BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] (30 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] gi|254040830|gb|ACT57626.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Score = 62.0 bits (149), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 MANNTGLSPIQAGEKRVNVDDKRILTNIVD Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254040522|gb|ACT57318.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254040641|gb|ACT57437.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 25/25 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRIL 25 MANNTGLSPIQAGEKRVNVDDKR+L Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRML 25 Searching..................................................done Results from round 2 CONVERGED! >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254040522|gb|ACT57318.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] gi|254040641|gb|ACT57437.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 57.0 bits (136), Expect = 8e-07, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 25/25 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRIL 25 MANNTGLSPIQAGEKRVNVDDKR+L Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRML 25 >gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] gi|254040830|gb|ACT57626.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 MANNTGLSPIQAGEKRVNVDDKRILTNIVD Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 >gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida fusca YX] gi|71917133|gb|AAZ57035.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX] Length = 354 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 20/28 (71%) Query: 3 NNTGLSPIQAGEKRVNVDDKRILTNIVD 30 N TGL IQ+G RV+V+DKR++ + D Sbjct: 5 NTTGLGEIQSGAARVDVEDKRMINSRAD 32 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.310 0.137 0.387 Lambda K H 0.267 0.0415 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 579,410,175 Number of Sequences: 14124377 Number of extensions: 9495758 Number of successful extensions: 8882 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8877 Number of HSP's gapped (non-prelim): 5 length of query: 30 length of database: 4,842,793,630 effective HSP length: 5 effective length of query: 25 effective length of database: 4,772,171,745 effective search space: 119304293625 effective search space used: 119304293625 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 75 (33.5 bits)