BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 132 bits (331), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS Sbjct: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 Query: 61 YVYTF 65 YVYTF Sbjct: 61 YVYTF 65 >gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 36.6 bits (83), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%) Query: 2 TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53 T WL LQ DF + R Q + LITD N+SA+ ++ DKNI G Sbjct: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203 Query: 54 IVKMDLSYVYTF 65 + K+ L YVY F Sbjct: 204 VTKIGLDYVYKF 215 >gi|254780855|ref|YP_003065268.1| NADH dehydrogenase subunit D [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 22.7 bits (47), Expect = 1.3, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 10 DFGVVLIGDKAFNTYRSQLR 29 +FGV LI D YR ++R Sbjct: 339 EFGVYLISDGGNKPYRCKIR 358 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 6 KLQRDFGVVL 15 KLQ DFG++L Sbjct: 287 KLQSDFGIIL 296 >gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 20.4 bits (41), Expect = 6.4, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 31 LITDNLSALISSDKNITESGKEGIVK 56 +IT +L+ LIS+ + K+GI+K Sbjct: 206 MITHDLNNLISTCNRVAVIQKKGIMK 231 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,907 Number of Sequences: 1233 Number of extensions: 1210 Number of successful extensions: 7 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 65 length of database: 328,796 effective HSP length: 36 effective length of query: 29 effective length of database: 284,408 effective search space: 8247832 effective search space used: 8247832 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)