RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781156|ref|YP_003065569.1| hypothetical protein CLIBASIA_05315 [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >gnl|CDD|147015 pfam04652, DUF605, Vta1 like. Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region. Length = 312 Score = 28.5 bits (64), Expect = 0.76 Identities = 25/100 (25%), Positives = 34/100 (34%), Gaps = 6/100 (6%) Query: 47 PFTKSSPYNNSVSNTVNNTPRVPD--VSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASS 104 P + S S S + P P+ S +SS AP S +V P S+ S Sbjct: 179 PASASPSDPPSSSPGEPSFPSPPEDPPSPADSSLPPAPSSFQSVPPPPSPESPSNPSPPP 238 Query: 105 STHASPPPHFEQKHIS----RTRIDSSPPPGHIDPHPDHI 140 S A P + + + P G I P D I Sbjct: 239 SPFAPSSPPVPSSPTAKPTPPSAPATPAPAGGITPDDDAI 278 >gnl|CDD|48222 cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 182 Score = 28.6 bits (64), Expect = 0.83 Identities = 7/28 (25%), Positives = 11/28 (39%) Query: 126 SSPPPGHIDPHPDHIRNTLALHRKMLEQ 153 + G +D IR+ LH L+ Sbjct: 99 TGKRLGLLDNWLRPIRDVYRLHAAELDA 126 >gnl|CDD|146567 pfam03999, MAP65_ASE1, Microtubule associated protein (MAP65/ASE1 family). Length = 619 Score = 27.5 bits (61), Expect = 1.6 Identities = 15/75 (20%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Query: 56 NSVSNTVNNTPRVPDVSEMNSSRGSA-PQSHVNVSSPHYKHEYSSSSASSSTHASPPPHF 114 S + + + S SS GS +S + + ++++ S P Sbjct: 533 RSSKGNLIRSGANGNASSDLSSPGSINSKSPEHSVPLVRVFDIHLRASTTKGRHSTPSTN 592 Query: 115 EQKHISRTRIDSSPP 129 E+K R SPP Sbjct: 593 EKKKRLLKRSPLSPP 607 >gnl|CDD|145999 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit. Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription. Length = 334 Score = 27.4 bits (61), Expect = 1.7 Identities = 11/81 (13%), Positives = 18/81 (22%), Gaps = 4/81 (4%) Query: 63 NNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEY----SSSSASSSTHASPPPHFEQKH 118 VP + N + Q ++ + Y S S A + Sbjct: 119 LYQVTVPVMVTQNPANSERDQPAQQRAAQQLQQRYGAPASGQLPSQQQSAQKNDESPLQQ 178 Query: 119 ISRTRIDSSPPPGHIDPHPDH 139 I G D + Sbjct: 179 QPNGLIQPQQTDGAGDDEEEA 199 >gnl|CDD|35720 KOG0499, KOG0499, KOG0499, Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 815 Score = 27.3 bits (60), Expect = 2.0 Identities = 12/79 (15%), Positives = 20/79 (25%), Gaps = 7/79 (8%) Query: 69 PDVSEMNSSRGSAPQSHVNVSSPH------YKHEYSSSSASSSTHASPPPHFEQKHISRT 122 +VS + + S P +S ++ST P P + Sbjct: 22 SEVSRQKAEEPTELSEKEWKSPPQEESPDLEAPANASKEPAASTRPLPYPEDRPPEVVIQ 81 Query: 123 RIDSSPPP-GHIDPHPDHI 140 + P D H Sbjct: 82 IDEVESPITVLPDEQDAHE 100 >gnl|CDD|35384 KOG0162, KOG0162, KOG0162, Myosin class I heavy chain [Cytoskeleton]. Length = 1106 Score = 26.5 bits (58), Expect = 3.2 Identities = 12/77 (15%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Query: 71 VSEMNSSRGSAPQSHVNVSSPHYKHEYSS---SSASSSTHASPPPHFEQKHISRTRIDSS 127 ++ G P S + P YSS ++++ + A ++ S Sbjct: 914 SLTVSVGTGLPPNSKPSRKKPRKATGYSSGRDAASTPTRRAPQNKQAYGQNGVSPAAKGS 973 Query: 128 PPPGHIDPHPDHIRNTL 144 P P + + R Sbjct: 974 PLPAQKPVNTYNQRPPP 990 Score = 25.3 bits (55), Expect = 8.0 Identities = 16/111 (14%), Positives = 27/111 (24%), Gaps = 3/111 (2%) Query: 24 SGSSFGCCGEFKKKASSPRIHMRPF--TKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSA 81 G F K S + + S P + S Sbjct: 898 FGIDFEDLKVLKDIYKSLTVSVGTGLPPNSKPSRKKPRKATGYSSGRDAASTPTRRAPQN 957 Query: 82 PQSHV-NVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPG 131 Q++ N SP K + +T+ PP + + + P Sbjct: 958 KQAYGQNGVSPAAKGSPLPAQKPVNTYNQRPPPVSTSTTTSQQPSARPSSK 1008 >gnl|CDD|36433 KOG1219, KOG1219, KOG1219, Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]. Length = 4289 Score = 26.1 bits (57), Expect = 4.0 Identities = 18/116 (15%), Positives = 34/116 (29%), Gaps = 7/116 (6%) Query: 34 FKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVS-------EMNSSRGSAPQSHV 86 +KK S + N +V V + S + N S+ + + Sbjct: 4015 CRKKNSRKKYGAHCPVDLLRRNTNVYVPVVPQVPLRPRSYTSRNNLDSNFISTSSVPTEL 4074 Query: 87 NVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRN 142 P + S + + P + I + DS G +D + R+ Sbjct: 4075 VTFRPESQVRPVVCSVAPNLPPPSPCGSDSDSIRKDPWDSDYDFGRVDETANRSRH 4130 >gnl|CDD|34211 COG4573, GatZ, Predicted tagatose 6-phosphate kinase [Carbohydrate transport and metabolism]. Length = 426 Score = 26.1 bits (57), Expect = 4.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Query: 136 HPDHIRNTLALHRKMLEQS 154 P+ RNTL HRK E Sbjct: 192 TPEAARNTLRAHRKAFEAR 210 >gnl|CDD|38739 KOG3531, KOG3531, KOG3531, Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms]. Length = 1036 Score = 26.1 bits (57), Expect = 4.2 Identities = 25/99 (25%), Positives = 34/99 (34%), Gaps = 9/99 (9%) Query: 34 FKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHY 93 F++K S R SSPY V R + E N + +V+ S PH Sbjct: 361 FERKHSKSHSTRRG-LYSSPYGLVSD--VPEQHRNGSLYEANGTDSYNKHQNVHSSEPHI 417 Query: 94 KHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGH 132 + S T SP SRT ++ P H Sbjct: 418 ASSQPADHPFSGTLDSPAGK------SRTGAPATSPTQH 450 >gnl|CDD|37513 KOG2302, KOG2302, KOG2302, T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1956 Score = 25.8 bits (56), Expect = 4.8 Identities = 11/60 (18%), Positives = 17/60 (28%) Query: 80 SAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDH 139 + QS H Y S S + P + R + H DP ++ Sbjct: 927 GSYQSRGISDYSSEYHSYDQDSHPSERSSGDHPWGTSYAWTSRRSSWNQSLKHQDPSGEY 986 >gnl|CDD|40019 KOG4822, KOG4822, KOG4822, Predicted nuclear membrane protein involved in mRNA transport and sex determination via splicing modulation [RNA processing and modification, Signal transduction mechanisms]. Length = 1906 Score = 25.8 bits (56), Expect = 5.1 Identities = 17/102 (16%), Positives = 30/102 (29%), Gaps = 7/102 (6%) Query: 40 SPRIHMRP-FTKSSPYNNSVSNTVNNTPRVPDVSEMNSSR--GSAPQSHVNVSSPHYKHE 96 P H+RP + VS + N ++P + +M + G P S ++ ++ Sbjct: 1778 QPPQHVRPPIQINRGSRQGVS--MQNRFQIP-MHQMQLMQRTGVQPSSWISQVQQQGQYH 1834 Query: 97 YSSSSASSSTHASPPPHFEQKHIS-RTRIDSSPPPGHIDPHP 137 + T R I P P Sbjct: 1835 AVQGQQGAGTSQQQESGMSSHDYFKSPRARQYRVRQLILPSP 1876 >gnl|CDD|31990 COG1805, NqrB, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrB [Energy production and conversion]. Length = 400 Score = 25.7 bits (56), Expect = 5.4 Identities = 6/22 (27%), Positives = 11/22 (50%) Query: 130 PGHIDPHPDHIRNTLALHRKML 151 PG + H+R+ + R M+ Sbjct: 35 PGTVTSKAPHVRDAVDSKRMMI 56 >gnl|CDD|36303 KOG1087, KOG1087, KOG1087, Cytosolic sorting protein GGA2/TOM1 [Intracellular trafficking, secretion, and vesicular transport]. Length = 470 Score = 25.8 bits (56), Expect = 5.7 Identities = 12/72 (16%), Positives = 20/72 (27%), Gaps = 3/72 (4%) Query: 48 FTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTH 107 + S S + +S P + + SSP S+ S+ Sbjct: 385 NSPGSSPQESFPPLPQIQKSSTSPPQSDSLMIEQPLTPASKSSPRSSSSASTGSSPQYDV 444 Query: 108 AS---PPPHFEQ 116 A P +Q Sbjct: 445 AKSQLSPNSIQQ 456 >gnl|CDD|39506 KOG4305, KOG4305, KOG4305, RhoGEF GTPase [Signal transduction mechanisms]. Length = 1029 Score = 25.7 bits (56), Expect = 5.7 Identities = 15/91 (16%), Positives = 32/91 (35%) Query: 38 ASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEY 97 S + +S S+ ++ + S +S + +S ++ + Sbjct: 46 QHSASGSPSSSSSTSGSTMSLKSSFYSKESSSSSSSPFNSPHKPSFIGSSSNSHNHHSAH 105 Query: 98 SSSSASSSTHASPPPHFEQKHISRTRIDSSP 128 S ++ S TH S P +S + S+P Sbjct: 106 SRYTSVSLTHLSRSPSPSNSALSLSPSKSTP 136 >gnl|CDD|99996 cd04300, GT1_Glycogen_Phosphorylase, This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.. Length = 797 Score = 25.5 bits (57), Expect = 5.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 56 NSVSNTVNNTPRVPD 70 N+V++ VNN P V D Sbjct: 593 NAVADVVNNDPDVGD 607 >gnl|CDD|32303 COG2120, COG2120, Uncharacterized proteins, LmbE homologs [Function unknown]. Length = 237 Score = 25.4 bits (55), Expect = 6.0 Identities = 10/25 (40%), Positives = 11/25 (44%), Gaps = 2/25 (8%) Query: 119 ISRTRIDS--SPPPGHIDPHPDHIR 141 I R R D +P P HPDH Sbjct: 105 IRRLRPDVVFTPYPDDGYGHPDHRA 129 >gnl|CDD|38944 KOG3740, KOG3740, KOG3740, Uncharacterized conserved protein [Function unknown]. Length = 706 Score = 25.1 bits (54), Expect = 7.7 Identities = 15/71 (21%), Positives = 26/71 (36%), Gaps = 1/71 (1%) Query: 43 IHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSA 102 I R + + VS T +P + V + SS+G+ + + + +PH S Sbjct: 524 IEQRLAQQVARLLAEVSPTSAASPALSQVIK-ASSQGTQSRGTLALQAPHQFQMQGLSGL 582 Query: 103 SSSTHASPPPH 113 P H Sbjct: 583 WRGVPRQPTRH 593 >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional. Length = 403 Score = 24.9 bits (55), Expect = 8.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 9 TSSLMFFFLSSGYALSGS 26 TS+LMF+ + Y +S S Sbjct: 277 TSTLMFYLIGEFYHISKS 294 >gnl|CDD|35786 KOG0566, KOG0566, KOG0566, Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport]. Length = 1080 Score = 24.9 bits (54), Expect = 10.0 Identities = 12/92 (13%), Positives = 22/92 (23%), Gaps = 6/92 (6%) Query: 46 RPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSS 105 + S + N+ S +++ S P +S P S + Sbjct: 991 SARSPSPSAKSPSPTEAPNSSSTSMPSPASAATLSGPWY--VISKPLA----PPQSNNGL 1044 Query: 106 THASPPPHFEQKHISRTRIDSSPPPGHIDPHP 137 +P P P + P Sbjct: 1045 NQQAPAPLPPPAPPPPPVGAPLGPGPPLPNVP 1076 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.311 0.124 0.365 Gapped Lambda K H 0.267 0.0635 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,852,471 Number of extensions: 83999 Number of successful extensions: 304 Number of sequences better than 10.0: 1 Number of HSP's gapped: 292 Number of HSP's successfully gapped: 74 Length of query: 154 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 68 Effective length of database: 4,405,363 Effective search space: 299564684 Effective search space used: 299564684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (24.4 bits)