RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781156|ref|YP_003065569.1| hypothetical protein CLIBASIA_05315 [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >1q74_A 1D-MYO-inosityl 2-acetamido-2-deoxy-alpha-D- glucopyranoside deacetylase (MSHB); rossmann fold, zinc aminohydrolase; HET: PE4; 1.70A {Mycobacterium tuberculosis} (A:) Length = 303 Score = 26.0 bits (56), Expect = 2.2 Identities = 7/34 (20%), Positives = 9/34 (26%), Gaps = 2/34 (5%) Query: 117 KHISRTRIDS--SPPPGHIDPHPDHIRNTLALHR 148 I R + P HPDH+ Sbjct: 123 AIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTA 156 >3dfi_A Pseudoaglycone deacetylase DBV21; single alpha-beta domain, hydrolase; 2.10A {} (A:) Length = 270 Score = 26.0 bits (56), Expect = 2.3 Identities = 7/32 (21%), Positives = 8/32 (25%) Query: 117 KHISRTRIDSSPPPGHIDPHPDHIRNTLALHR 148 I+ I HPDH A Sbjct: 139 SMIAECDPTLVLTCVAIGKHPDHKATRDATLL 170 >3dff_A Teicoplanin pseudoaglycone deacetylases ORF2; lipoglycopeptide, zinc dependent, hydrolase; HET: MSE PG4; 1.60A {Actinoplanes teichomyceticus} PDB: 3dfk_A* 3dfm_A (A:) Length = 273 Score = 26.0 bits (56), Expect = 2.6 Identities = 6/24 (25%), Positives = 6/24 (25%) Query: 117 KHISRTRIDSSPPPGHIDPHPDHI 140 I I HPDH Sbjct: 142 SIIDEFDPTLVVTCAAIGEHPDHE 165 >1y2i_A Hypothetical protein S0862; structural genomics, pentamer, protein structure initiative, PSI, midwest center for structural genomics; 2.30A {Shigella flexneri 2a str} (A:) Length = 133 Score = 25.9 bits (57), Expect = 2.8 Identities = 5/31 (16%), Positives = 7/31 (22%), Gaps = 3/31 (9%) Query: 113 HFEQKHISRTRIDSSPPPGHIDPHPDHIRNT 143 H H S +D +T Sbjct: 2 HHHHHHSS--GVDLGTEN-LYFQSNAXQFST 29 >1uan_A Hypothetical protein TT1542; rossmann-like, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.00A {Thermus thermophilus} (A:) Length = 227 Score = 25.5 bits (55), Expect = 4.0 Identities = 8/30 (26%), Positives = 11/30 (36%) Query: 116 QKHISRTRIDSSPPPGHIDPHPDHIRNTLA 145 + + R R P D HPDH + Sbjct: 88 AQALRRLRPRVVFAPLEADRHPDHTAASRL 117 >2ixd_A LMBE-related protein; hexamer, deacetylase, rossman fold, zinc-dependent metalloenzyme, hydrolase; 1.8A {Bacillus cereus} (A:) Length = 242 Score = 25.1 bits (54), Expect = 4.2 Identities = 8/32 (25%), Positives = 11/32 (34%) Query: 117 KHISRTRIDSSPPPGHIDPHPDHIRNTLALHR 148 K I + P + D HPDH + Sbjct: 91 KVIRTYKPKLVFAPYYEDRHPDHANCAKLVEE 122 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.311 0.124 0.365 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,144,628 Number of extensions: 45729 Number of successful extensions: 299 Number of sequences better than 10.0: 1 Number of HSP's gapped: 264 Number of HSP's successfully gapped: 47 Length of query: 154 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 73 Effective length of database: 2,217,844 Effective search space: 161902612 Effective search space used: 161902612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.6 bits)