BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781157|ref|YP_003065570.1| hypothetical protein CLIBASIA_05320 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781157|ref|YP_003065570.1| hypothetical protein CLIBASIA_05320 [Candidatus Liberibacter asiaticus str. psy62] gi|254040834|gb|ACT57630.1| hypothetical protein CLIBASIA_05320 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 175 bits (443), Expect = 2e-42, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MSKFVVRIMFLLSAISSNPILAANEHSSVSEQKRKETTVGFISRLVNKRPVANKRCPNAT 60 MSKFVVRIMFLLSAISSNPILAANEHSSVSEQKRKETTVGFISRLVNKRPVANKRCPNAT Sbjct: 1 MSKFVVRIMFLLSAISSNPILAANEHSSVSEQKRKETTVGFISRLVNKRPVANKRCPNAT 60 Query: 61 KQTPPDHGSKYDTREVLMLFGGLNN 85 KQTPPDHGSKYDTREVLMLFGGLNN Sbjct: 61 KQTPPDHGSKYDTREVLMLFGGLNN 85 >gi|156071430|ref|NP_001092978.1| vomeronasal 2 receptor 61 [Rattus norvegicus] Length = 855 Score = 35.1 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 9/88 (10%) Query: 3 KFVVRIMFLLSAISSNPILAANE------HSSVSEQKRKETTVGFISRLVNK-RPVANKR 55 +FV+ ++F + I+ NPIL N HS+ S + +ET + F+ L + R + N Sbjct: 74 QFVMALIFAIEEINRNPILLPNMTLGYDIHSAGSIE--RETVICFLKWLTGQNRLIPNYT 131 Query: 56 CPNATKQTPPDHGSKYDTREVLMLFGGL 83 C K G+ ++ ++ +F GL Sbjct: 132 CKTEEKSVTAITGTTWEISSLIAIFLGL 159 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.317 0.130 0.365 Lambda K H 0.267 0.0402 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 651,210,637 Number of Sequences: 14124377 Number of extensions: 17582246 Number of successful extensions: 36521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 36520 Number of HSP's gapped (non-prelim): 2 length of query: 85 length of database: 4,842,793,630 effective HSP length: 55 effective length of query: 30 effective length of database: 4,065,952,895 effective search space: 121978586850 effective search space used: 121978586850 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 75 (33.5 bits)