RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781157|ref|YP_003065570.1| hypothetical protein CLIBASIA_05320 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional. Length = 1490 Score = 25.7 bits (56), Expect = 2.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 16 SSNPILAANEHSSVSEQKRKET 37 SS+ +A + H SVS+++R T Sbjct: 298 SSDVFIARSHHGSVSKEQRAIT 319 >gnl|CDD|184974 PRK15012, PRK15012, menaquinone-specific isochorismate synthase; Provisional. Length = 431 Score = 25.2 bits (55), Expect = 3.7 Identities = 10/41 (24%), Positives = 16/41 (39%) Query: 26 HSSVSEQKRKETTVGFISRLVNKRPVANKRCPNATKQTPPD 66 S S Q F++ LV+ +P+ +Q PD Sbjct: 128 FSESSLQHDAIQAKEFLATLVSIKPLPGLHLTTTREQHWPD 168 >gnl|CDD|177467 PHA02685, PHA02685, ORF065 virion protein; Provisional. Length = 155 Score = 24.6 bits (53), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 59 ATKQTPPDHGSKYDTRE 75 A ++ PPD GS D RE Sbjct: 102 AAREPPPDDGSPIDARE 118 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0624 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,246,531 Number of extensions: 57420 Number of successful extensions: 98 Number of sequences better than 10.0: 1 Number of HSP's gapped: 98 Number of HSP's successfully gapped: 6 Length of query: 85 Length of database: 5,994,473 Length adjustment: 54 Effective length of query: 31 Effective length of database: 4,827,641 Effective search space: 149656871 Effective search space used: 149656871 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)