>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus. In the E. coli cytosol, a fraction of the newly synthesized proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent p

Probab=94.63 E-value=0.29 Score=26.06 Aligned_cols=110 Identities=11% Similarity=0.108 Sum_probs=71.0 Q ss_pred ECCHHHHHHHHHHHHHHHHHHCCC-CCCHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH Q ss_conf 848999999999999999987088-999789----------986013899999999999999999984982488999999 Q gi|254781158|r 50 KVPFSSFINSWKQELGMISQKIGF-VVNSER----------ARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGE 118 (631) Q Consensus 50 ~I~~~~f~~~~~~~~~~~~~~~g~-~~~~~~----------~~~~~l~~qvl~~li~~~ll~~~a~~~gi~vsd~~v~~~ 118 (631) T Consensus 40 evP~~~v~~e~~~~~~~~~~~~~~~g~~~e~~~~~~~~~~e~~~~~~~~~A~~~vk~~lil~~Ia~~e~i~vs~eev~~~ 119 (162) T pfam05698 40 ELPESLVEEEIDRLLRQFLQQLQGQGLDLEEYLSLSGSSEEELREEFKEEAEKRVKLGLILEEIAKEEKIEVTDEEIKEE 119 (162) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH T ss_conf 99999999999999999999987669988888765256478887888999999999999999999880899899999999 Q ss_pred HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 96347655421023989999999861100567767888775444555430 Q gi|254781158|r 119 IARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMF 168 (631) Q Consensus 119 i~~~p~Fq~~~G~Fd~~~~~~~L~~~g~t~~~~~~~~~~~l~~~~l~~~~ 168 (631) T Consensus 120 i~~~a----~~~~~~~~~i~~~~~~~~~-----l~~l~~~ll~~K~~d~l 160 (162) T pfam05698 120 IEELA----SQYGMEPEEVKEFYKKNEQ-----LSALKEDLLEEKAVDLL 160 (162) T ss_pred HHHHH----HHCCCCHHHHHHHHHCCHH-----HHHHHHHHHHHHHHHHH T ss_conf 99999----8869999999999975556-----99999999999999997

HHsearch alignment for GI: 254781158 and conserved domain: pfam05698