RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781159|ref|YP_003065572.1| hypothetical protein CLIBASIA_05330 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 326 Score = 26.1 bits (58), Expect = 2.2 Identities = 11/44 (25%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Query: 2 WRRV---FAITLFSSIPLQKISF--LPQIFSLIITCGAQGKYCV 40 WRR+ T + Q+I+ LP+ I+ G+ V Sbjct: 281 WRRLATDLKPTQLLNEIKQEITLDELPEALKQILQGRVTGRTVV 324 >gnl|CDD|35428 KOG0207, KOG0207, KOG0207, Cation transport ATPase [Inorganic ion transport and metabolism]. Length = 951 Score = 25.7 bits (56), Expect = 2.6 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 2 WRRVFAITLFSSIPLQKISFLPQIFSLII 30 W+R F I+L S+P+ SF I + Sbjct: 234 WKRPFLISLGFSLPV---SFAMIICPPLA 259 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.137 0.414 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 742,691 Number of extensions: 27388 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's gapped: 112 Number of HSP's successfully gapped: 9 Length of query: 67 Length of database: 6,263,737 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,442,595 Effective search space: 157835255 Effective search space used: 157835255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.5 bits)