HHsearch alignment for GI: 254781160 and conserved domain: COG1385

>COG1385 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=100.00  E-value=0  Score=421.88  Aligned_cols=237  Identities=37%  Similarity=0.554  Sum_probs=207.6

Q ss_pred             CCCCEEEECCCCCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCC-CEEEEEEEECC-CCCCCCC
Q ss_conf             778777408544788889987798759987035789888999977998798753023555-23899754135-5554431
Q gi|254781160|r    5 SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRS-QTKQSDV   82 (245)
Q Consensus         5 ~~m~R~f~~~~l~~~~~i~L~~~~~hHl~kVlRlk~Gd~i~i~dg~g~~~~~~I~~~~k~-~~~~i~~~~~~-~~~~~~i   82 (245)
T Consensus         1 ~~~~~~~v~~~~~~~~~~~l~~~~~~Hl~~VlRl~~gd~l~l~~g~g~~~~a~i~~~~kk~~~~~i~~~~~~~~e~~~~i   80 (246)
T COG1385           1 MRMPRLFVDEELAEGATVILTGDEAHHLKRVLRLKEGDELRLFDGSGGEFLAEITKIGKKEALLKIVEQLEPNPELPLKI   80 (246)
T ss_pred             CCCEEEEECCCCCCCCEEEECCHHHHHHHHEEECCCCCEEEEEECCCCEEEEEEECCCCCCEEEEEEECCCCCCCCCCEE
T ss_conf             97406863464467977997632443267446667899899995899699999810467716999864145677888607


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHH--H---HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             354134454115677754444566565555420220112--2---12233578899997512344343320000001123
Q gi|254781160|r   83 QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH--Y---NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK  157 (245)
Q Consensus        83 ~l~~~~~k~~~~~~ilqk~tELGV~~I~p~~~~rs~~~~--~---k~eR~~~ii~eA~eQsgr~~lP~i~~~~~l~~~l~  157 (245)
T Consensus        81 ~l~~~~~kg~k~d~iiqkatELGv~~i~p~~ter~~~k~~~~~~~kler~~ki~ieAaEQs~R~~vP~I~~~~~~~~~l~  160 (246)
T COG1385          81 TLAQAIPKGDKLELIIQKATELGVSKIIPLITERSVVKLDGKKAAKLERWQKIAIEAAEQSGRNVVPEIKPPESLKELLK  160 (246)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHCCCEEEEEEECEEEEEHHCCHHHHHHHHHHHHHHHHHHCCCCCCCEEECHHHHHHHHH
T ss_conf             99996275188999999998718011798850126772001103689999999999998649986982623130999998


Q ss_pred             CCCCCC--CCCCCCCHHCCCCCHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHH
Q ss_conf             332233--321263000121102221003678835999888888888999999957995586368874004489999999
Q gi|254781160|r  158 NWDHNC--QIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA  235 (245)
Q Consensus       158 ~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~IGPEGGfs~~E~~~l~~~~~~~~vsLG~~ILR~ETA~i~als  235 (245)
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~i~iiIGPEGGfs~~Ei~~l~~~g~-~~v~LGprILRtETA~l~ala  238 (246)
T COG1385         161 EIDDEDALKLIYEEKAKEGLLALPLL-EALPEGKVLLIIGPEGGFSEDEIELLREAGF-TPVSLGPRILRTETAALAALA  238 (246)
T ss_pred             HCCCHHHHHHEECCCCCCCCCCCHHH-HCCCCCCEEEEECCCCCCCHHHHHHHHHCCC-EEECCCCCEEEHHHHHHHHHH
T ss_conf             54630013322254454454333012-0156773899988998999899999997798-581378972007789999999


Q ss_pred             HHHHHHCC
Q ss_conf             99998478
Q gi|254781160|r  236 LVQAICGD  243 (245)
Q Consensus       236 ~~~~~~g~  243 (245)
T Consensus       239 ~i~~~~~~  246 (246)
T COG1385         239 ALQALLGD  246 (246)
T ss_pred             HHHHHHCC
T ss_conf             99997349