HHsearch alignment of GI: 254781160 and MMDB domain: 1v6z_A_1-67

>1v6z_A (A:1-67) Hypothetical protein TTHA0657; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.00A {Thermus thermophilus HB8}
Probab=97.09  E-value=0.0021  Score=42.45  Aligned_cols=60  Identities=27%  Similarity=0.393  Sum_probs=46.0

Q ss_pred             CCCEEEECCCCCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCCCEEEEEE
Q ss_conf             787774085447888899877987599870357898889999779987987530235552389975
Q gi|254781160|r    6 HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEY   71 (245)
Q Consensus         6 ~m~R~f~~~~l~~~~~i~L~~~~~hHl~kVlRlk~Gd~i~i~dg~g~~~~~~I~~~~k~~~~~i~~   71 (245)
                      +-||-|.+.-     +-.|.-.+.|||..|||.++||.+.+|||+ .++.|++.+.+......+.+
T Consensus         2 RPHRAf~p~l-----~~~l~LrE~~HL~dVLRAr~GD~~TVFDg~-~E~~A~V~~~~p~~~~~~~e   61 (67)
T 1v6z_A            2 RPHRAFSPGL-----TGVLPLRETRHLVEVLRARVGDRFTVFDGE-REALAEVVDLGPPLRYRVLE   61 (67)
T ss_dssp             CCCEEECGGG-----CSBCCHHHHHHHHTTSCCCTTCEEEEECSS-CEEEEEEEECCSSCEEEEEE
T ss_pred             CCCEEECCCC-----EEECCHHHHHHHHHCCCCCCCCEEEEEECC-CCEEEEECCCCCCEEEEEEE
T ss_conf             9864708998-----675898997899962828999999999799-87788975256621246543