HHsearch alignment of GI: 254781160 and MMDB domain: 1vhk_A_1-77

>1vhk_A (A:1-77) Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis}
Probab=99.51  E-value=3.3e-14  Score=112.84  Aligned_cols=70  Identities=21%  Similarity=0.308  Sum_probs=60.6

Q ss_pred             CCCCEEEECCC---CCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCC-CEEEEEEEEC
Q ss_conf             77877740854---4788889987798759987035789888999977998798753023555-2389975413
Q gi|254781160|r    5 SHLKRLFVDFP---LCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSR   74 (245)
Q Consensus         5 ~~m~R~f~~~~---l~~~~~i~L~~~~~hHl~kVlRlk~Gd~i~i~dg~g~~~~~~I~~~~k~-~~~~i~~~~~   74 (245)
                      ..|||||++..   +..+..+.|+++++||+.||||+++||.|.|+||+|+.|.|+|+.++|+ +.+.+.....
T Consensus         1 ~sM~Rff~~~~~~~~~~~~~i~l~~~~~hHl~~VlR~~~Gd~i~l~dg~g~~~~a~I~~i~~~~~~~~i~e~~~   74 (77)
T 1vhk_A            1 XSLQRYFIELTKQQIEEAPTFSITGEEVHHIVNVXRXNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTN   74 (77)
T ss_dssp             ---CEEECSSCHHHHHSSSSEEEESHHHHHHHTTTCCCTTCEEEEECTTSCEEEEEEEEECSSEEEEEEEEECC
T ss_pred             CCCCEEEECCCHHHCCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEEEEECCCCCHHHHHHCC
T ss_conf             99748996788567356997996889988999807689999999993899889999999615663022233213