HHsearch alignment of GI: 254781160 and MMDB domain: 1vhy_A_78-257

>1vhy_A (A:78-257) Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae}
Probab=100.00  E-value=1.4e-45  Score=317.06  Aligned_cols=161  Identities=27%  Similarity=0.389  Sum_probs=144.8

Q ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHH------HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             443135413445411567775444456656555542022011------22122335788999975123443433200000
Q gi|254781160|r   79 QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAAEQCDILTLPFIYPPTTL  152 (245)
Q Consensus        79 ~~~i~l~~~~~k~~~~~~ilqk~tELGV~~I~p~~~~rs~~~------~~k~eR~~~ii~eA~eQsgr~~lP~i~~~~~l  152 (245)
                      +++++|+++++|+++|||+|||+|||||++|+|++|+||+++      .+|.+||++|+++|||||+|+++|+|.++.+|
T Consensus         2 ~~~i~l~~a~~K~~~~~~il~k~tELGv~~i~p~~s~rs~~~~~~~~~~~k~eR~~~i~~eA~kQs~r~~lp~i~~~~~l   81 (180)
T 1vhy_A            2 HLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLDAERXDKKIQQWQKIAIAACEQCGRNIVPEIRPLXKL   81 (180)
T ss_dssp             SSCEEEEEEC----CCHHHHHHHHHTTCCEEEEEECTTSSSCCCHHHHHHHHHHHHHHHHHHHHHHCCSSCCEECCCEEH
T ss_pred             CEEEEEEEEECCCCCHHHHHHHHHHEEEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH
T ss_conf             11477776520655199999875243101589998501504353557777588999999999986078644420211001


Q ss_pred             CCCCCCCCCCCCCCCCCCHHCCCCCHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHH
Q ss_conf             01123332233321263000121102221003678835999888888888999999957995586368874004489999
Q gi|254781160|r  153 EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA  232 (245)
Q Consensus       153 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~IGPEGGfs~~E~~~l~~~~~~~~vsLG~~ILR~ETA~i~  232 (245)
                      +++++..+.+..++++++....   .... .....++++++||||||||++|+++|+++|| .+||||++|||+|||+++
T Consensus        82 ~~~l~~~~~~~~~~~~~~~~~~---~~~~-~~~~~~~v~i~IGPEGGfs~~E~~~~~~~g~-~~vsLG~~ILR~ETA~i~  156 (180)
T 1vhy_A           82 QDWCAENDGALKLNLHPRAHYS---IKTL-PTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLA  156 (180)
T ss_dssp             HHHHTCCSSCEEEEECTTCCCB---GGGC-CCCCTTCEEEEECCTTCCCHHHHHHHHHTTC-EEEBCCSSCCCHHHHHHH
T ss_pred             HHHHHCCCCCHHHHCCCCCCHH---HHHH-HCCCCCCEEEEECCCCCCCHHHHHHHHHCCC-EEEECCCCCCHHHHHHHH
T ss_conf             4555303330010002100022---4443-1156674589984777889899999998798-886668980667879999


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999984786
Q gi|254781160|r  233 AMALVQAICGDW  244 (245)
Q Consensus       233 als~~~~~~g~~  244 (245)
                      ++|++++.+|||
T Consensus       157 als~~~~~~~~~  168 (180)
T 1vhy_A          157 AISALQICFGDL  168 (180)
T ss_dssp             HHHHHHHHHSGG
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999984865