HHsearch alignment of GI: 254781160 and MMDB domain: 2qwv_A_

>2qwv_A (A:) UPF0217 protein VC_A1059; unknown function, structural genomics, PSI- 2, protein structure initiative; 2.60A {Vibrio cholerae o1 biovar eltor str}
Probab=94.39  E-value=0.043  Score=33.90  Aligned_cols=109  Identities=15%  Similarity=0.181  Sum_probs=71.9

Q ss_pred             HH-HHHHHHHHHHHHCC-------CCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCHHCCCCCHHHHHCCCCCCCEEEEEC
Q ss_conf             23-35788999975123-------44343320-00000112333223332126300012110222100367883599988
Q gi|254781160|r  125 DR-VRTYTISAAEQCDI-------LTLPFIYP-PTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG  195 (245)
Q Consensus       125 eR-~~~ii~eA~eQsgr-------~~lP~i~~-~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~IG  195 (245)
                      || .-..++.|.+.+..       -..|-|.. -.+|+++++.......+++.++...+      +-......+.+++.|
T Consensus        87 Ers~a~~I~kAL~~~~~~~~~~~~e~~pGi~V~~~~fe~ll~~l~e~~~ly~L~e~G~~------i~~~~~~~n~~FvLg  160 (208)
T 2qwv_A           87 EAALIALLVKALDASVGXGKEQTRVVQPGLTVRTISFEALLGELAEHHSLYXXDKKGDS------IRDIKIGPNPCFILT  160 (208)
T ss_dssp             HHHHHHHHHHHHHHTTTCCTTCEEEEETTEEEECCCHHHHHHHHHTTSEEEEEEEEEEE------TTTSCCCSSEEEEEC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEECCCEEEECCCHHHHHHHHHCCCCEEEECCCCCC------HHHCCCCCCCEEEEE
T ss_conf             89999999998636578887513674799899488899999998558978998899995------310668899879960


Q ss_pred             CCCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             888888899999995799558636887400448999999999998
Q gi|254781160|r  196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI  240 (245)
Q Consensus       196 PEGGfs~~E~~~l~~~~~~~~vsLG~~ILR~ETA~i~als~~~~~  240 (245)
                      --=||+++|.++++..+. ..+||||..|=|+.+.+++.-.+--.
T Consensus       161 DH~~~~~ee~~~L~~~~~-~~iSlGP~~l~AshcI~~vhn~LDr~  204 (208)
T 2qwv_A          161 DHIPXPKKSGNSXKRLGV-EKISLGPKXLFASQCVTLIHNEIDHQ  204 (208)
T ss_dssp             C----------CTTTTTC-EEEECCSSCCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCCC-CEEEECCHHHHHHHHHHHHHHHHHCC
T ss_conf             899989789999986388-23754607888758999999987123