HHsearch alignment of GI: 254781160 and MMDB domain: 3kw2_A_75-257

>3kw2_A (A:75-257) Probable R-RNA methyltransferase; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE ADN; 2.00A {Porphyromonas gingivalis atcc 33277}
Probab=100.00  E-value=1.4e-45  Score=319.17  Aligned_cols=165  Identities=21%  Similarity=0.339  Sum_probs=145.1

Q ss_pred             CCCCEEEECCCCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             4431354134454-115677754444566565555420220112212233578899997512344343320000001123
Q gi|254781160|r   79 QSDVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK  157 (245)
Q Consensus        79 ~~~i~l~~~~~k~-~~~~~ilqk~tELGV~~I~p~~~~rs~~~~~k~eR~~~ii~eA~eQsgr~~lP~i~~~~~l~~~l~  157 (245)
                      ++.++|++++||+ ++|||+|||+|||||++|+|+.|+||+++.+|.+||++|+++|||||||+++|+|..|.+|.++++
T Consensus         2 p~~i~L~~~~pK~~~r~d~il~k~tELGV~~i~p~~s~rs~~~~~k~~r~~~ii~ea~kQs~r~~~P~I~~~~~~~~~l~   81 (183)
T 3kw2_A            2 RDRITIAIAPTKQSERXEWXLEKLVEIGVDEVVFIESEHSERRRIKAERLERIAISAXKQSLKASFPVIRVNIPIQTVIA   81 (183)
T ss_dssp             CSCEEEEECCCSSHHHHHHHHHHHHHHCCSEEEEEECTTSCCSCCCHHHHHHHHHHHHHHTTCSBCCEEEEEEEHHHHHH
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCHHHHHH
T ss_conf             75258998123441179999999881184489953035402444457789999999999737663867735658899997


Q ss_pred             CCCCCCCCCCCCCHHCCCCCHHH-----HHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHH
Q ss_conf             33223332126300012110222-----1003678835999888888888999999957995586368874004489999
Q gi|254781160|r  158 NWDHNCQIVFADETCGSENSLEK-----LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA  232 (245)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~i~i~IGPEGGfs~~E~~~l~~~~~~~~vsLG~~ILR~ETA~i~  232 (245)
                      .....+..+++++..........     .......++++++||||||||++|+++|+++|| .+|+||++|||+|||+++
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~i~VGPEGGfs~~E~~~l~~~gf-~~vsLG~rILR~ETA~i~  160 (183)
T 3kw2_A           82 DTPKAAVRLIAYVDEAVRAEITQGRGYPSDFYHVGQDVLILIGPEGDFSPSEVESALLAGF-APVSLGESRLRTETAGLV  160 (183)
T ss_dssp             HSCTTSEEEEECCCTTCC-----CCCCGGGTCCTTSCEEEEECCTTCCCHHHHHHHHHHTC-EEECCCSSCCCHHHHHHH
T ss_pred             HCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCC-EEEECCCCCCHHHHHHHH
T ss_conf             3710253220101331012344310242124236882799988998999999999998799-898679981567859999


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999984786
Q gi|254781160|r  233 AMALVQAICGDW  244 (245)
Q Consensus       233 als~~~~~~g~~  244 (245)
                      ++|++++++|||
T Consensus       161 als~~~~~~~~~  172 (183)
T 3kw2_A          161 ACQWIHTLQACY  172 (183)
T ss_dssp             HHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999998664