HHsearch results for GI: 254781160 and protein with PDBid: 1vhk_A

>1vhk_A Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis} SCOP: b.122.1.2 c.116.1.5
Probab=100.00  E-value=0  Score=436.82  Aligned_cols=239  Identities=24%  Similarity=0.316  Sum_probs=206.1

Q ss_pred             CCCCEEEEC---CCCCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCC-CEEEEEEEECCC-CCC
Q ss_conf             778777408---544788889987798759987035789888999977998798753023555-238997541355-554
Q gi|254781160|r    5 SHLKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQ-TKQ   79 (245)
Q Consensus         5 ~~m~R~f~~---~~l~~~~~i~L~~~~~hHl~kVlRlk~Gd~i~i~dg~g~~~~~~I~~~~k~-~~~~i~~~~~~~-~~~   79 (245)
                      |+|+|||++   .++..+.++.|+++++|||.||||+++||.|.++||+|..|.|+|++++|+ +.+.+......+ .++
T Consensus         1 M~~~r~fi~~~~~~l~~~~~i~L~~~~~hHl~kVLR~k~Gd~i~v~dg~G~~~~a~I~~i~k~~~~~~~~~~~~~~~~~~   80 (268)
T 1vhk_A            1 MSLQRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNENRELP   80 (268)
T ss_dssp             ---CEEECSSCHHHHHSSSSEEEESHHHHHHHTTTCCCTTCEEEEECTTSCEEEEEEEEECSSEEEEEEEEECCCCCCCS
T ss_pred             CCCCEEEECCCHHHCCCCCEEEECHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEEEEEECCCCCCCC
T ss_conf             99748996788567156997996889988999707889999999992899889999999506743344432002466897


Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHH------HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             43135413445411567775444456656555542022011------221223357889999751234434332000000
Q gi|254781160|r   80 SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE  153 (245)
Q Consensus        80 ~~i~l~~~~~k~~~~~~ilqk~tELGV~~I~p~~~~rs~~~------~~k~eR~~~ii~eA~eQsgr~~lP~i~~~~~l~  153 (245)
                      ++++|+++++|+++|||+|||+|||||++|+|+.++||+.+      ..+.+||++|+++|||||||+|+|+|..+.+|+
T Consensus        81 ~~i~L~~~l~k~~~~e~ii~katELGV~~I~p~~sers~~~~~~~~~~~k~eR~~~ii~eA~eQsgr~~lP~I~~~~~l~  160 (268)
T 1vhk_A           81 IKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKLDDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQ  160 (268)
T ss_dssp             SEEEEEEECCSTTHHHHHHHHHHHTTCCEEEEECCTTCCCC---------HHHHHHHHHHHHHHTTCSSCCEECCCBCHH
T ss_pred             CCEEEEEEEECCCHHHHHHHHHHHHCCCEEEEEHHCEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCHH
T ss_conf             42579984216752888998878327256781010301221222055640999999999999971999876797436999


Q ss_pred             CCCCCCCCCCCCCCCCCHHCCCCCHH----HHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHH
Q ss_conf             11233322333212630001211022----21003678835999888888888999999957995586368874004489
Q gi|254781160|r  154 FLLKNWDHNCQIVFADETCGSENSLE----KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA  229 (245)
Q Consensus       154 ~~l~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~i~i~IGPEGGfs~~E~~~l~~~~~~~~vsLG~~ILR~ETA  229 (245)
                      ++++........+++++.........    ........++++++||||||||++|+++|+++|| ++|+||++|||||||
T Consensus       161 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~i~IGPEGGfs~~Ei~~l~~~g~-~~v~LG~~ILR~ETA  239 (268)
T 1vhk_A          161 QLLQRMQDFDKCVVAYEESSKQGEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDG-VTCGLGPRILRTETA  239 (268)
T ss_dssp             HHHHHGGGSSEEEEECC--------CHHHHHHHTCCTTCEEEEEECCTTCCCHHHHHHHHHTTC-EEECCCSSCCCTTTH
T ss_pred             HHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHCCC-EEEECCCCCCHHHHH
T ss_conf             9997286679489974200234424678888764347981999983898899999999997899-997789981457749


Q ss_pred             HHHHHHHHHHHH----CCC
Q ss_conf             999999999984----786
Q gi|254781160|r  230 AVAAMALVQAIC----GDW  244 (245)
Q Consensus       230 ~i~als~~~~~~----g~~  244 (245)
                      +|+|+|++++++    |||
T Consensus       240 ~i~als~i~~~~~~~~g~~  258 (268)
T 1vhk_A          240 PLYALSAISYQTELLRGDQ  258 (268)
T ss_dssp             HHHHHHHHHHHHHTCC---
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999988747775