BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498
methyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (245 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040837|gb|ACT57633.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 245

 Score =  517 bits (1332), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 245/245 (100%), Positives = 245/245 (100%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY
Sbjct: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT
Sbjct: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
           HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK
Sbjct: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI
Sbjct: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240

Query: 241 CGDWY 245
           CGDWY
Sbjct: 241 CGDWY 245


>gi|315122545|ref|YP_004063034.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495947|gb|ADR52546.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 254

 Score =  359 bits (921), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 178/245 (72%), Positives = 211/245 (86%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK+H  LKRLFV+F L  K QGKAS  QYHYLAHVLRMKE + +L+FNG+DGEW+S ISY
Sbjct: 1   MKMHPPLKRLFVNFSLQPKAQGKASDAQYHYLAHVLRMKEKEKVLIFNGEDGEWISTISY 60

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           + KSI F VE+Q+R+QTK SD+ YIFSPIKTNRLDYMIQKSVEMG+ AIRPVITRYTQNT
Sbjct: 61  IKKSISFNVEHQTRTQTKPSDLHYIFSPIKTNRLDYMIQKSVEMGVSAIRPVITRYTQNT 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
           H N++R+RTY ISAAEQC+I++LP I+PP TL+ LL++WD N  IVFADETC  ENS  K
Sbjct: 121 HCNVNRMRTYAISAAEQCNIISLPSIHPPITLDTLLEDWDQNRHIVFADETCIHENS--K 178

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           + AIAHI ++A+LIGPEGG+H +EKE LHSLPFVTP+SLGPRILR+DTAAVAA+ALVQ+ 
Sbjct: 179 IQAIAHIVHMAVLIGPEGGFHPKEKEKLHSLPFVTPISLGPRILRADTAAVAAIALVQST 238

Query: 241 CGDWY 245
           CGDWY
Sbjct: 239 CGDWY 243


>gi|254720129|ref|ZP_05181940.1| 16S ribosomal RNA methyltransferase RsmE [Brucella sp. 83/13]
          Length = 248

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTDRIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAM LVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMVLVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|319405184|emb|CBI78789.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 247

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 158/247 (63%), Gaps = 6/247 (2%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  LKRLFV   L +  +    G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+ +
Sbjct: 1   MRANYKLKRLFVRQLLALNEEIVIEGQQASYLVHVLRMKEGTEILLFNGQDGEWLAKLIF 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K I   ++ +Q R QT  SD+ Y F+P+K  RLDYMIQK+VEMG+  + PVIT++TQ 
Sbjct: 61  IKKKIVVARLIHQERPQTTHSDLFYCFAPLKHMRLDYMIQKAVEMGVSVLYPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN--S 177
           T  NM R+    I A+EQC IL+LP   P  +LE  L+NWD    + F DE   S N  S
Sbjct: 121 TRINMARIEANIIEASEQCGILSLPKCAPAVSLETFLENWDKTRALFFCDELNESYNPIS 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L K H    +    +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DTAAVAA+ LV
Sbjct: 181 LFKKHGTNPL---GVLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADTAAVAALTLV 237

Query: 238 QAICGDW 244
            A  GDW
Sbjct: 238 NATMGDW 244


>gi|265985135|ref|ZP_06097870.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839033|ref|ZP_07471853.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264663727|gb|EEZ33988.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405856|gb|EFM62115.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 242

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 156/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAM LVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMVLVQAVLGDW 238


>gi|49473945|ref|YP_031987.1| hypothetical protein BQ02980 [Bartonella quintana str. Toulouse]
 gi|49239448|emb|CAF25798.1| hypothetical protein BQ02980 [Bartonella quintana str. Toulouse]
          Length = 244

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 155/247 (62%), Gaps = 6/247 (2%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I+  LKRLF+  PL +  + K  G +  YL HVLRM+EG  ILLFNG+DGEWL+K+  
Sbjct: 1   MHINYKLKRLFIRQPLVLNEEIKIEGQKASYLIHVLRMQEGAEILLFNGQDGEWLAKLIT 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K  +  K+ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKRFVVVKLIHQERLQTAPSNLIYCFAPLKNARLDYMVQKAVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  N  R+    + A+EQC IL+LP   P  +L  LL  WD    + F DE     N L 
Sbjct: 121 TRINRTRMEANVVEASEQCGILSLPECVPAVSLVELLACWDETQPLFFCDEAHKLHNPLP 180

Query: 180 --KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             K H +  +P V  LIGPEGG+  EE+  L    FV P+ LGPRILR+DTAAV A+AL+
Sbjct: 181 LLKKHEMT-VPGV--LIGPEGGFSKEERSFLKKHSFVIPIPLGPRILRADTAAVVALALL 237

Query: 238 QAICGDW 244
            A  GDW
Sbjct: 238 NATVGDW 244


>gi|325292039|ref|YP_004277903.1| hypothetical protein AGROH133_04165 [Agrobacterium sp. H13-3]
 gi|325059892|gb|ADY63583.1| hypothetical protein AGROH133_04165 [Agrobacterium sp. H13-3]
          Length = 261

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 169/245 (68%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL      +A+ +Q++YLA+VLRM +G  ILLFNG+DGEW +++S+
Sbjct: 17  MRANFRMQRLFVETPLVAGAAQEATTEQFNYLANVLRMTDGAEILLFNGRDGEWKARLSF 76

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q+R Q   SD+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 77  PSRKKITLIPLEQTRPQPSASDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 136

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
             +N +++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L 
Sbjct: 137 KIHNTEKLRANAIEAAEQCGILSLPDVAEPVKLKDMLETWPRDRRIIYCDEGDAGQNPLP 196

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L +I     +A+L+GPEGG+  EE+E L SL FVTP+ LGPRILR+DTAAVAA+A++QA
Sbjct: 197 VLQSIKER-KIALLVGPEGGFSEEERELLRSLAFVTPIPLGPRILRADTAAVAALAVIQA 255

Query: 240 ICGDW 244
             GDW
Sbjct: 256 SIGDW 260


>gi|148253212|ref|YP_001237797.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium sp. BTAi1]
 gi|146405385|gb|ABQ33891.1| hypothetical protein BBta_1682 [Bradyrhizobium sp. BTAi1]
          Length = 250

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 150/236 (63%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL      +   DQ +YL +VLR+  G  +L+FNG+DGEW   I    +     
Sbjct: 10  RLYVDAPLQHGAHVELDRDQSNYLGNVLRLGAGGRVLVFNGRDGEWQGLIGGRKRPDSLT 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +E+++R Q + +D+ Y+F+P+K  RLDYM+QK+VEMG+ ++ PVITR+TQ +  N +R+R
Sbjct: 70  IEHRTRPQDRLADLAYVFAPLKHARLDYMVQKAVEMGVSSLAPVITRHTQVSRVNGERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL+L  +  P +LE  L     +  +VF DE     + L+ L   +   
Sbjct: 130 ANVIEAAEQCGILSLAEVREPVSLERFLAQRPPDRLLVFCDEAADVADPLQALRGGSDYA 189

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            + +LIGPEGG+ SEE+E L   P V  ++LGPRILR+DTA VAA+AL+QA  GDW
Sbjct: 190 GIDLLIGPEGGFASEERELLLRQPLVLRVALGPRILRADTAGVAALALIQATLGDW 245


>gi|121602013|ref|YP_988622.1| hypothetical protein BARBAKC583_0300 [Bartonella bacilliformis
           KC583]
 gi|120614190|gb|ABM44791.1| conserved hypothetical protein TIGR00046 [Bartonella bacilliformis
           KC583]
          Length = 247

 Score =  218 bits (554), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +   +RLF+  PL +  +    G Q  YL HVLRM+EG  ILLFNG DGEWL+++  
Sbjct: 1   MRANYKFQRLFIQQPLVLNAEVIIEGSQASYLIHVLRMREGARILLFNGCDGEWLAELIT 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K I   ++ +Q R QT +SD+ Y F+PIK+ RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKIVVVRIIHQERVQTVRSDLVYCFAPIKSARLDYMVQKAVEMGVSVLQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+L    P  +LE LL +WD    + F DE+    N L 
Sbjct: 121 TRINMARIEANIIEASEQCGILSLSECAPTVSLEALLTSWDEARPLFFCDESHEFHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +P V +LIGPEGG+  EE+  L   PFV P+SLGPRILR+DTAAVAA+A++  
Sbjct: 181 LLKKYRAMP-VGVLIGPEGGFSEEERILLKKYPFVVPISLGPRILRADTAAVAALAIINT 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|319898419|ref|YP_004158512.1| hypothetical protein BARCL_0241 [Bartonella clarridgeiae 73]
 gi|319402383|emb|CBI75922.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 240

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 144/229 (62%), Gaps = 2/229 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+++  LKRLFV   L +  +    G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+++
Sbjct: 1   MRVNYKLKRLFVRQLLALNKEIVIEGQQASYLMHVLRMKEGAKILLFNGQDGEWLAKLTF 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K  +  ++  Q R QTK SD+ Y F+P+K  RLDYMIQK+VEMG   + P+IT YTQ 
Sbjct: 61  IKKKFVVVRLINQERLQTKSSDLFYCFAPLKYMRLDYMIQKAVEMGASVLHPIITHYTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I AAEQC IL+LP   P   L+  L+NWD    + F DE   S N++ 
Sbjct: 121 TRINMARIEANIIEAAEQCGILSLPKCAPAVPLKTFLENWDETHALFFCDELSESYNTIP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
                   P + +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DT
Sbjct: 181 LFKKHRTTP-LGVLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADT 228


>gi|256111326|ref|ZP_05452352.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 3
           str. Ether]
 gi|265992832|ref|ZP_06105389.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262763702|gb|EEZ09734.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 248

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 160/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP  +     +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCWEALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|239833512|ref|ZP_04681840.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239821575|gb|EEQ93144.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 248

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 161/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L   +Q + +    HYL HVLR+KEGD IL FNG+DGEW S++  
Sbjct: 1   MRANYKMQRLYVENDLQSGSQIEVASQAAHYLTHVLRLKEGDEILAFNGRDGEWKSRLRP 60

Query: 61  VGKSIRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK   F   + Q+R Q   SD+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGKKRLFLEPFDQTRPQPPASDLIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR+R   I AAEQC +L+LP        +  ++ WD    ++F DE   S++ L 
Sbjct: 121 PKLGTDRIRVNAIEAAEQCGVLSLPACRETIRFDRFIEQWDETRHLIFCDEGHESDDPLT 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+   P  A+LIGPEGG+  +E++TL  LP+VT + LGPRILR+DTAAVAAMALVQ+
Sbjct: 181 ILQAMKPGP-AALLIGPEGGFSEDERQTLRRLPYVTAIPLGPRILRADTAAVAAMALVQS 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|306845979|ref|ZP_07478546.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306273614|gb|EFM55459.1| conserved hypothetical protein [Brucella sp. BO1]
          Length = 242

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 116/239 (48%), Positives = 157/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELQAGVSFDAEAQAAHYLAHVLRMKEGDKVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|17988874|ref|NP_541507.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 1
           str. 16M]
 gi|256043637|ref|ZP_05446562.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256262333|ref|ZP_05464865.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260564827|ref|ZP_05835312.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990057|ref|ZP_06102614.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984700|gb|AAL53771.1| surface protein [Brucella melitensis bv. 1 str. 16M]
 gi|260152470|gb|EEW87563.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263000726|gb|EEZ13416.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092061|gb|EEZ16358.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 248

 Score =  215 bits (547), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|229007176|ref|NP_353680.3| hypothetical protein Atu0657 [Agrobacterium tumefaciens str. C58]
          Length = 245

 Score =  214 bits (545), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 169/245 (68%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLF++  L      +A+G+Q++YLA+VLRM +G  ILLFNG+DGEW +K+S+
Sbjct: 1   MRANFRMQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRDGEWKAKLSF 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q+R Q   +++ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKKISLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
             +N +++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L 
Sbjct: 121 KIHNSEKLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+     +A+L+GPEGG+  EE+  L SL FVTP+ LGPRILR+DTAAVAA+A++QA
Sbjct: 181 ILQAVKER-KIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILRADTAAVAALAVIQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VIGDW 244


>gi|254699975|ref|ZP_05161803.1| 16S ribosomal RNA methyltransferase RsmE [Brucella suis bv. 5 str.
           513]
 gi|254710992|ref|ZP_05172803.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           B2/94]
 gi|254712536|ref|ZP_05174347.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M644/93/1]
 gi|254715608|ref|ZP_05177419.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M13/05/1]
 gi|256029374|ref|ZP_05442988.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           M292/94/1]
 gi|256059062|ref|ZP_05449271.1| 16S ribosomal RNA methyltransferase RsmE [Brucella neotomae 5K33]
 gi|256157566|ref|ZP_05455484.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M490/95/1]
 gi|256253459|ref|ZP_05458995.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti B1/94]
 gi|260167538|ref|ZP_05754349.1| 16S ribosomal RNA methyltransferase RsmE [Brucella sp. F5/99]
          Length = 248

 Score =  214 bits (545), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|227820965|ref|YP_002824935.1| 16S ribosomal RNA methyltransferase RsmE [Sinorhizobium fredii
           NGR234]
 gi|227339964|gb|ACP24182.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 245

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 165/245 (67%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL    + +A+ DQ++YL +VLR  EG +IL+FNG+DGEW +++S 
Sbjct: 1   MRANFRMQRLFVESPLHAGARHEATKDQFNYLINVLRFGEGSSILVFNGRDGEWRAELSL 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +      Q+R Q   SD+ Y+F+P+KT RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKQLVLTAVEQTRPQPAPSDLVYLFAPLKTGRLDYLVQKAVEMGAGVLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+DR+R     AAEQC +L +P +  P  LE LL NW    +I+F DE   S+N L 
Sbjct: 121 KLGNLDRLRANVTEAAEQCGVLGIPSVETPRKLEELLANWPRERRIIFCDEGNESQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  I+    +A+LIGPEGG+   E+  LHSL FVT + LGPRILR+DTAAVAA+AL+QA
Sbjct: 181 ILGGISER-RLALLIGPEGGFSEAERVLLHSLDFVTAVPLGPRILRADTAAVAALALIQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TLGDW 244


>gi|229597125|ref|YP_001622546.2| 16S ribosomal RNA methyltransferase RsmE [Brucella suis ATCC 23445]
          Length = 248

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLELGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|326410911|gb|ADZ67975.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis M28]
 gi|326554202|gb|ADZ88841.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis
           M5-90]
          Length = 285

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|240137404|ref|YP_002961875.1| hypothetical protein MexAM1_META1p0669 [Methylobacterium extorquens
           AM1]
 gi|240007372|gb|ACS38598.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 250

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/239 (45%), Positives = 149/239 (62%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I   G KS   
Sbjct: 10  RLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR+
Sbjct: 70  RVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           +   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L      
Sbjct: 130 QANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEDASVTDPVAALRGAADP 189

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           A+ P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 190 ANPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|148558128|ref|YP_001257708.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ovis ATCC 25840]
 gi|225629236|ref|ZP_03787269.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|148369413|gb|ABQ62285.1| conserved hypothetical protein TIGR00046 [Brucella ovis ATCC 25840]
 gi|225615732|gb|EEH12781.1| conserved hypothetical protein [Brucella ceti str. Cudo]
          Length = 285

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|218528889|ref|YP_002419705.1| hypothetical protein Mchl_0859 [Methylobacterium chloromethanicum
           CM4]
 gi|218521192|gb|ACK81777.1| protein of unknown function DUF558 [Methylobacterium
           chloromethanicum CM4]
          Length = 250

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/239 (45%), Positives = 148/239 (61%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I   G KS   
Sbjct: 10  RLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR+
Sbjct: 70  RVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           +   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L      
Sbjct: 130 QANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEEASVTDPVAALRGAADP 189

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           A  P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 190 ASPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|188580094|ref|YP_001923539.1| hypothetical protein Mpop_0826 [Methylobacterium populi BJ001]
 gi|179343592|gb|ACB79004.1| protein of unknown function DUF558 [Methylobacterium populi BJ001]
          Length = 250

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 145/239 (60%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW S+I   G KS   
Sbjct: 10  RLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRSEIVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+R Q   SD+ Y+F+P+KT RLDYM QK+VEMG G ++PV TR+TQ     +DR+
Sbjct: 70  RVVAQTRPQPAPSDLHYLFAPLKTGRLDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           +   I AAEQC IL +P I  P  L   L   D    +VF DE     + +  L      
Sbjct: 130 QANAIEAAEQCGILAVPEIGEPDRLPACLAALDPGRLLVFCDEDAPVTDPVAALRGAADP 189

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           A  P +A+L+GPEGG+H EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 190 ADPPPLAVLVGPEGGFHPEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|306841708|ref|ZP_07474395.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306288238|gb|EFM59622.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 242

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 155/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L LP        +     WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLALPDCREALRFDRFRDQWDTSRRLIFCDEGHESDDPLSILAGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|225686530|ref|YP_002734502.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis ATCC
           23457]
 gi|225642635|gb|ACO02548.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
          Length = 242

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 156/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQALRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|49475195|ref|YP_033236.1| hypothetical protein BH03960 [Bartonella henselae str. Houston-1]
 gi|49238000|emb|CAF27205.1| hypothetical protein BH03960 [Bartonella henselae str. Houston-1]
          Length = 247

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+  PL I  + K  G Q  Y+ HVLRM+EG  ILLFNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQPLVINEKIKIEGPQAFYIVHVLRMQEGAEILLFNGQDGEWLAKLIT 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K  +  ++ +Q R QT  S++ Y F+P+KT RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKFVVVQLIHQERFQTALSNLIYCFAPLKTARLDYMVQKAVEMGVSVLQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+ +  + A+EQC IL+LP   P  +L  LL  WD    + F DET  S N L 
Sbjct: 121 TRINMARMESNVVEASEQCGILSLPECVPAVSLAELLARWDETQPLFFCDETHKSHNPL- 179

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +    ILIGPEGG+  EE+  L   PFV  + LGPRILR+DTAAVAA+AL+ A
Sbjct: 180 PLFKKREMLAPGILIGPEGGFSQEERSFLKKHPFVISIPLGPRILRADTAAVAALALLNA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TIGDW 244


>gi|294853463|ref|ZP_06794135.1| ribosomal RNA small subunit methyltransferase E [Brucella sp. NVSL
           07-0026]
 gi|294819118|gb|EFG36118.1| ribosomal RNA small subunit methyltransferase E [Brucella sp. NVSL
           07-0026]
          Length = 242

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 156/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAVHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|159139721|gb|AAK86465.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 239

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 109/239 (45%), Positives = 166/239 (69%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RLF++  L      +A+G+Q++YLA+VLRM +G  ILLFNG+DGEW +K+S+   K I
Sbjct: 1   MQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRDGEWKAKLSFPSRKKI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
                 Q+R Q   +++ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q   +N +
Sbjct: 61  SLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQGKIHNSE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           ++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L  L A+ 
Sbjct: 121 KLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYCDEGDAGQNPLPILQAVK 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               +A+L+GPEGG+  EE+  L SL FVTP+ LGPRILR+DTAAVAA+A++QA+ GDW
Sbjct: 181 ER-KIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILRADTAAVAALAVIQAVIGDW 238


>gi|254705760|ref|ZP_05167588.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           M163/99/10]
          Length = 248

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRXPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|256015526|ref|YP_003105535.1| hypothetical protein BMI_II755 [Brucella microti CCM 4915]
 gi|261217356|ref|ZP_05931637.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220586|ref|ZP_05934867.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261318573|ref|ZP_05957770.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320229|ref|ZP_05959426.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323007|ref|ZP_05962204.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750457|ref|ZP_05994166.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261756957|ref|ZP_06000666.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265986373|ref|ZP_06098930.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265996067|ref|ZP_06108624.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|255998186|gb|ACU49873.1| hypothetical protein BMI_II755 [Brucella microti CCM 4915]
 gi|260919170|gb|EEX85823.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922445|gb|EEX89013.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292919|gb|EEX96415.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297796|gb|EEY01293.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298987|gb|EEY02484.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261736941|gb|EEY24937.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740210|gb|EEY28136.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262550364|gb|EEZ06525.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264658570|gb|EEZ28831.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 242

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 156/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|229220845|ref|YP_223253.2| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 1
           str. 9-941]
 gi|229358031|ref|YP_418671.2| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis
           biovar Abortus 2308]
 gi|229597252|ref|YP_001932396.2| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus S19]
 gi|254690902|ref|ZP_05154156.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 6
           str. 870]
 gi|254695788|ref|ZP_05157616.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 3
           str. Tulya]
 gi|254698683|ref|ZP_05160511.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254732130|ref|ZP_05190708.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 4
           str. 292]
 gi|256256087|ref|ZP_05461623.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 9
           str. C68]
 gi|260544638|ref|ZP_05820459.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260097909|gb|EEW81783.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 248

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|254559584|ref|YP_003066679.1| hypothetical protein METDI1041 [Methylobacterium extorquens DM4]
 gi|254266862|emb|CAX22661.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 250

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 149/239 (62%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW +++   G KS   
Sbjct: 10  RLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAELVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR+
Sbjct: 70  RVVVQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           +   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L      
Sbjct: 130 QANAIEAAEQCGILSVPEIGEPARLPGCLDALEANRLLVFCDEDASVTDPVAALRGAADP 189

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           A+ P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 190 ANPPPLAVLVGPEGGFHAEERALIAARPNTVVLSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|163675614|gb|ABY39724.1| conserved hypothetical protein [Brucella suis ATCC 23445]
          Length = 242

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 156/239 (65%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 LGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|237816954|ref|ZP_04595946.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297249441|ref|ZP_06933142.1| ribosomal RNA small subunit methyltransferase E [Brucella abortus
           bv. 5 str. B3196]
 gi|237787767|gb|EEP61983.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297173310|gb|EFH32674.1| ribosomal RNA small subunit methyltransferase E [Brucella abortus
           bv. 5 str. B3196]
          Length = 285

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|163850332|ref|YP_001638375.1| hypothetical protein Mext_0899 [Methylobacterium extorquens PA1]
 gi|163661937|gb|ABY29304.1| protein of unknown function DUF558 [Methylobacterium extorquens
           PA1]
          Length = 250

 Score =  211 bits (537), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 149/239 (62%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I   G KS   
Sbjct: 10  RLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR+
Sbjct: 70  RVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH- 186
           +   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L   A+ 
Sbjct: 130 QANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEDASVTDPVVALRGAANP 189

Query: 187 --IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
              P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ G+
Sbjct: 190 ASPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGN 248


>gi|153010322|ref|YP_001371536.1| hypothetical protein Oant_2999 [Ochrobactrum anthropi ATCC 49188]
 gi|151562210|gb|ABS15707.1| protein of unknown function DUF558 [Ochrobactrum anthropi ATCC
           49188]
          Length = 248

 Score =  211 bits (537), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 163/245 (66%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+V+  L    Q + +    HYL HVLR+K+GD IL FNG+ GEW S++  
Sbjct: 1   MRANYKMQRLYVENDLDDGDQIEVAPQAAHYLTHVLRLKDGDEILAFNGRHGEWKSRLKP 60

Query: 61  VGKSIRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK   F + + Q+R Q   SD+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGKKRLFLMPFEQTRPQPLASDLVYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++   I AAEQC +L++P        +  ++ WD +  ++F DE   S++ L 
Sbjct: 121 PRLGADRIKANAIEAAEQCGVLSIPECCEAIRFDRFIEQWDKSRHLIFCDEGYESDDPLT 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +A  P VA+LIGPEGG+  +E++TL +LPFVT + LGPRILR+DTAAVAAMALVQ+
Sbjct: 181 ILQKMAPGP-VALLIGPEGGFSEDERQTLRNLPFVTAIPLGPRILRADTAAVAAMALVQS 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|75676748|ref|YP_319169.1| hypothetical protein Nwi_2564 [Nitrobacter winogradskyi Nb-255]
 gi|74421618|gb|ABA05817.1| Conserved hypothetical protein 46 [Nitrobacter winogradskyi Nb-255]
          Length = 257

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 146/237 (61%), Gaps = 1/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL    +   + +Q +YL +VLR+  G N+L+FNG+DGEW + IS   +    +
Sbjct: 12  RLYVDAPLAAGNRVPLNRNQGNYLGNVLRLGTGTNVLVFNGRDGEWRAAISGRKRPEHLE 71

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +   +R Q    DV Y F+P+K  RLDYM+QK+VEMG  A++PV+TR+TQ    N +R+R
Sbjct: 72  IVAATRKQDHLRDVHYAFAPLKHARLDYMVQKAVEMGASALQPVLTRFTQVGRVNGERMR 131

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL+L  +  P  L+  L        +VF DE   + N +  L  +  + 
Sbjct: 132 ANVIEAAEQCGILSLAAVEEPAQLDRWLGRRAGERLLVFCDEAASTANPVRALETVRSVA 191

Query: 189 -NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +L+GPEGG+   E+E L + P +  LSLGPRILR+DTAAVA +ALVQ + GDW
Sbjct: 192 RGIDVLVGPEGGFADNERENLLNQPNILRLSLGPRILRADTAAVAVLALVQTVLGDW 248


>gi|254473523|ref|ZP_05086919.1| conserved hypothetical protein TIGR00046 [Pseudovibrio sp. JE062]
 gi|211957235|gb|EEA92439.1| conserved hypothetical protein TIGR00046 [Pseudovibrio sp. JE062]
          Length = 242

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 161/243 (66%), Gaps = 5/243 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RLFVD  L      +A   Q +YL +VLRMKEG  +L+FNGK GEW ++I   G KS 
Sbjct: 1   MQRLFVDQELRAGLHLEADRAQANYLLNVLRMKEGGEVLVFNGKHGEWRAQILPTGRKSC 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
              V  Q R QT   D+ Y+F+P+K  RLDYM+QK+VEMG G +RPVIT++TQN    ++
Sbjct: 61  ELIVTEQLREQTPTPDLDYLFAPLKLARLDYMVQKAVEMGAGRLRPVITQFTQNPKIKLE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH---NCQIVFADETCGSENSLEKLH 182
           R+ +  + A EQC +L++P +  P  ++ LL  W+    + QI+F DE  G+ N LE L 
Sbjct: 121 RMESNALEACEQCGVLSVPSVLEPVQIKKLLSTWEQEEGDRQIIFCDEGHGTHNPLEALK 180

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
            +   P +A+LIGPEGG+  EE+  LHS PFV  + LGPRILR+DTAAVAA+A+VQA  G
Sbjct: 181 DVPKAP-LAVLIGPEGGFSEEERALLHSKPFVHAIPLGPRILRADTAAVAALAVVQAKLG 239

Query: 243 DWY 245
           DW+
Sbjct: 240 DWF 242


>gi|319408122|emb|CBI81775.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+++   +RLF+  PL +  + +  G Q  YL HVLRMKEG  ILLFNG+DGEWL+KI+ 
Sbjct: 1   MRVNYKFQRLFIQQPLSLNREIEIEGAQVSYLVHVLRMKEGAQILLFNGQDGEWLAKITA 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K  +  ++ +Q+R QT  SD+ Y F+P+K  RLDYM+QK VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKFVVVQLIHQTRPQTTCSDLIYCFAPLKHARLDYMVQKVVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +  NM R++   I AAEQC IL+LP   P  +L+ LL +WD    + F DE+   +N L 
Sbjct: 121 SRINMARIKANIIEAAEQCGILSLPECLPAVSLKTLLAHWDKTHSLFFCDESHEIQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +P + +LIGPEGG+  EE+  L    FV  +SLGPRILR+DTAAVAA+AL+  
Sbjct: 181 LLKKHGTVP-LGVLIGPEGGFSEEEQVLLRKHSFVISISLGPRILRADTAAVAALALINT 239

Query: 240 ICGDW 244
               W
Sbjct: 240 TIEAW 244


>gi|241203235|ref|YP_002974331.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857125|gb|ACS54792.1| protein of unknown function DUF558 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 245

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 164/245 (66%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +A+ DQ++YLA+VLRM++G  ILLFNG+DGEW + +++
Sbjct: 1   MRANFRMQRLFVDAPLTRGAGVEANADQFNYLANVLRMEDGGEILLFNGRDGEWKATLTF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q +  D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   I AAEQC IL +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KVTNLDKLRANVIEAAEQCGILGIPDVAEPVRLLDLLDRWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLSAIRER-HLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|209548049|ref|YP_002279966.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209533805|gb|ACI53740.1| protein of unknown function DUF558 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 245

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 164/245 (66%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +A+ DQ++YLA+VLRM+EG  +LLFNG+DGEW + +++
Sbjct: 1   MRANFRMQRLFVDAPLSSGAALEANADQFNYLANVLRMEEGGEVLLFNGRDGEWKATLTF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I+     ++R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRIQLTAIEETRPQPAPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVRLLDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLSAIRER-HLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|144898953|emb|CAM75817.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 245

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 151/237 (63%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV   L   +      DQ HYLA+V+R+K G+++ LFNG+DGEWL ++  V K S+  
Sbjct: 3   RLFVANDLSADSLIGLDKDQSHYLANVMRVKAGEDVALFNGRDGEWLGRLDKVAKASVTL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V+ QSR QT + D+  + +PIK + +D + +K+ E+G+ A+ PV T  T  +  N DR+
Sbjct: 63  QVQSQSRPQTPEPDLWLLAAPIKKDCIDLVAEKATELGISALWPVFTHRTVMSRVNTDRL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               + AAEQC+ L++P +  PT L   L  WD    +VF DE+ G     + LH++   
Sbjct: 123 AANMVEAAEQCERLSVPEMREPTDLAKALAGWDAARPLVFLDESGGGAPITQALHSLQPG 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P +A+L GPEGG+   E+  L  LPF  P+SLGPRILR++TAA+AA+++VQA+ GDW
Sbjct: 183 P-LAVLTGPEGGFDDSERAMLARLPFAVPVSLGPRILRAETAAIAALSVVQALLGDW 238


>gi|240850045|ref|YP_002971438.1| hypothetical protein Bgr_04270 [Bartonella grahamii as4aup]
 gi|240267168|gb|ACS50756.1| hypothetical protein Bgr_04270 [Bartonella grahamii as4aup]
          Length = 247

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 155/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQTLALNEEIKIEGAQASYLVHVLRMKEGAEILLFNGQDGEWLAKLII 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K  +  ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL  WD    + F DE   S N L 
Sbjct: 121 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLARWDETQPLFFCDEEHKSHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                  +    ILIGPEGG+  EE+  L   PFV P+SLGPRILR+DTAAVAA+AL+ A
Sbjct: 181 SFKK-RDVTTPGILIGPEGGFSEEERSFLKKHPFVVPISLGPRILRADTAAVAALALLNA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|260756485|ref|ZP_05868833.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759917|ref|ZP_05872265.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763155|ref|ZP_05875487.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882306|ref|ZP_05893920.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216206|ref|ZP_05930487.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|62197593|gb|AAX75892.1| conserved hypothetical protein TIGR00046 [Brucella abortus bv. 1
           str. 9-941]
 gi|82939654|emb|CAJ12643.1| Conserved hypothetical protein 46:Protein of unknown function
           DUF558 [Brucella melitensis biovar Abortus 2308]
 gi|189021229|gb|ACD73950.1| Conserved hypothetical protein 46 [Brucella abortus S19]
 gi|260670235|gb|EEX57175.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673576|gb|EEX60397.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676593|gb|EEX63414.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260871834|gb|EEX78903.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917813|gb|EEX84674.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 242

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 155/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVLRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|229107039|ref|NP_699939.2| 16S ribosomal RNA methyltransferase RsmE [Brucella suis 1330]
          Length = 248

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++R +V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +  
Sbjct: 1   MRANYRMQRPYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            G K +  +   Q+R Q K S++ Y F+P+K  +LDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGQLDYMMQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|229597123|ref|YP_001609040.2| 16S ribosomal RNA methyltransferase RsmE [Bartonella tribocorum CIP
           105476]
          Length = 247

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  IL+FNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQTLALNEEIKIEGAQASYLMHVLRMKEGAEILIFNGQDGEWLAKLII 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K  +  ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG   ++PVIT +TQ 
Sbjct: 61  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGASILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL+ WD    + F DE   S N L 
Sbjct: 121 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLERWDETQPLFFCDEEHKSPNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                 ++    +LIGPEGG+  EE+  L   PFV P+SLGPRILR+DTAAVAA+AL+ A
Sbjct: 181 SFKK-RNVTTPGVLIGPEGGFSEEERSFLKKHPFVVPMSLGPRILRADTAAVAALALLNA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|300024089|ref|YP_003756700.1| hypothetical protein Hden_2583 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525910|gb|ADJ24379.1| protein of unknown function DUF558 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 248

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 102/238 (42%), Positives = 148/238 (62%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW-LSKISYVGKSIR 66
           +RLF+   L      + +  Q HYL +VLR++ G  +L+FNG+DGEW  S I    ++  
Sbjct: 9   ERLFIADDLAAGVSVELAQQQAHYLTNVLRLRPGAKLLVFNGRDGEWQASLIESRKRTTV 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +E Q+R Q +  D+ Y+F+P+K +RLDYM+QK+ EMG+  +RPVIT  T     N +R
Sbjct: 69  LGIEEQTRPQEQGPDIDYLFAPLKRSRLDYMVQKATEMGVRRLRPVITERTIAERVNSER 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I AAEQC IL +P + PP +LE  L  WD    +++ DE   + + +  L  +  
Sbjct: 129 MLANAIEAAEQCGILRVPEVEPPVSLETALAAWDPARALIYCDEHETAADPIATLRKVPA 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P VA+LIGPEGG+ + E+  L +  +V PL LGPRI+R+DTAAVAA+ LV A+ GDW
Sbjct: 189 GP-VAVLIGPEGGFSNGERSRLLANSYVVPLPLGPRIMRADTAAVAALTLVNAVLGDW 245


>gi|116250629|ref|YP_766467.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255277|emb|CAK06352.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 245

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 164/245 (66%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +A+ DQ++YL +VLRM+EG  ILLFNG+DGEW + +++
Sbjct: 1   MRANFRMQRLFVDAPLSSGAVVEANADQFNYLGNVLRMEEGAEILLFNGRDGEWKATLTF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q +  D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC IL +P +  P  L  LL +W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGILGIPDVAEPVRLLDLLDHWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLSAIRER-HLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|114705941|ref|ZP_01438844.1| surface protein [Fulvimarina pelagi HTCC2506]
 gi|114538787|gb|EAU41908.1| surface protein [Fulvimarina pelagi HTCC2506]
          Length = 295

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 146/237 (61%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           RLFV+  +   T   A+  Q +YL +VLR  EGD++LLFNG+DGEW +++    K  +  
Sbjct: 56  RLFVEERITADTPIAATSPQANYLLNVLRKDEGDSVLLFNGQDGEWRAELRKASKKKLDL 115

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               + R Q    D+ Y F+P+K  RLDYM+QK+VEMG G ++PV+T  TQN     D++
Sbjct: 116 FPVAKVRVQQPPYDLIYCFAPLKVGRLDYMVQKAVEMGAGILQPVLTHRTQNHRVRTDKI 175

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC IL +P    P   + LL NW  +  +VF DE   + + ++ L  +   
Sbjct: 176 RANAIEAAEQCGILAIPECREPVKFDDLLSNWSSSIPLVFCDEKMDAASPIDALRELGD- 234

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               ++IGPEGG+  +E+ +L    F T +SLGPRILR+DTAAVAA+ +VQA+CGDW
Sbjct: 235 GRKGLIIGPEGGFSQDERVSLLGAEFTTAISLGPRILRADTAAVAALTMVQAVCGDW 291


>gi|110632733|ref|YP_672941.1| hypothetical protein Meso_0372 [Mesorhizobium sp. BNC1]
 gi|110283717|gb|ABG61776.1| protein of unknown function DUF558 [Chelativorans sp. BNC1]
          Length = 248

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 160/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL++   L    + + + +Q HYL +VLRM+ G  +L+FNG+ GEWL+++  
Sbjct: 1   MRANYKMQRLYLPEDLSKGAEVETTREQAHYLGNVLRMRGGAELLVFNGRHGEWLAEVKE 60

Query: 61  VGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K S    V   +R QT Q D+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  ISKKSALLAVRELTREQTPQPDILYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQI 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++   I AAEQC IL++P +  P  L+ LL  W+   ++VF DE    +N   
Sbjct: 121 PKLGTDRLQANVIEAAEQCGILSIPLVREPVKLDVLLSRWEEGRRLVFCDEDAPGQNPFP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +L A+A    + +L+GPEGG+   E+ TL SL FV P+ LGPRILR+DTAAVAA+A++QA
Sbjct: 181 RLSALAG-ERLGLLVGPEGGFSDSERRTLRSLAFVVPIPLGPRILRADTAAVAALAILQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AAGDW 244


>gi|161017487|emb|CAK01045.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 277

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  IL+FNG+DGEWL+K+  
Sbjct: 31  MRINYKLKRLFIRQTLALNEEIKIEGAQASYLMHVLRMKEGAEILIFNGQDGEWLAKLII 90

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K  +  ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG   ++PVIT +TQ 
Sbjct: 91  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGASILQPVITHHTQV 150

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL+ WD    + F DE   S N L 
Sbjct: 151 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLERWDETQPLFFCDEEHKSPNPLP 210

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                 ++    +LIGPEGG+  EE+  L   PFV P+SLGPRILR+DTAAVAA+AL+ A
Sbjct: 211 SFKK-RNVTTPGVLIGPEGGFSEEERSFLKKHPFVVPMSLGPRILRADTAAVAALALLNA 269

Query: 240 ICGDW 244
             GDW
Sbjct: 270 TVGDW 274


>gi|86356450|ref|YP_468342.1| hypothetical protein RHE_CH00804 [Rhizobium etli CFN 42]
 gi|86280552|gb|ABC89615.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 245

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 161/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV  PL      +A+ DQ++YLA+VLRM++G  ILLFNG+DGEW + +S+
Sbjct: 1   MRANFRMQRLFVYAPLSAGAAVEANADQFNYLANVLRMEDGAEILLFNGRDGEWKATLSF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I       +R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEATRPQPAPCDLHYLFAPLKVGRLDYLVQKAVEMGAGRLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLAIPEVAEPVKLSDLLDRWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLAAIQER-HLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|328545108|ref|YP_004305217.1| hypothetical protein SL003B_3491 [polymorphum gilvum SL003B-26A1]
 gi|326414850|gb|ADZ71913.1| Hypothetical conserved protein [Polymorphum gilvum SL003B-26A1]
          Length = 252

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 164/243 (67%), Gaps = 6/243 (2%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIR 66
           +RLF+   L    Q +A   Q +YL +VLR+ + D +L+FNG+DGEWL++I+  G K+  
Sbjct: 9   QRLFLRHGLADGGQVEADRAQANYLLNVLRLADDDRVLVFNGRDGEWLAEIAAAGRKACT 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            ++  ++R QT Q D+ Y+F+P+K  RLDYM+QK+VEMG GA+RPV+TR+T  +  N++R
Sbjct: 69  LRLVERTRPQTPQPDLHYLFAPLKHARLDYMVQKAVEMGAGALRPVMTRHTHASRINLER 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNW---DHNCQIVFADETCGSENSLEKLHA 183
           +    + AAEQC +++LP +  P  L+ +L  W   D   +++F DE   S + L  L  
Sbjct: 129 MEANVVEAAEQCGVISLPDVRAPAALDAVLAAWPQADAGRRLLFCDEGEESHSPLPVLAR 188

Query: 184 IA-HIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
           +A   P+ +A+L+GPEGG+  EE+  L  LPFV P+ LGPRILR+DTAAVAA+A+VQA  
Sbjct: 189 LAGEGPSPLALLVGPEGGFSKEERALLRGLPFVVPIPLGPRILRADTAAVAALAVVQAAL 248

Query: 242 GDW 244
           GDW
Sbjct: 249 GDW 251


>gi|319782233|ref|YP_004141709.1| hypothetical protein Mesci_2516 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168121|gb|ADV11659.1| protein of unknown function DUF558 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 244

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   L    + +A   Q HYL HVLR+ EG  IL+FNG+DGEW + IS 
Sbjct: 1   MRANYKMQRLFVTDDLAPDIEFEAGQQQSHYLLHVLRLGEGAEILVFNGRDGEWSAAISA 60

Query: 61  VGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K ++R KV    R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 61  KTKRAVRLKVSALQRPQPPLPDLVYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      + LL  WD   +++F DE   + N L 
Sbjct: 121 AKPSIDRLRANVVEAAEQCGILAVPQVREAEKFDRLLTGWDTERRLIFCDEDASTNNPLA 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+     + +L+GPEGG+  +E++ L +LPFVT + LGPRILR+DTAAVAA A++QA
Sbjct: 181 ALQAVKE-KKLGLLVGPEGGFSDDERKMLRALPFVTAIPLGPRILRADTAAVAAFAVMQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|23464129|gb|AAN33944.1| conserved hypothetical protein TIGR00046 [Brucella suis 1330]
          Length = 242

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 155/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++R +V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRPYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  +LDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGQLDYMMQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|150395613|ref|YP_001326080.1| 16S ribosomal RNA methyltransferase RsmE [Sinorhizobium medicae
           WSM419]
 gi|150027128|gb|ABR59245.1| protein of unknown function DUF558 [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 169/246 (68%), Gaps = 4/246 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL      +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++IS 
Sbjct: 1   MRANFRMQRLFVESPLHNGASHQATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEISM 60

Query: 61  VGK--SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ 118
             +  ++   VE Q+R Q    D+ Y+F+P+KT RLDY++QK+VEMG G ++PVIT++ Q
Sbjct: 61  PSRKQAVLVAVE-QTRPQPAPCDLVYLFAPLKTGRLDYLVQKAVEMGAGVLQPVITQHVQ 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
               +++R+R   I AAEQC +L +P +  P  LE LL  W  + +IVF DE   S+N L
Sbjct: 120 GKIGSLERIRANAIEAAEQCGVLGIPAVEEPRRLEDLLAAWPRDRRIVFCDEGNESQNPL 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L+ +A    +A+LIGPEGG+   E++ L SL FVT + LGPRILR+DTAAVAAMA++Q
Sbjct: 180 PILNELAE-HRLALLIGPEGGFSETERDLLRSLDFVTAIPLGPRILRADTAAVAAMAVIQ 238

Query: 239 AICGDW 244
           A  GDW
Sbjct: 239 ATLGDW 244


>gi|260567973|ref|ZP_05838442.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 4 str. 40]
 gi|261753715|ref|ZP_05997424.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
 gi|260154638|gb|EEW89719.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 4 str. 40]
 gi|261743468|gb|EEY31394.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 3 str. 686]
          Length = 235

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 148/222 (66%), Gaps = 2/222 (0%)

Query: 24  ASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDV 82
           A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +  +   Q+R Q K S++
Sbjct: 11  AGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRLLLEPLEQTRPQPKPSEL 70

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILT 142
            Y F+P+K  +LDYM+QK+VEMG G ++PVIT++TQ      +R+R   I AAEQC +L+
Sbjct: 71  IYCFAPLKQGQLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTERIRANAIEAAEQCGVLS 130

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           LP        +  L  WD + +++F DE   S++ L  L  +   P+  +LIGPEGG+  
Sbjct: 131 LPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLEPGPS-GLLIGPEGGFSE 189

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 190 EERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 231


>gi|190890510|ref|YP_001977052.1| hypothetical protein RHECIAT_CH0000889 [Rhizobium etli CIAT 652]
 gi|190695789|gb|ACE89874.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 245

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 161/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +AS +Q++YLA+VLRM+    ILLFNG+DGEW + +S+
Sbjct: 1   MRANFRMQRLFVDAPLSAGAVVEASAEQFNYLANVLRMEADAEILLFNGRDGEWKASLSF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEETRPQPLPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVKLSDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLSAIRER-HLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|158330817|dbj|BAF88302.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 283

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 145/238 (60%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW-LSKISYVGKSIR 66
           +RLFV   L   T      +Q HY+A+V+R+     +L+FNG+DGEW  ++I    K +R
Sbjct: 42  QRLFVREDLAADTTFSLPSEQAHYVANVIRLPVRGGLLVFNGRDGEWRATRIEGGKKEVR 101

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +  Q+R Q   + + Y F+P+K  RLDYM+QK+VEMG G + PV+T++TQ    N +R
Sbjct: 102 LSIGGQTRPQPAAAGLTYAFAPLKHARLDYMVQKAVEMGAGVLAPVLTQHTQIPRVNGER 161

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I AAEQC ILT+P +  P  L   L     +  +VF DE     + L  L   A 
Sbjct: 162 MEANAIEAAEQCGILTIPSVRAPQGLSAFLGARPADDMLVFCDEAAPVADPLVALRPAAG 221

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P + +LIGPEGG+ ++E+  LH    V  ++LGPRILR+DTA VAA+ALVQA+CGDW
Sbjct: 222 GP-ITVLIGPEGGFSADERTLLHRQERVIVIALGPRILRADTAGVAALALVQAVCGDW 278


>gi|229595716|ref|YP_001525220.2| 16S ribosomal RNA methyltransferase RsmE [Azorhizobium caulinodans
           ORS 571]
          Length = 250

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 145/238 (60%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW-LSKISYVGKSIR 66
           +RLFV   L   T      +Q HY+A+V+R+     +L+FNG+DGEW  ++I    K +R
Sbjct: 9   QRLFVREDLAADTTFSLPSEQAHYVANVIRLPVRGGLLVFNGRDGEWRATRIEGGKKEVR 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +  Q+R Q   + + Y F+P+K  RLDYM+QK+VEMG G + PV+T++TQ    N +R
Sbjct: 69  LSIGGQTRPQPAAAGLTYAFAPLKHARLDYMVQKAVEMGAGVLAPVLTQHTQIPRVNGER 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I AAEQC ILT+P +  P  L   L     +  +VF DE     + L  L   A 
Sbjct: 129 MEANAIEAAEQCGILTIPSVRAPQGLSAFLGARPADDMLVFCDEAAPVADPLVALRPAAG 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P + +LIGPEGG+ ++E+  LH    V  ++LGPRILR+DTA VAA+ALVQA+CGDW
Sbjct: 189 GP-ITVLIGPEGGFSADERTLLHRQERVIVIALGPRILRADTAGVAALALVQAVCGDW 245


>gi|85714212|ref|ZP_01045200.1| hypothetical protein NB311A_14712 [Nitrobacter sp. Nb-311A]
 gi|85698659|gb|EAQ36528.1| hypothetical protein NB311A_14712 [Nitrobacter sp. Nb-311A]
          Length = 256

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 147/237 (62%), Gaps = 1/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL    +   + +Q +YL +VLR+  G N+L+FNG+DGEW + I    +    +
Sbjct: 17  RLYVDAPLAAGCRIPLNRNQGNYLGNVLRLGTGTNVLVFNGRDGEWRAAIFGRKRLENLE 76

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +   +R Q +  DV+Y F+P+K  RLDYM+QK+VEMG+ A++P++TR+TQ    N +R+R
Sbjct: 77  IVAATRKQDQLPDVRYAFAPLKHARLDYMVQKAVEMGVCALQPLLTRFTQVGRVNGERMR 136

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL+L  +  P +L+  L        +VF DE   + N L  L     + 
Sbjct: 137 ANVIEAAEQCGILSLAAVEEPASLDQWLGRRGPERLLVFCDEAASTANPLRTLEPARRVA 196

Query: 189 -NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +L+GPEGG+  +E+  L   P V  LSLGPRILR+DTAAVA +ALVQ + GDW
Sbjct: 197 QGIDVLVGPEGGFAEDERVNLLKQPNVLRLSLGPRILRADTAAVAVLALVQTVLGDW 253


>gi|260462657|ref|ZP_05810863.1| protein of unknown function DUF558 [Mesorhizobium opportunistum
           WSM2075]
 gi|259031563|gb|EEW32833.1| protein of unknown function DUF558 [Mesorhizobium opportunistum
           WSM2075]
          Length = 273

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   L    +  A   Q HYL HVLR+ EG  IL+FNG+DGEW + I+ 
Sbjct: 30  MRANYKMQRLFVPDDLAGDAEFDAGQQQSHYLMHVLRLGEGAEILVFNGRDGEWSAAIAA 89

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              +++R KV    R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 90  KTKRAVRLKVLALQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 149

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      E +L  WD   +++F DE   + N L 
Sbjct: 150 AKPSIDRLRANVVEAAEQCGILAVPEVREAEKFERVLTGWDKGRRLIFCDEDASTNNPLP 209

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI     + +L+GPEGG+  EE++ L +LPFV+ + LGPRILR+DTAAVAA+A++QA
Sbjct: 210 ALQAIRE-KKLGLLVGPEGGFSDEERKMLRALPFVSAIPLGPRILRADTAAVAALAVIQA 268

Query: 240 ICGDW 244
             GDW
Sbjct: 269 SVGDW 273


>gi|327191156|gb|EGE58200.1| hypothetical protein RHECNPAF_3350022 [Rhizobium etli CNPAF512]
          Length = 245

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 161/245 (65%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +A+ +Q++YLA+VLRM+    ILLFNG+DGEW + +++
Sbjct: 1   MRANFRMQRLFVDAPLSSGAAIEANAEQFNYLANVLRMEADAEILLFNGRDGEWKASLTF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q+R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEQTRPQPLPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVKLSDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 VLSAIRE-KHLALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|307308472|ref|ZP_07588176.1| protein of unknown function DUF558 [Sinorhizobium meliloti BL225C]
 gi|307319035|ref|ZP_07598466.1| protein of unknown function DUF558 [Sinorhizobium meliloti AK83]
 gi|306895449|gb|EFN26204.1| protein of unknown function DUF558 [Sinorhizobium meliloti AK83]
 gi|306901075|gb|EFN31683.1| protein of unknown function DUF558 [Sinorhizobium meliloti BL225C]
          Length = 245

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 168/246 (68%), Gaps = 4/246 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLF++ PL    + +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++I+ 
Sbjct: 1   MRANFRMQRLFIENPLHAGAKHEATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEIAM 60

Query: 61  VGK--SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ 118
             +  ++   VE Q+R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q
Sbjct: 61  PSRKQAVLVAVE-QTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQ 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
               +++RVR   I AAEQC +L +P +  P  LE LL +W  + +IVF DE   S+N L
Sbjct: 120 GKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGNDSQNPL 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L  IA    +A+LIGPEGG+   E++ L S  FVT + LGPRILR+DTAAVAAMA++Q
Sbjct: 180 PILEGIAER-RLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQ 238

Query: 239 AICGDW 244
           A  GDW
Sbjct: 239 ATLGDW 244


>gi|90426187|ref|YP_534557.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisB18]
 gi|90108201|gb|ABD90238.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisB18]
          Length = 251

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 146/245 (59%), Gaps = 2/245 (0%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +I     RL+VD  L    Q   + +Q +YL +VLR+  G  +L+FNG+DGEW + I   
Sbjct: 3   QIEFRSPRLYVDADLSAGLQVPLTREQGNYLGNVLRLSAGAAVLVFNGRDGEWQAMIGAG 62

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            +  R  +  ++R+Q    DV Y+F+P+K  RLDYM+QK++EMG  A++PV+TR+TQ T 
Sbjct: 63  KRVDRLDILSRARAQDGLPDVTYVFAPLKHARLDYMVQKAIEMGACALQPVLTRFTQVTR 122

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
            N +R+R   I AAEQC IL++  +  P  LE  L   D    +VF DE     + +  L
Sbjct: 123 VNTERMRANVIEAAEQCGILSIAAVEEPLKLERYLSTRDTGRLLVFCDEAAEVADPVAAL 182

Query: 182 HAIAHIPNVAI--LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                  +  I  +IGPEGG+  EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQ 
Sbjct: 183 GGARERASAGIDVVIGPEGGFAEEERALLLRQPNILRLALGPRIMRADTAAVAALTLVQT 242

Query: 240 ICGDW 244
           + GDW
Sbjct: 243 VLGDW 247


>gi|222106772|ref|YP_002547563.1| hypothetical protein Avi_5780 [Agrobacterium vitis S4]
 gi|221737951|gb|ACM38847.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 245

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 166/245 (67%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL+VD  L        + +QY+YLA+VLR+ EG  +L+FNG+DGEW + +++
Sbjct: 1   MRANYKMQRLYVDAGLEAANPVATTPEQYNYLANVLRLTEGAEVLVFNGRDGEWKASLAF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I    + Q+R Q + SD+ ++F+P+K  R+DY++QK+VEMG GA++PV+T++ Q 
Sbjct: 61  PTRKRIALIPQSQTRPQPRPSDLTFLFAPLKVGRMDYLVQKAVEMGAGALQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              +++R++   I AAEQC IL++P + P   L+ LL+ W    +I+F DE   ++N + 
Sbjct: 121 RIGSIERLQANVIEAAEQCGILSVPKVAPLVKLKDLLETWPATHRIIFCDEDSATDNPMP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAA+A+VQA
Sbjct: 181 ALAAIEER-QLALLVGPEGGFSDEERSLLRSLGFVTAIPLGPRILRADTAAVAALAVVQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 SIGDW 244


>gi|229259630|ref|NP_107316.2| 16S ribosomal RNA methyltransferase RsmE [Mesorhizobium loti
           MAFF303099]
          Length = 244

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   L    +  A   Q HYL HVLR+ EG  ILLFNG+DGEW + I+ 
Sbjct: 1   MRANYKMQRLFVPDDLGPDAEFDADQQQSHYLIHVLRLGEGAEILLFNGRDGEWSAAIAA 60

Query: 61  VGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K  +R +V+   R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 61  KSKKAVRLRVQTLQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      E LL  WD   ++VF DE   + N L 
Sbjct: 121 AKPSIDRLRANVVEAAEQCGILAVPEVREAEKFERLLAGWDKERRLVFCDEDASTNNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+     +A+L+GPEGG+  +E++ L +LPFVT + LGPRILR+DTAAVAA+A++QA
Sbjct: 181 ALRAVKE-KKLALLVGPEGGFSDDERKMLRALPFVTAIPLGPRILRADTAAVAALAVMQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|118590628|ref|ZP_01548029.1| hypothetical protein SIAM614_05658 [Stappia aggregata IAM 12614]
 gi|118436604|gb|EAV43244.1| hypothetical protein SIAM614_05658 [Stappia aggregata IAM 12614]
          Length = 252

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 165/250 (66%), Gaps = 8/250 (3%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           K   +++RLF+   L    + +A   Q +YL +VLR+K+GD +L+FNG DGEWL+KI   
Sbjct: 3   KYEFNMQRLFLRHILADGARIEADRSQANYLLNVLRLKDGDYVLVFNGTDGEWLAKIVSN 62

Query: 62  GK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           G+     ++  ++R QT  +D+ Y+F+P+K  RLDYM+QK+VEMG G+++PV+T++TQ +
Sbjct: 63  GRRDCTLQLMERTREQTSANDLMYMFAPLKHARLDYMVQKAVEMGAGSLKPVLTQHTQAS 122

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH---NCQIVFADETCGSEN- 176
             N++R+    I AAEQC +L +P +  P  L  +L  W       +++F DE  G+ N 
Sbjct: 123 RINLERMEANVIEAAEQCGVLAVPEVLAPQPLADVLSVWAEAQPGRRLLFCDEAEGTNNP 182

Query: 177 --SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
             SL ++      P +AILIGPEGG+  EE+  L SL FVTP+ LGPRILR+DTAAVAA+
Sbjct: 183 LLSLAQMKENGPQP-LAILIGPEGGFSEEERSLLRSLDFVTPIPLGPRILRADTAAVAAL 241

Query: 235 ALVQAICGDW 244
           A++QA  GDW
Sbjct: 242 AVLQATVGDW 251


>gi|222084972|ref|YP_002543501.1| hypothetical protein Arad_1026 [Agrobacterium radiobacter K84]
 gi|221722420|gb|ACM25576.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 162/245 (66%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   +      +A  +Q++YLA+VLRM++G  +L+FNG+DGEW ++IS+
Sbjct: 1   MRANFRMQRLFVVSDIKANAGIEADQEQFNYLANVLRMEDGAELLIFNGRDGEWKARISF 60

Query: 61  VG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q   SD+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKRILMTPIEETRPQPAPSDLHYLFAPLKVGRLDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D+VR   I AAEQC IL +P +  P  L  LL+ W    +I++ DE    +N L 
Sbjct: 121 KITNLDKVRANVIEAAEQCGILGIPDVAEPVKLADLLERWPRERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  I    ++A+L+GPEGG+  EE+  L SL FVT + LGPRILR+DTAAVAAMA++QA
Sbjct: 181 LLAKITE-KHLALLVGPEGGFSEEERALLRSLDFVTAIPLGPRILRADTAAVAAMAVIQA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 AIGDW 244


>gi|14026505|dbj|BAB53102.1| mll6903 [Mesorhizobium loti MAFF303099]
          Length = 238

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 155/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           ++RLFV   L    +  A   Q HYL HVLR+ EG  ILLFNG+DGEW + I+   K  +
Sbjct: 1   MQRLFVPDDLGPDAEFDADQQQSHYLIHVLRLGEGAEILLFNGRDGEWSAAIAAKSKKAV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           R +V+   R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ    ++D
Sbjct: 61  RLRVQTLQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQVAKPSID 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   + AAEQC IL +P +      E LL  WD   ++VF DE   + N L  L A+ 
Sbjct: 121 RLRANVVEAAEQCGILAVPEVREAEKFERLLAGWDKERRLVFCDEDASTNNPLPALRAVK 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               +A+L+GPEGG+  +E++ L +LPFVT + LGPRILR+DTAAVAA+A++QA  GDW
Sbjct: 181 E-KKLALLVGPEGGFSDDERKMLRALPFVTAIPLGPRILRADTAAVAALAVMQATVGDW 238


>gi|15964524|ref|NP_384877.1| hypothetical protein SMc00826 [Sinorhizobium meliloti 1021]
 gi|15073701|emb|CAC45343.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 245

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 167/246 (67%), Gaps = 4/246 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLF++  L    + +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++I+ 
Sbjct: 1   MRANFRMQRLFIENALHAGAKHEATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEIAM 60

Query: 61  VGK--SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ 118
             +  ++   VE Q+R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q
Sbjct: 61  PSRKQAVLVAVE-QTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQ 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
               +++RVR   I AAEQC +L +P +  P  LE LL +W  + +IVF DE   S+N L
Sbjct: 120 GKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGNDSQNPL 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L  IA    +A+LIGPEGG+   E++ L S  FVT + LGPRILR+DTAAVAAMA++Q
Sbjct: 180 PILEGIAE-RRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQ 238

Query: 239 AICGDW 244
           A  GDW
Sbjct: 239 ATLGDW 244


>gi|192289752|ref|YP_001990357.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris TIE-1]
 gi|192283501|gb|ACE99881.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           TIE-1]
          Length = 251

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 145/239 (60%), Gaps = 3/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD  L    Q     DQ +YL +VLR+  G  +L FNG+DGEW + I+   +    +
Sbjct: 10  RLFVDAALAPGAQVPLERDQSNYLGNVLRLGAGAAVLAFNGRDGEWRATIAGRKRPEALE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q+R Q +  DV Y+F+P+K  RLDYM QK+VEMG G ++PV+T++TQ    N DR+R
Sbjct: 70  VAEQTRPQDRLPDVAYVFAPLKHARLDYMAQKAVEMGAGRLQPVLTQHTQVHRLNTDRMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
              I AAEQC IL+L  +  P  L+ FL    +    +VF DE     + +  L A    
Sbjct: 130 ANVIEAAEQCGILSLAEVGEPIGLDRFLASRANGERLLVFCDEDAEIADPVAALQAARDA 189

Query: 188 P--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               V +L+GPEGG+ +EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQA+ GDW
Sbjct: 190 AARGVDLLVGPEGGFSTEERALLLKQPVILRLALGPRIMRADTAAVAALTLVQAVLGDW 248


>gi|39934226|ref|NP_946502.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris CGA009]
 gi|39648074|emb|CAE26594.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 251

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 145/239 (60%), Gaps = 3/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD  L    Q     DQ +YL +VLR+  G  +L FNG+DGEW + I+   +    +
Sbjct: 10  RLFVDAALAPGAQVPLERDQSNYLGNVLRLGAGAAVLAFNGRDGEWRATIAGRKRPEALE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q+R Q +  DV Y+F+P+K  RLDYM QK+VEMG G ++PV+T++TQ    N DR+R
Sbjct: 70  VAEQTRPQDRLPDVAYVFAPLKHARLDYMAQKAVEMGAGRLQPVLTQHTQVHRLNTDRMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
              I AAEQC IL+L  +  P  L+ FL    +    +VF DE     + +  L A    
Sbjct: 130 ANVIEAAEQCGILSLAEVGEPIGLDRFLAGRANGERLLVFCDEDAEIADPVAALQAARDA 189

Query: 188 P--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               V +L+GPEGG+ +EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQA+ GDW
Sbjct: 190 AARGVDLLVGPEGGFSTEERALLLKQPAILRLALGPRIMRADTAAVAALTLVQAVLGDW 248


>gi|170751754|ref|YP_001758014.1| hypothetical protein Mrad2831_5384 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658276|gb|ACB27331.1| protein of unknown function DUF558 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 250

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 135/220 (61%), Gaps = 4/220 (1%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQYIF 86
           Q +YL +VLR    D +L+FNG+ GEW + +   G K     V  Q+R QT+++D+ Y+F
Sbjct: 29  QANYLLNVLRRGPDDPVLVFNGRHGEWRAHLVQTGRKGADLHVAAQTRPQTERADLHYLF 88

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           +P+K+ RLDY+ QK+VEMG G IRPVITR+TQ    N+DR+R   + AAEQC IL +P  
Sbjct: 89  APLKSARLDYLAQKAVEMGAGTIRPVITRFTQGDRVNIDRLRANAVEAAEQCGILAIPEC 148

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH---IPNVAILIGPEGGYHSE 203
             P  L   L        +VF DE     + +  L A       P +A+L+GPEGG+  E
Sbjct: 149 PEPERLPAALAGLAPGRLLVFCDEDAPVRDPVAALRAAGDPLAPPPLAVLVGPEGGFSEE 208

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           E+  + + P    LSLGPRILR+DTAAVA + LVQA+ GD
Sbjct: 209 ERALILARPNTVALSLGPRILRADTAAVAVLTLVQAVLGD 248


>gi|217979033|ref|YP_002363180.1| protein of unknown function DUF558 [Methylocella silvestris BL2]
 gi|217504409|gb|ACK51818.1| protein of unknown function DUF558 [Methylocella silvestris BL2]
          Length = 253

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 151/241 (62%), Gaps = 6/241 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL  + +      Q +YL + LR+K+G  IL FNG+DGEW ++I   G+ S   
Sbjct: 10  RLYVDAPLAPQARVSLEAPQVNYLRNALRLKDGAEILAFNGRDGEWRARIETEGRRSTVL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             + Q R Q    D+ Y+F+P+K  RLDYM+QK+VEMG G +RPV+TR TQ    N+DR+
Sbjct: 70  AADQQLRPQPPPFDLHYLFAPLKHARLDYMVQKAVEMGAGQLRPVLTRRTQAERINLDRM 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC +L++  I  P  L+  L  W  +  +VF DE    ++ +  L A A  
Sbjct: 130 RANAIEAAEQCGVLSVAEIIAPIRLDAALAQWSPDRLLVFCDEDAPEQDPVAALRA-ARE 188

Query: 188 PN----VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            N    +A+LIGPEGG+  +E++ L + P    LSLGPR+LR+DTAAVAA+ALVQA  GD
Sbjct: 189 SNPGGGLAVLIGPEGGFDEDERKALLAAPRTVRLSLGPRVLRADTAAVAALALVQASIGD 248

Query: 244 W 244
           W
Sbjct: 249 W 249


>gi|170740484|ref|YP_001769139.1| hypothetical protein M446_2244 [Methylobacterium sp. 4-46]
 gi|168194758|gb|ACA16705.1| protein of unknown function DUF558 [Methylobacterium sp. 4-46]
          Length = 265

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 143/248 (57%), Gaps = 13/248 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLF+D P+           Q +YL  VLR  EGD +L+FNG+DGEW ++I   G K+   
Sbjct: 10  RLFLDVPMAEGVVHGLDRAQANYLLGVLRRGEGDGVLVFNGRDGEWWAEIRPTGRKAGDL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  ++R QT+  D+ Y+F+P+K  RLDY+ QK+VEMG   IRPVITR TQ     +DR+
Sbjct: 70  VLRRRTRPQTEPGDLHYLFAPLKAARLDYVAQKAVEMGASLIRPVITRRTQGDRIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-HAIAH 186
           R   + AAEQC IL +P I     L   L   + +  +VF DE     + +  L   +A 
Sbjct: 130 RANAVEAAEQCGILAIPEIAEAAPLTEALAALEADRLLVFCDEDAPVRDPVAALRQGVAR 189

Query: 187 IPN-----------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            P            +A++IGPEGG+  EE+  +   P    LSLGPRILR+DTAAVA +A
Sbjct: 190 PPAGAGRGGNVPLPLAVVIGPEGGFTPEERALILERPTTIRLSLGPRILRADTAAVAVLA 249

Query: 236 LVQAICGD 243
           LVQA+ GD
Sbjct: 250 LVQAVLGD 257


>gi|182679209|ref|YP_001833355.1| hypothetical protein Bind_2249 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635092|gb|ACB95866.1| protein of unknown function DUF558 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 250

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/238 (44%), Positives = 143/238 (60%), Gaps = 6/238 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RL++D PL           Q HYL  VLR+  GD+IL+FNG++GEW + +   G K+++ 
Sbjct: 10  RLYLDQPLRAGGTVALDKSQAHYLCTVLRLVAGDHILVFNGREGEWRAALKESGRKTVQI 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q R+Q   +D+ Y+F+P+K  RLDYM QK+VEMG   ++P+ TR TQN   N++R+
Sbjct: 70  EPIEQVRTQEPDNDLHYLFAPLKHARLDYMAQKAVEMGASLLQPLFTRRTQNERINLERL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC ILTLP I     L+  L   D N  +VF DE       L  L      
Sbjct: 130 RANAIEAAEQCGILTLPEIAEAVKLDAYLARRDQNRVLVFCDEDAPPIGPLAALREALRP 189

Query: 188 PNVA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
             VA     +LIGPEGG+ + E++ L S P    +SLGPRILR+DTAAVA +ALVQAI
Sbjct: 190 GGVACRGADVLIGPEGGFDATERDLLVSQPNHIRISLGPRILRADTAAVAVLALVQAI 247


>gi|312114482|ref|YP_004012078.1| hypothetical protein Rvan_1732 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219611|gb|ADP70979.1| protein of unknown function DUF558 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 242

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 141/239 (58%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           ++R+FV   L    +      Q HYL +VLR+ EG  +L F+G  GEW +KI    KS  
Sbjct: 3   MQRIFVANKLDPDGEIALDTAQAHYLLNVLRLSEGAEVLTFDGTSGEWRAKIVKARKSAC 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             ++  + R QT  + + Y F+P+K  RLDYM+QK+VEMG   ++PVIT++T       D
Sbjct: 63  TIRLMEKVREQTAPTGIHYAFAPLKQARLDYMVQKAVEMGASLLQPVITQHTAVPRLGAD 122

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R++   I AAEQC +LTLP I  P      L+ +D +  +VF DE     + L+ L A++
Sbjct: 123 RMKANAIEAAEQCGVLTLPEIKAPVKFAAFLQAFDKDRALVFCDERAEVASPLDALSALS 182

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               V  LIGPEGG+   E+  L S  FV P+SLGPRI+R+DTAAVA +AL+    GDW
Sbjct: 183 G-RKVTALIGPEGGFSENERADLLSRSFVCPISLGPRIMRADTAAVAVLALLNVTVGDW 240


>gi|23010926|ref|ZP_00051451.1| COG1385: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 250

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 142/239 (59%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLFV+  L           Q +YL  VLR  E D +LLFNG+DGEW ++I   G KS   
Sbjct: 10  RLFVESDLAEGLILPLERAQANYLLTVLRRSETDPVLLFNGRDGEWRAEIVPQGRKSADL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  ++R Q    D+ Y+F+P+KT RLDYM QK+VEMG G IRPV TR+TQ     ++R+
Sbjct: 70  RVVTRTRPQPAPPDLHYLFAPLKTGRLDYMAQKAVEMGAGLIRPVFTRFTQGERIKLERL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL---EKLHAI 184
           R   + AAEQC IL++P I  P  L   L        +VF DE     + +         
Sbjct: 130 RANAVEAAEQCGILSIPEIAEPARLPACLDALAPERLLVFCDEDAPVSDPVAALRAAADP 189

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           AH P +A+L+GPEGG+H EE+  + + P    LSLGPRILR+DTAAVA + LVQA+ GD
Sbjct: 190 AHPPPLAVLVGPEGGFHEEERALIAARPNTVALSLGPRILRADTAAVAVLTLVQAVLGD 248


>gi|307941761|ref|ZP_07657116.1| surface protein [Roseibium sp. TrichSKD4]
 gi|307775369|gb|EFO34575.1| surface protein [Roseibium sp. TrichSKD4]
          Length = 252

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 166/244 (68%), Gaps = 6/244 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RLF+   L    + +A   Q +YL +VLR+K+GD +L F+G++GEWL++I   G K+ 
Sbjct: 8   MQRLFLRHILADGARIEADRSQANYLLNVLRLKDGDKVLAFDGQNGEWLTEIKVTGRKAC 67

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             ++  Q+R Q K +D+ Y+F+P+K  RLDYM+QK+VEMG+G+++PV+T++TQ +  N++
Sbjct: 68  VLELVEQTRPQEKSADLLYLFAPLKHARLDYMVQKAVEMGVGSLQPVMTQHTQTSRVNLE 127

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNW--DHNCQI-VFADETCGSENSLEKLH 182
           R+    I AAEQC +L++P +  P  L+ LL NW   H  ++ +F DE   + N L  L 
Sbjct: 128 RMEANVIEAAEQCGVLSVPGVVEPEPLKALLANWPEKHPGRVLLFCDEGSETTNPLGDLA 187

Query: 183 AI--AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
            +  A   ++A+L+GPEGG+ +EE+  LH   FV  + LGPRILR+DTAAVAA+A++QA 
Sbjct: 188 KLVEAKPESIALLVGPEGGFSTEERSILHQSDFVVSIPLGPRILRADTAAVAALAVIQAT 247

Query: 241 CGDW 244
            GDW
Sbjct: 248 LGDW 251


>gi|146342924|ref|YP_001207972.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium sp.
           ORS278]
 gi|146195730|emb|CAL79757.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 249

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 149/236 (63%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL          +Q +YL +VLR+  GD +L+FNG++GEW + I+   ++    
Sbjct: 10  RLFVDAPLIEGGAVALDRNQSNYLGNVLRLGAGDQVLVFNGREGEWQATIAGRKRADLLT 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           ++ + R Q +  D+ Y+F+P+K  RLDY++QK+VEMG   ++PV+TR+TQ +  N +R+R
Sbjct: 70  IQQRLRPQDQLPDITYVFAPLKHARLDYIVQKAVEMGAAVLQPVLTRHTQVSRLNGERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL+L  +  P  LE  L+    +  +VF DE     + ++ L   A   
Sbjct: 130 ANVIEAAEQCGILSLAEVRDPVPLERFLRERMASRLLVFCDEAAEIADPVQALRGAAANA 189

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            + +LIGPEGG+ +EE+E L     VT L+LGPRILR+DTA VAA+AL+QA  GDW
Sbjct: 190 GIDLLIGPEGGFAAEERELLLRQRQVTRLALGPRILRADTAGVAALALLQATLGDW 245


>gi|90419943|ref|ZP_01227852.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335984|gb|EAS49732.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 280

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 156/237 (65%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSIRF 67
           RL++D  L  +T   A+  Q +YL +V+R+ EG  +L FNG+DGEW  + +    K +  
Sbjct: 42  RLYLDTDLVAETPVPATPVQANYLLNVMRLGEGAQVLAFNGRDGEWRCELVKAAKKKLDL 101

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               + R QT  +D+ Y+F+P+K  RLDYM+QK+VEMG G ++PV+T++ Q T  N +R+
Sbjct: 102 VPRERVRDQTPPADLHYLFAPLKHARLDYMVQKAVEMGAGVLQPVMTQHVQATRLNTERM 161

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC IL++P    P     LL  WD   +++F DE   + + ++ L A+   
Sbjct: 162 RANAIEAAEQCGILSIPECREPVKFNDLLDRWDSGRRLIFCDERADAASPIDTLRALPEG 221

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P+ A++IGPEGG+ ++E+E L++  FVT +SLGPRILR+DTAAVAAMA++QA  GDW
Sbjct: 222 PH-ALVIGPEGGFSADERERLNAADFVTAISLGPRILRADTAAVAAMAVLQAAIGDW 277


>gi|254703098|ref|ZP_05164926.1| 16S ribosomal RNA methyltransferase RsmE [Brucella suis bv. 3 str.
           686]
          Length = 214

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/211 (48%), Positives = 143/211 (67%), Gaps = 2/211 (0%)

Query: 35  VLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNR 93
           +LRMKEGD +L+FNG+DGEW + +   G K +  +   Q+R Q K S++ Y F+P+K  +
Sbjct: 1   MLRMKEGDEVLVFNGRDGEWKASLQPEGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGQ 60

Query: 94  LDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE 153
           LDYM+QK+VEMG G ++PVIT++TQ      +R+R   I AAEQC +L+LP        +
Sbjct: 61  LDYMVQKAVEMGAGVLQPVITQHTQVPRLGTERIRANAIEAAEQCGVLSLPDCREALRFD 120

Query: 154 FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPF 213
             L  WD + +++F DE   S++ L  L  +   P+  +LIGPEGG+  EE++ LH LPF
Sbjct: 121 RFLDQWDTSRRLIFCDEGHESDDPLSILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPF 179

Query: 214 VTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           VT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 180 VTAIPLGPRILRADTAAVAAMALVQAVLGDW 210


>gi|27382634|ref|NP_774163.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium japonicum
           USDA 110]
 gi|27355806|dbj|BAC52788.1| blr7523 [Bradyrhizobium japonicum USDA 110]
          Length = 252

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 144/237 (60%), Gaps = 1/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL    +     DQ +YL +VLR+  G  +L FNG+DGEW + I    +     
Sbjct: 11  RLFVDAPLAQDARVPLDRDQSNYLGNVLRLAAGAEVLAFNGRDGEWQAAIEGRKRPDGLV 70

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q+R Q + +D+ Y+F+P+K  RLDYM+QK++EMG   ++PV+TR+TQ +  N +R+R
Sbjct: 71  ILQQTRPQDRLADLTYVFAPLKHARLDYMVQKAIEMGAAGLQPVLTRFTQASRVNTERMR 130

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI- 187
              + A+EQC IL++  +  P  LE  L        ++F DE    EN ++ L       
Sbjct: 131 ANVVEASEQCGILSIATVAEPVPLERFLSQRAAGRLLIFCDEAAEVENPVQSLQGAREAG 190

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +LIGPEGG+  EE+  L   P +  L+LGPRI+R+DTAAVAA+ALVQ + GDW
Sbjct: 191 QGIDVLIGPEGGFAEEERALLLRQPKILRLALGPRIMRADTAAVAALALVQTVLGDW 247


>gi|83859513|ref|ZP_00953034.1| hypothetical protein OA2633_13950 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852960|gb|EAP90813.1| hypothetical protein OA2633_13950 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 254

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 148/249 (59%), Gaps = 13/249 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RL++D PL          DQ HYL +V+R K GD + LFNG+DGEW ++++    K    
Sbjct: 6   RLYIDAPLEAGAVLDLDRDQAHYLVNVMRRKPGDGVRLFNGRDGEWRAEVASADRKRASL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           ++  Q RSQ+   D+   F+P+K  R D++++K+ E+G+ +I PVIT+ TQ+     DR+
Sbjct: 66  QIVQQRRSQSATPDMALYFAPVKKARTDFIVEKATELGVASITPVITQRTQSERVRTDRM 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS---------- 177
           +  T  A+EQ + L LP I+ P +L  +LK WD    ++FADE+  S+            
Sbjct: 126 QALTREASEQTERLDLPVIHEPVSLTQMLKGWDEARTLMFADESGDSQTEPWGGEHGRAR 185

Query: 178 --LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
              E L         A+L+GPEGG+  EE+  LH+  FV P+SLGPRILR+DTAA AA++
Sbjct: 186 PMAEALAGRERGGKWAMLVGPEGGFSVEERTLLHAQTFVLPVSLGPRILRADTAAAAALS 245

Query: 236 LVQAICGDW 244
           + Q++ GDW
Sbjct: 246 VWQSMLGDW 254


>gi|254503148|ref|ZP_05115299.1| conserved hypothetical protein TIGR00046 [Labrenzia alexandrii
           DFL-11]
 gi|222439219|gb|EEE45898.1| conserved hypothetical protein TIGR00046 [Labrenzia alexandrii
           DFL-11]
          Length = 264

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 165/249 (66%), Gaps = 6/249 (2%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           K    ++RLF+   L    + +A   Q +YL +VLR+K+GD +L+FNG DGEWL+KI   
Sbjct: 15  KYEFKMQRLFLRHILADGARIEADRGQANYLLNVLRLKDGDYVLVFNGSDGEWLAKIQSS 74

Query: 62  GK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           G+ +   ++  ++R QT  +D+ Y+F+P+K  RLDYM+QK+VEMG G++ PV+T++TQ++
Sbjct: 75  GRRACSLQLMERTRDQTAPNDLIYMFAPLKHARLDYMVQKAVEMGAGSLMPVMTQHTQSS 134

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH---NCQIVFADETCGSENS 177
             N++R+    I AAEQC +L++P +  P +L+ +L  W       +++F DE   + N 
Sbjct: 135 RVNVERMEANVIEAAEQCGVLSVPTVLSPMSLKDVLTAWPEAHAGRKLLFCDEGEETNNP 194

Query: 178 LEKLHAIAH--IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           L  L  +     P +AILIGPEGG+  +E+  L  L FVTP+ LGPRILR+DTAAVAA+A
Sbjct: 195 LLTLVQLKENGPPPLAILIGPEGGFSKDERGLLKDLDFVTPIPLGPRILRADTAAVAALA 254

Query: 236 LVQAICGDW 244
           +VQA  GDW
Sbjct: 255 VVQATVGDW 263


>gi|220920410|ref|YP_002495711.1| hypothetical protein Mnod_0365 [Methylobacterium nodulans ORS 2060]
 gi|219945016|gb|ACL55408.1| protein of unknown function DUF558 [Methylobacterium nodulans ORS
           2060]
          Length = 267

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/243 (43%), Positives = 142/243 (58%), Gaps = 9/243 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLF+D P+    +      Q +YL  VLR  EGD +L+FNG+DGEW ++I   G K+   
Sbjct: 10  RLFLDLPMREGMRHSLDRAQANYLLGVLRRGEGDGVLVFNGRDGEWRAEIQPTGRKAGDL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q+R QT   ++ Y+F+P+K  RLDY+ QK+VEMG   IRPVITR TQ     +DR+
Sbjct: 70  ILREQTRPQTPPGNLHYLFAPLKAARLDYVAQKAVEMGASLIRPVITRRTQGDRIKLDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           R   I AAEQC ILT+P I     L   L   +    +VF DE     + +  L      
Sbjct: 130 RANAIEAAEQCGILTIPEIAEAAPLPAALSALEAERLLVFCDEDAPVADPIMTLRQAGAG 189

Query: 185 ----AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                 +P +A++IGPEGG+  EE+  +   P    LSLGPRILR+DTAAVA +ALVQA+
Sbjct: 190 REGNGGLP-LAVVIGPEGGFTPEERALILDRPNTVRLSLGPRILRADTAAVAVLALVQAV 248

Query: 241 CGD 243
            GD
Sbjct: 249 LGD 251


>gi|149913421|ref|ZP_01901954.1| hypothetical protein RAZWK3B_08971 [Roseobacter sp. AzwK-3b]
 gi|149812541|gb|EDM72370.1| hypothetical protein RAZWK3B_08971 [Roseobacter sp. AzwK-3b]
          Length = 241

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 138/237 (58%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR-F 67
           RL+V+ PL        + DQ HYL  V+R   GD +L FNG+DGEWL  +    K     
Sbjct: 7   RLYVEHPLGEGQTVPLNRDQAHYLFAVMRRGAGDALLAFNGRDGEWLVTVQEASKKGGVL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +VE Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 67  RVEKQTAPQRNPPDLWVLFAPIKKARTDFIVEKAAEMGAARILPVQTDFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + I AAEQC    +P +     L+ LL++W    Q++F DE      + + L A+   
Sbjct: 127 QAHAIEAAEQCGGTYVPEVADLQKLDQLLQDWPEGRQLMFCDEALA--GAAQNLGAVGG- 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E+  LH+LPF  P+SLGPRILR+DTAAVAAM + Q   GDW
Sbjct: 184 PAWAILIGPEGGFSEAERARLHALPFAHPVSLGPRILRADTAAVAAMTVWQMALGDW 240


>gi|115522898|ref|YP_779809.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisA53]
 gi|115516845|gb|ABJ04829.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisA53]
          Length = 258

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 146/238 (61%), Gaps = 2/238 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL   TQ   + +Q +YL +VLR+  G  +L FNG DGEW + I    +  R +
Sbjct: 10  RLFVDAPLVAGTQVPLTREQANYLGNVLRLSPGGRVLAFNGSDGEWQALIVGGKRLERLE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q+R Q +  DV Y ++P+K  RLDYM+QK+VE+G  A+ PV+TR+TQ T  N +R+R
Sbjct: 70  MLLQTRPQDRLPDVTYAYAPLKHARLDYMVQKAVELGAAALVPVLTRFTQATRVNTERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL+L  +  PT LE  L   D    +VF DE     + +  L       
Sbjct: 130 ANVIEAAEQCGILSLAAVEEPTKLERWLTARDGQRLLVFCDEDAEIADPVAALAGARDRA 189

Query: 189 NVAI--LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              I  LIGPEGG+  EE++ L   P V  L+LGPRI+R+DTAAVAA+ALVQA+ GDW
Sbjct: 190 QAGIDVLIGPEGGFAEEERDLLLRQPSVLRLALGPRIMRADTAAVAALALVQAVLGDW 247


>gi|302381943|ref|YP_003817766.1| hypothetical protein Bresu_0829 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192571|gb|ADL00143.1| protein of unknown function DUF558 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 237

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 141/237 (59%), Gaps = 5/237 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSIRF 67
           RL V  PL        + DQ  YL  V+R+K GD++L+FNG+DGEW +  +  + K +  
Sbjct: 3   RLHVTQPLAPGAAVAPTLDQSRYLTQVMRLKLGDDLLVFNGRDGEWRATLVEILKKGVIL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           + E Q R Q    D++ I + +K +R++ +++K+ E+G   +R  IT+ T   H  +DR+
Sbjct: 63  RAEDQVRPQAYGPDLELIVAVVKKSRVETIVEKAAELGAARVRLTITQRTNVDHVRLDRL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ   L +P +  P  L  LL  WD + +++F DET G+  +     A+   
Sbjct: 123 DAIAIEAAEQTGRLDVPTVDDPQKLGALLDGWDPSRRLMFCDETGGAPVA----SAVTES 178

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+  EE++ L +LPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 179 GPWAILIGPEGGFSPEERDRLRALPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 235


>gi|296444351|ref|ZP_06886316.1| protein of unknown function DUF558 [Methylosinus trichosporium
           OB3b]
 gi|296257998|gb|EFH05060.1| protein of unknown function DUF558 [Methylosinus trichosporium
           OB3b]
          Length = 247

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 145/238 (60%), Gaps = 1/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIR 66
           +RLFVD  L    +    GD+ +YL +VLR++EGD +LLFNG+DGEWL+++  V + S  
Sbjct: 9   QRLFVDERLEAGARMIPDGDRLNYLLNVLRLREGDGVLLFNGRDGEWLARLEKVTRRSAE 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                ++R QT   D+ Y F+P+K  RLDYM QK+ EMG   + P+ITR TQ    N+ R
Sbjct: 69  LVATTRAREQTAPCDLHYCFAPLKHARLDYMAQKATEMGASRLVPIITRRTQARRVNLTR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC +L +P +    +L+  L     +  +VF DE     + +  L A   
Sbjct: 129 LRANAIEAAEQCGVLGVPEVAEEVSLDAFLAGLCASRLLVFCDEAAEIADPVAALRAAPE 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              +A++IGPEGG+  EE+  + S   V  L+LGPRILR+DTAAVAA+A+VQ   GDW
Sbjct: 189 HEGIAVIIGPEGGFDEEERRAILSAGKVARLALGPRILRADTAAVAALAIVQTTIGDW 246


>gi|197104001|ref|YP_002129378.1| hypothetical protein PHZ_c0535 [Phenylobacterium zucineum HLK1]
 gi|196477421|gb|ACG76949.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 239

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 137/237 (57%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV   L    +      Q  YLA V+R K GD + +FNG+DGEW + ++ VGK ++  
Sbjct: 3   RLFVTHDLSAGAELALDEGQSRYLAAVMRAKAGDELRVFNGRDGEWRALVAAVGKRAVTL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V   +R Q    D+  + + +K   L+ +++K+ E+G   IRPV+T  T   H  ++R+
Sbjct: 63  QVIDPARPQAPGPDLDLVVALVKRAPLETIVEKAAELGARRIRPVVTERTNADHTRVERL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R     A+EQ   L +P +  P  LE LL  W+   +++F DE   +   LE L   A  
Sbjct: 123 RAIATEASEQTGRLDVPEVTEPVKLERLLAEWEPGRRLLFCDEAGDARPVLEALEGAAG- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+E L +LP+  P SLGPRILR+DTAA++A+AL QA  GDW
Sbjct: 182 -PWAILIGPEGGFSPREREALRALPYAVPASLGPRILRADTAAISALALWQAAAGDW 237


>gi|209886372|ref|YP_002290229.1| hypothetical protein OCAR_7260 [Oligotropha carboxidovorans OM5]
 gi|209874568|gb|ACI94364.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 246

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 145/236 (61%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL    +   + +Q HYL +VLR+   D +L+FNG+DGEW ++I+   +  +  
Sbjct: 10  RLFVDAPLGAGREVALAREQGHYLGNVLRLSASDTVLVFNGRDGEWRAQITGRKRLEQLT 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
              Q+R Q    D+  +F+P+K  RLDYM+QK+VEMG   + P +T++TQ +  N++R+R
Sbjct: 70  PLEQTRPQDPPCDLHLLFAPLKHARLDYMVQKAVEMGASRLTPTLTQFTQVSRINLERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQC IL LP I  P  L   L   D    +VF DE     + L  L   A+  
Sbjct: 130 ANAIEAAEQCGILNLPEIDEPLPLTGRLAERDGKRLLVFCDEAAPQASPLAALKEAANDG 189

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            + +LIGPEGG+  +E+  L + P +  LSLGPRILR+DTAAVAA+ALVQA  GDW
Sbjct: 190 GLDVLIGPEGGFSEDERAALLAQPRLVRLSLGPRILRADTAAVAALALVQAALGDW 245


>gi|89070197|ref|ZP_01157525.1| hypothetical protein OG2516_16646 [Oceanicola granulosus HTCC2516]
 gi|89044213|gb|EAR50364.1| hypothetical protein OG2516_16646 [Oceanicola granulosus HTCC2516]
          Length = 237

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 7/238 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL          +Q HYL  V+R+ EG  +LLFNG+DGEW ++++  GK     
Sbjct: 5   RLYVDHPLGAGQTVPLIREQAHYLFGVMRLGEGAEVLLFNGRDGEWSARVAEAGKRGGTL 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+R      D+  +F+P+K  R D++++K+VEMG   + PV T +T +     DR+
Sbjct: 65  ACAAQTRPLAPPPDLWLLFAPVKKARTDFIVEKAVEMGAARLCPVQTEFTNSERIRRDRL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC   T+P +     L+ LL  WD + +I+  DET   +++     A+   
Sbjct: 125 QAHAVEAAEQCGATTVPEVADLARLDRLLDGWDPSRRIMLCDETRAGDDA-----ALPAE 179

Query: 188 PNV-AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P   AILIGPEGG+   E+  L +LPF  P++LGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 180 PGPWAILIGPEGGFSDAERARLAALPFTRPVALGPRILRADTAAVAALTLWQTQLGDW 237


>gi|92118652|ref|YP_578381.1| 16S ribosomal RNA methyltransferase RsmE [Nitrobacter hamburgensis
           X14]
 gi|91801546|gb|ABE63921.1| protein of unknown function DUF558 [Nitrobacter hamburgensis X14]
          Length = 261

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/239 (43%), Positives = 149/239 (62%), Gaps = 5/239 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL    +     +Q +YL +VLR+  G N+L+FNG+DGEW + IS   +     
Sbjct: 10  RLYVDAPLEPGGKVPLDRNQGNYLGNVLRLGSGANVLVFNGRDGEWRAAISGRKRPECLD 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +   +R+Q +  D+ Y+F+P+K  RLDYM+QK+VEMG+ A++PV+TR+TQ    N +R+R
Sbjct: 70  IVAAARAQDRLPDLHYVFAPLKHARLDYMVQKAVEMGVSALQPVLTRFTQVARVNGERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN---SLEKLHAIA 185
              I AAEQC IL+L  +  P TL+  L        +V  DE     N   +LE +   A
Sbjct: 130 ANVIEAAEQCGILSLAAVEEPVTLDRWLGRRAPERLLVLCDEAALVTNPAAALEPMRGAA 189

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           H   + +L+GPEGG+  +E+  L + P    LSLGPRILR+DTAAVAA+ALVQ + GDW
Sbjct: 190 H--GIDVLVGPEGGFAEDERANLLNQPNTLRLSLGPRILRADTAAVAAIALVQTVLGDW 246


>gi|288957600|ref|YP_003447941.1| ribosomal RNA small subunit methyltransferase [Azospirillum sp.
           B510]
 gi|288909908|dbj|BAI71397.1| ribosomal RNA small subunit methyltransferase [Azospirillum sp.
           B510]
          Length = 259

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/240 (39%), Positives = 139/240 (57%), Gaps = 8/240 (3%)

Query: 9   RLFVDFPLCIKTQGKASG---DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
           RL+VD PL    +G++ G   ++ H+L HVLR+  GD + +FNG+DGEW + I   GK  
Sbjct: 8   RLYVDSPL---AEGQSVGLDHERAHFLRHVLRLDRGDAVAVFNGRDGEWRAVIDGFGKGW 64

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +  Q R Q    D+  +F+P+K  R+D++ +K+ EMG+  + PV TR T     N+
Sbjct: 65  CSLTLAEQRREQDTGPDLWLVFAPLKKGRIDFVAEKATEMGVSRLCPVFTRRTDPNRVNL 124

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           DR+R   + AAEQC+ L++P +     L+  L  W    ++    E   +    E L   
Sbjct: 125 DRLRANAVEAAEQCERLSVPDLADALPLDRALAAWPAERRLYLCAEAGAARPIAEVLRDA 184

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           A  P  A+L+GPEGG+   E + L  LPFV P+ LGPRILR+DTA VAA+A  Q++ GDW
Sbjct: 185 AAGP-AALLVGPEGGFDQSELDELAKLPFVVPVGLGPRILRADTAVVAALACWQSLAGDW 243


>gi|260575962|ref|ZP_05843957.1| protein of unknown function DUF558 [Rhodobacter sp. SW2]
 gi|259021888|gb|EEW25189.1| protein of unknown function DUF558 [Rhodobacter sp. SW2]
          Length = 245

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 139/238 (58%), Gaps = 2/238 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL +      + DQ +YL  V+R+  GD +LLFNG+DGEW   ++  GK     
Sbjct: 7   RLYVDQPLGVGQPVPLNADQANYLFAVMRLGRGDAVLLFNGRDGEWRGVVAEAGKRGGVL 66

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V + Q+R      D+  +F+PIK  R D++++K+ E+G   I PV TR+T       DR+
Sbjct: 67  VCDAQTRPLQMPPDLWLLFAPIKKARTDFIVEKAAELGASRILPVQTRFTNAERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L+ +L  W    ++++ DE   G  ++L  L A A 
Sbjct: 127 QAHAVEAAEQCGGTFVPEVCDLQGLDKVLDTWPAERRLLWCDEHMVGGSSALTGLLATAR 186

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E+  L  LP V P+SLGPRILR+DTAAVAA+ L QA  GDW
Sbjct: 187 GGPWAILIGPEGGFAESEQARLRGLPQVVPISLGPRILRADTAAVAALVLWQAALGDW 244


>gi|167644342|ref|YP_001682005.1| 16S ribosomal RNA methyltransferase RsmE [Caulobacter sp. K31]
 gi|167346772|gb|ABZ69507.1| protein of unknown function DUF558 [Caulobacter sp. K31]
          Length = 238

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 135/237 (56%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV  PL +      + DQ  YL  V+R+  GD IL+FNG+DGEW   ++  GK     
Sbjct: 3   RLFVPHPLKVGAGVAPTVDQSRYLTAVMRLNVGDEILVFNGQDGEWRCGLTEAGKRGCLL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           + E Q+R Q    D+  + + +K  R++ +++K+ E+G   +R   TR T      + R+
Sbjct: 63  RCEEQTREQDHAPDLDLVVAMVKRGRVETIVEKAAELGARRVRLTQTRRTNVDFLKLGRL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ   L +P I  P  L+ +L  WD   ++VF DE   +   +E +      
Sbjct: 123 DAIAIEAAEQTGRLDVPVIDDPMKLDKILDTWDPARRLVFCDEGGDARTMIEAVTGTGA- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+  EE++ L SLPFV P+SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 182 -PAAILIGPEGGFAPEERKRLRSLPFVIPVSLGPRILRADTAAIAAMTLWQAAAGDW 237


>gi|119383376|ref|YP_914432.1| hypothetical protein Pden_0624 [Paracoccus denitrificans PD1222]
 gi|119373143|gb|ABL68736.1| protein of unknown function DUF558 [Paracoccus denitrificans
           PD1222]
          Length = 239

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 140/237 (59%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLF+D PL      + + DQ HYL+ V+R   GD IL+FNG+DGEWL++I  + K     
Sbjct: 5   RLFIDHPLAEGQGIELNADQSHYLSSVMRQGAGDEILVFNGQDGEWLARIERIAKRGGAL 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 65  EALRQTAPQLNPPDLWLVFAPIKKARTDFIVEKAAEMGAARILPVQTDHTNSERIRQDRL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL  WD   +I++ADE       +  L  +   
Sbjct: 125 QAHAVEAAEQCGGTHVPEVCDLVPLSRLLDGWDAGRRILWADEALAGPAQV--LSGLPRG 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E++ L ++  VT ++LGPRILR+DTAAVA++AL QA  GDW
Sbjct: 183 P-WAILIGPEGGWSESERKRLSAMDCVTRIALGPRILRADTAAVASLALWQASLGDW 238


>gi|84685244|ref|ZP_01013143.1| hypothetical protein 1099457000257_RB2654_10264 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666976|gb|EAQ13447.1| hypothetical protein RB2654_10264 [Rhodobacterales bacterium
           HTCC2654]
          Length = 241

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFVD  L          D+ HYL  V+R   GD + LFNG+DGEW ++++  GK +   
Sbjct: 8   RLFVDESLREGQTIPLERDKAHYLFGVMRQAVGDRVALFNGRDGEWTAEVTLAGKRNGVL 67

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV+T +T +    +DR+
Sbjct: 68  TCLGQAAPQLDPPDLWLMFAPIKKARTDFIVEKAAEMGASRIVPVLTEFTNSERVRVDRL 127

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +  P  L+ LL  WD   +++F DE    EN  + L   A  
Sbjct: 128 QAHAVEAAEQCGGTFVPEVAEPEKLDRLLDGWDGARRLMFCDEALAGEN--KPLSGAAGA 185

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E++ LH +     +SLGPRILR+DTAAVAAM L Q+  GDW
Sbjct: 186 P-WAILIGPEGGFSDAERKRLHGMESAVSVSLGPRILRADTAAVAAMTLWQSALGDW 241


>gi|154248025|ref|YP_001418983.1| 16S ribosomal RNA methyltransferase RsmE [Xanthobacter
           autotrophicus Py2]
 gi|154162110|gb|ABS69326.1| protein of unknown function DUF558 [Xanthobacter autotrophicus Py2]
          Length = 242

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/222 (41%), Positives = 135/222 (60%), Gaps = 4/222 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW-LSKISYVGKSIR 66
           +RL+VD  L        + +Q HY+A+V+R+  G ++LLFNG+DGEW  ++++   + +R
Sbjct: 9   QRLYVDAELGPDASVLLAPEQAHYVANVIRLAVGQDLLLFNGRDGEWRATRVAGGKRDVR 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
           F+V  Q R Q +   ++Y F+P+K  RLDYM+QK+VEMG G + PVITRYTQ +  N+DR
Sbjct: 69  FEVSAQVRPQPEAPTLEYAFAPLKHARLDYMVQKAVEMGAGVLSPVITRYTQVSRINLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    + AAEQC IL+LP +  P  L   L        +VF DE     + +  L     
Sbjct: 129 MAANAVEAAEQCGILSLPHVAEPRPLAQWLDALPAERVLVFCDEAAADHDPIHALRTAPS 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
            P V++LIGPEGG+  +E+  +   P    LSLGPRILR+DT
Sbjct: 189 GP-VSVLIGPEGGFSPDERALIA--PRAVTLSLGPRILRADT 227


>gi|126727781|ref|ZP_01743611.1| hypothetical protein RB2150_10474 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702908|gb|EBA02011.1| hypothetical protein RB2150_10474 [Rhodobacterales bacterium
           HTCC2150]
          Length = 246

 Score =  184 bits (468), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 139/242 (57%), Gaps = 4/242 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L RL+ D PL          DQ HYL  V+R K GD + LFNG+DGEW  K+ +  K   
Sbjct: 4   LSRLYTDHPLAQGHNIPLERDQAHYLFGVMRRKLGDEVELFNGRDGEWRGKVVHANKHRG 63

Query: 67  -FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +V +Q+R      D+  +F+PIK  R D++++K+ EMG   I PV+T YT +     +
Sbjct: 64  ILEVTHQTRPLQMPPDLWLMFAPIKKARTDFIVEKATEMGAARIVPVMTEYTNSDRVRQE 123

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-GSENSLE--KLH 182
           +++ + + AAEQC    +P +     L+ +L NW    Q++F DE   G    L+  KL 
Sbjct: 124 KMQIHAVEAAEQCGGTYVPEVAELQKLDRMLDNWPDGRQLLFCDEGLIGRPTGLDQSKLT 183

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           A+      AILIGPEGG+  +E+  L SL FVT  SLGPRILR+DTAAVAA+ L Q   G
Sbjct: 184 AVNKTGPWAILIGPEGGFSEKERNRLASLDFVTTQSLGPRILRADTAAVAALTLWQRELG 243

Query: 243 DW 244
           DW
Sbjct: 244 DW 245


>gi|296533751|ref|ZP_06896298.1| RsmE family RNA methyltransferase [Roseomonas cervicalis ATCC
           49957]
 gi|296265927|gb|EFH12005.1| RsmE family RNA methyltransferase [Roseomonas cervicalis ATCC
           49957]
          Length = 242

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 143/239 (59%), Gaps = 4/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           + RL V   L    +      Q HYL  V+R KEGD + LFNG+DGEWL++I+ + K  +
Sbjct: 3   IPRLHVAADLAEAAEIPGEPGQGHYLGQVMRRKEGDPVHLFNGRDGEWLARIAALRKDRV 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           +F+ E + R Q    D++ + +P+K + +D++++K+ E+G+ +IRPV T        N++
Sbjct: 63  QFRPESRLRPQQSGPDLRLLLAPVKRDAMDWIVEKATELGVRSIRPVFTARCVIGRVNLE 122

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+ T    AAEQC+ L +P I  P  L   L  WD    +V   +  G   SL  + A  
Sbjct: 123 RLSTIAREAAEQCERLDVPEIAAPLDLHAALDAWDGAPLLV--GDARGKAPSLNVVLA-G 179

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P + +L+GPEGG+  +E + +   PFV+P +LGPRILR++TAAVA +A++QA+ GDW
Sbjct: 180 KAPPLGLLVGPEGGFTDQELDAVRRRPFVSPAALGPRILRAETAAVAGLAVLQALAGDW 238


>gi|163758378|ref|ZP_02165466.1| hypothetical protein HPDFL43_02095 [Hoeflea phototrophica DFL-43]
 gi|162284667|gb|EDQ34950.1| hypothetical protein HPDFL43_02095 [Hoeflea phototrophica DFL-43]
          Length = 250

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 149/245 (60%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  L+RL++D PL  + +     +Q HYL  VLRM E   +L+FNG+DGE+LS +  
Sbjct: 7   MRANFKLQRLYLDAPLVPRQRAAMRKEQAHYLLTVLRMAEDQQVLVFNGRDGEFLSALKP 66

Query: 61  VGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K +   ++  Q+R Q     + ++F+P+K  RL+Y++QK+ EMG+  I P  T +TQ 
Sbjct: 67  LSKKAAELEIVEQTRPQPPLPRLDFLFAPLKVGRLEYLVQKATEMGVRQITPAFTDHTQL 126

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N  R+    + AAEQC  L +P +     L+ LL  WD   +I+F +E+    N  +
Sbjct: 127 HKVNAARLEANILEAAEQCGNLAIPQLQEAQKLDALLDGWDPARRIIFCNESQAGNNPTD 186

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+    ++A+L+GPEGG+   E+E L +LPF+T + LGPRILR+DTAAVAA+  VQ 
Sbjct: 187 ILSAVEER-DLALLVGPEGGFSDRERERLLALPFLTAIPLGPRILRADTAAVAALTAVQM 245

Query: 240 ICGDW 244
             GDW
Sbjct: 246 TIGDW 250


>gi|299134206|ref|ZP_07027399.1| protein of unknown function DUF558 [Afipia sp. 1NLS2]
 gi|298590953|gb|EFI51155.1| protein of unknown function DUF558 [Afipia sp. 1NLS2]
          Length = 255

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 140/237 (59%), Gaps = 1/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL    +     +Q HYL +VLR+  GD+IL+FNG DGEW ++I    +     
Sbjct: 10  RLFVDAPLDAGGRVALEREQGHYLGNVLRLGTGDSILVFNGHDGEWRAQIEGRKRPEHLT 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q+R Q    D+  +F+P+K  RLDYM+QK+VEMG   + P +T++TQ +  N +R+R
Sbjct: 70  LTEQTRPQETPCDLHLLFAPLKHARLDYMVQKAVEMGASLLAPTLTQFTQVSRVNTERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH-AIAHI 187
              I AAEQC IL LP I  P  L   L   D    ++F DE     + L  L       
Sbjct: 130 ANAIEAAEQCGILNLPGINEPQPLARRLSERDGQRLLIFCDEAAPQCDPLAALGMGAGKT 189

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +L+GPEGG+  EE+  L   P +  LSLGPRILR+DTAAVAA+ALVQA  GDW
Sbjct: 190 KGLDVLVGPEGGFSEEERALLLRQPRLMRLSLGPRILRADTAAVAALALVQAALGDW 246


>gi|298290358|ref|YP_003692297.1| hypothetical protein Snov_0345 [Starkeya novella DSM 506]
 gi|296926869|gb|ADH87678.1| protein of unknown function DUF558 [Starkeya novella DSM 506]
          Length = 260

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/233 (43%), Positives = 146/233 (62%), Gaps = 2/233 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIR 66
           +RL+VD  L   T  +   D+ HY+A V+R++ G  + LFNG+DGEW +     G+    
Sbjct: 18  QRLYVDDDLGEGTLVRLDRDRAHYVADVIRLEVGGALHLFNGRDGEWRAVREPAGRREAV 77

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            + E + R Q + +D+ Y+F+P+K  RLDYM+QK+VEMG G + PV+TR TQ +  N +R
Sbjct: 78  LRCEARLRRQAEPADLDYVFAPLKHARLDYMVQKAVEMGAGRLVPVMTRRTQASRVNTER 137

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC IL+LP +  P+ L   L +     ++VF DE     + L +L     
Sbjct: 138 MRANVIEAAEQCGILSLPAVLEPSALARWLADLAPERRLVFCDEAAPEADPLAELREAVA 197

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            P +A+LIGPEGG+  EE+  L + P    LSLGPRILR+DTAAVAA+A+V+A
Sbjct: 198 GP-LAVLIGPEGGFDEEERRLLKARPGTIVLSLGPRILRADTAAVAALAMVEA 249


>gi|316932695|ref|YP_004107677.1| hypothetical protein Rpdx1_1321 [Rhodopseudomonas palustris DX-1]
 gi|315600409|gb|ADU42944.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           DX-1]
          Length = 257

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 107/239 (44%), Positives = 146/239 (61%), Gaps = 3/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD  L    Q     DQ +YL +VLR+  G ++L FNG+DGEW + I+   +    +
Sbjct: 10  RLFVDATLAPGAQVPLERDQSNYLGNVLRLGAGADVLTFNGRDGEWRATIAGRKRPEALE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q+R Q +  DV Y+F+P+K  RLDYM QK+VEMG G +RPV+T++TQ    N DR+R
Sbjct: 70  VAEQTRPQDRLPDVAYVFAPLKHARLDYMAQKAVEMGAGRLRPVLTQHTQVHRLNTDRMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSL--EKLHAIA 185
              I AAEQC IL+L  +  P  L+ FL         +VF DE     + +        A
Sbjct: 130 ANVIEAAEQCGILSLAEVGEPIGLDRFLAGRASGERLLVFCDEDAEIADPVAALAAARPA 189

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               V +L+GPEGG+ +EE++ L   P +  L+LGPRI+R+DTAAVAA+ALVQA+ GDW
Sbjct: 190 ATKGVDLLVGPEGGFSAEERDVLLKQPNILRLALGPRIMRADTAAVAALALVQAVVGDW 248


>gi|295687718|ref|YP_003591411.1| hypothetical protein Cseg_0273 [Caulobacter segnis ATCC 21756]
 gi|295429621|gb|ADG08793.1| protein of unknown function DUF558 [Caulobacter segnis ATCC 21756]
          Length = 238

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 132/237 (55%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV   L        + DQ  YL  V+R+  GD +LLFNG+DGEW + I    K     
Sbjct: 3   RLFVPNDLSAGAGVVPTVDQSRYLTSVMRLSVGDEVLLFNGRDGEWRASIVEATKRGCLL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           K + Q+R      D+  I + +K  R++ +++K+ E+G   +R  ITR T      + R+
Sbjct: 63  KADVQTRPMDTGPDLDLIVAMVKRGRVETIVEKAAELGARRVRLTITRRTNVDFVKLGRL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               + AAEQ   L +P I  P  L+ +L  WD   ++VF DE   +  ++E L      
Sbjct: 123 DAIAMEAAEQTGRLDVPEIVDPEKLDKILDGWDPTRRLVFCDEGGDARPAIEALAGTGA- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+  EE+E L  L FVTP+SLGPRILR+DTAA++AM L QA  GDW
Sbjct: 182 -PAAILIGPEGGFAPEERERLRGLSFVTPVSLGPRILRADTAAISAMTLWQASAGDW 237


>gi|329888452|ref|ZP_08267050.1| RNA methyltransferase, RsmE family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328847008|gb|EGF96570.1| RNA methyltransferase, RsmE family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 239

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/219 (41%), Positives = 128/219 (58%), Gaps = 3/219 (1%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRFKVEYQSRSQTKQSDVQYI 85
           DQ  YL  V+R+K GD +L+FNG+DGEW   ++ V  K +  + E Q R Q    D++ I
Sbjct: 21  DQSRYLTQVMRLKAGDELLVFNGRDGEWRVSVAEVLKKGVILRAEEQMRPQVYGPDLELI 80

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
            + +K  R++ +++K+ E+G   +R  +T  T      +DR+      AAEQ   L +P 
Sbjct: 81  VAVVKKARVETIVEKAAELGAKRVRLALTHRTNADRLRLDRLDAIAEEAAEQTGRLDVPV 140

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEK 205
           +  P  L+ LL  W+   +++F DET G+  +     A       AILIGPEGG+  EE 
Sbjct: 141 VDDPVKLDALLDGWEAGRRLMFCDETGGAPAASALTQA--GDGKWAILIGPEGGFSPEEG 198

Query: 206 ETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           E L SLPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 199 ERLRSLPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 237


>gi|260431629|ref|ZP_05785600.1| surface protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415457|gb|EEX08716.1| surface protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 241

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL        + +Q HYL  V+R+  G  + LFNG+DGEWL++++  GK     
Sbjct: 6   RLYVDHPLGAGQSVPLTREQAHYLFGVMRLAVGGQVALFNGRDGEWLAEVAEAGKRGGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  SCLEQTRPLQLPPDLWLLFAPIKKARTDFIVEKAAEMGAAKIMPVQTAFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ LL NW    Q++F DE      S  +L A    
Sbjct: 126 QAHAVEAAEQCGGTFVPEVCDLQRLDKLLDNWPDGRQLMFCDEA--EAGSALRLAAQDKG 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E++ L  LPF   +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 184 RPWAILIGPEGGFSDAERQRLKDLPFTHVVSLGPRILRADTAAVAAMTLWQQALGDW 240


>gi|146276272|ref|YP_001166431.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554513|gb|ABP69126.1| protein of unknown function DUF558 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 257

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 142/250 (56%), Gaps = 14/250 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL      + + DQ HYL  V+R+  G  +LLFNG+DGEW ++++  GK     
Sbjct: 7   RLYVDQPLGPGQPVRLTQDQAHYLFGVMRLARGAAVLLFNGRDGEWRAEVTEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+    +  D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  TCAAQTAPLRRPPDLWLMFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS--LEKLHAIA 185
           + + + AAEQC    +P +     L+ LL  W  + +I++ DE      +  LE   AI 
Sbjct: 127 QAHAVEAAEQCGGTYVPEVAELAALDRLLSGWPADRRIMWCDENLLGARAGLLEGAGAIE 186

Query: 186 -----HIPNV------AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                  P+       AILIGPEGG+  +E+  L  +P V P+SLGPRILR+DTAAVAA+
Sbjct: 187 ARGFEEAPSQPSPGPWAILIGPEGGFSEDEQARLRRMPQVVPVSLGPRILRADTAAVAAL 246

Query: 235 ALVQAICGDW 244
            L Q++ GDW
Sbjct: 247 TLWQSVLGDW 256


>gi|83309343|ref|YP_419607.1| 16S ribosomal RNA methyltransferase RsmE [Magnetospirillum
           magneticum AMB-1]
 gi|82944184|dbj|BAE49048.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 252

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 148/237 (62%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFV+ PL        + DQ HYLA V+R   G+ +LLFNG+DGEWL++I+ + K+    
Sbjct: 11  RLFVEAPLSAGMAVALTRDQTHYLASVMRAAVGELVLLFNGRDGEWLARIAALAKAGAAL 70

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V E Q+R Q  + D+  + +P+K +R D +++K+ E+G+  + PV TR T     N DR+
Sbjct: 71  VPESQTRPQAPEPDLWLLAAPLKKDRTDLVVEKAAELGVSRLWPVFTRRTNAGRVNADRL 130

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
             + + AAEQC+ LT+P +  P  L+ +L  W     ++F DE  G     E L+ ++  
Sbjct: 131 HAHLVEAAEQCERLTVPDLAEPAALDKVLAGWPAERVLLFLDEGGGGVPLAEVLNGLSGQ 190

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             +A+L+GPEGG+  EE+  + S PF   + LGPRILR++TAA+AA+A+VQA+ GDW
Sbjct: 191 -KLALLVGPEGGFDGEERRLIASRPFARAVGLGPRILRAETAAIAALAVVQALNGDW 246


>gi|163732851|ref|ZP_02140296.1| hypothetical protein RLO149_13455 [Roseobacter litoralis Och 149]
 gi|161394211|gb|EDQ18535.1| hypothetical protein RLO149_13455 [Roseobacter litoralis Och 149]
          Length = 247

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 136/237 (57%), Gaps = 5/237 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+VD PL        S DQ HYL  V+R+  G ++L+F+G+ GEWL++++  GK     
Sbjct: 14  RLYVDHPLGEGQSVPVSRDQAHYLFGVMRLGVGAHVLVFDGQSGEWLAEVAQAGKRAGEL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q+R      D+  +F+PIK  R D++++K+VEMG   I PV T +T       DR+
Sbjct: 74  HLLRQTRPLLMPPDLWLLFAPIKKARTDFIVEKAVEMGAARIMPVQTEFTNAGRIQRDRL 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+++L  WD    I+F DE    E + E L  +   
Sbjct: 134 QAHAVEAAEQCGGTFVPKVDDLARLDWVLGGWDTTRSIMFCDE----ERAGESLTLLQKA 189

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E E L SL    P+SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 190 GPWAILIGPEGGFSPREHEKLGSLAHAHPVSLGPRILRADTAAVAALTVWQQALGDW 246


>gi|209966873|ref|YP_002299788.1| 16S ribosomal RNA methyltransferase RsmE [Rhodospirillum centenum
           SW]
 gi|209960339|gb|ACJ00976.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 260

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 136/237 (57%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RLFVD PL         G + HYL  VLRM+ G+ +L FNG+DGEWL++++ +GKS    
Sbjct: 8   RLFVDAPLSEGAAVPLEGGRAHYLRTVLRMQPGERVLAFNGRDGEWLAEVAQLGKSGGTL 67

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               + R QT +     +F+P+K  R D + +K+ E+G   + PV TR T     N++R+
Sbjct: 68  TALRRERDQTGEEGPWLLFAPLKGGRSDSVAEKATELGAAVLHPVFTRRTDVGRVNLERL 127

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               + AAEQC+ L++P +     L   L+ WD    +  A E+  +  ++  + A    
Sbjct: 128 AANAVEAAEQCERLSVPEVREACPLFKALEGWDPARVLFVAAESGQAMPAVSAVTAQRGR 187

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  A L+GPEGG+   E + L  LPFV P+ LGPR+LR+DTAA A +A+ QA+ GDW
Sbjct: 188 P-AAWLLGPEGGFDRAELDGLLHLPFVVPVGLGPRVLRADTAAFAVLAVWQALAGDW 243


>gi|91978577|ref|YP_571236.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisB5]
 gi|91685033|gb|ABE41335.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisB5]
          Length = 251

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 145/239 (60%), Gaps = 3/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD  L    +     DQ +YL +VLR+  G  +L FNG+DGEW + I+   +    +
Sbjct: 10  RLFVDAALAPGARVPLDRDQSNYLGNVLRLGAGAPVLTFNGRDGEWRAAIAGRKRPEELE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q+R Q +  D+ Y+F+P+K +RLDYM QK+VEMG G ++PV+TR+TQ    N DR+R
Sbjct: 70  VTDQTRPQDRLPDLTYVFAPLKHSRLDYMTQKAVEMGAGRLQPVLTRHTQVHRLNTDRMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
              I AAEQC IL++  +     LE +L    D    + F DE     + +  L      
Sbjct: 130 ANAIEAAEQCGILSVAAVEESIALERWLAARADGGRLLAFCDEDAEIADPVAALQGARAT 189

Query: 188 P--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               + +L+GPEGG+ +EE+E L   P +  L+LGPRI+R+DTAAVAA+ALVQA+ GDW
Sbjct: 190 AAQGIDLLVGPEGGFSNEERELLLRQPNILRLALGPRIMRADTAAVAALALVQAVIGDW 248


>gi|23016538|ref|ZP_00056293.1| COG1385: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 254

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 151/239 (63%), Gaps = 6/239 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL        + DQ HYLA V+R + G+ +LLFNG DGEW ++I+ + K+    
Sbjct: 11  RLFVDAPLSEGVAVALTRDQTHYLASVMRAELGEMVLLFNGTDGEWAARIAALPKAGAAL 70

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V E Q+R Q  + D+  + +P+K +R D +++K+ E+G+  + PV TR T     N DR+
Sbjct: 71  VPERQTRPQAPEPDLWLLAAPLKKDRTDLVVEKAAELGVSLLMPVFTRRTNAGRVNTDRL 130

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R + I AAEQC+ L++P +  P  L+ +L +W  +  ++F DE  GS   L   H +  +
Sbjct: 131 RAHLIEAAEQCERLSVPQLSEPCPLDKVLADWPTDRILLFLDE-GGSGIPLA--HVLNGM 187

Query: 188 PN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P   +A+L+GPEGG+ +EE+  + S  F   + LGPRILR++TAA+AA+A+VQA+ GDW
Sbjct: 188 PGEKLALLVGPEGGFDAEERRLIGSKSFARAVGLGPRILRAETAAIAALAVVQALTGDW 246


>gi|86748970|ref|YP_485466.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris HaA2]
 gi|86571998|gb|ABD06555.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 251

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 148/239 (61%), Gaps = 3/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF+D  L    +   + DQ +YL +VLR+  G  +L FNG+DGEW + ++   +    +
Sbjct: 10  RLFLDAALVAGARVPLNRDQSNYLGNVLRLSSGAPVLAFNGRDGEWRAVLAGRKRPEELE 69

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q+R Q +  D+ Y F+P+K  RLDYM QK+VEMG G ++PV+TR+TQ    N +R+R
Sbjct: 70  VAEQTRPQDRLPDLTYAFAPLKHARLDYMAQKAVEMGAGRLQPVLTRHTQVHRLNTERMR 129

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQ-IVFADETCGSENSLEKLHAI--A 185
              I AAEQC IL+L  +  P  LE  L+    + + +VF DE     + +  L     A
Sbjct: 130 ANVIEAAEQCGILSLAGVEEPVALERWLETRAESGRLLVFCDEDAEVADPVAALQGARPA 189

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               + +L+GPEGG+ ++E++ L   P +  L+LGPRI+R+DTAAVAA+ALVQA+ GDW
Sbjct: 190 AAQGIDLLVGPEGGFAADERDVLLRQPNILRLALGPRIMRADTAAVAALALVQAVAGDW 248


>gi|254463111|ref|ZP_05076527.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679700|gb|EDZ44187.1| conserved hypothetical protein TIGR00046 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 240

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 135/238 (56%), Gaps = 6/238 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR-F 67
           RLFVD PL        S  Q HYL  V+R+  G  + LFNGKDGEW  +I   GK     
Sbjct: 6   RLFVDQPLAEGNCVSVSQAQAHYLFGVMRLAVGGAVSLFNGKDGEWRCEILEAGKRKGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q++      D+   F+PIK  R D++++K+ EMG   I PV T +T +     +R+
Sbjct: 66  RCTVQTKPLQMPPDLWLCFAPIKKTRTDFIVEKATEMGASKICPVQTEFTNSERIKQERL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +   + L  +L +W    QI+F DET  G  +SL    A A 
Sbjct: 126 QAHAVEAAEQCGGTYVPEVIALSKLSTMLDHWPEERQIMFCDETELGVASSL----ASAS 181

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E++ LHS+P    +SLGPRILR+DTAAVAAM + QA  GDW
Sbjct: 182 RGPWAILIGPEGGFSPAERKRLHSMPEAHVVSLGPRILRADTAAVAAMTIWQAALGDW 239


>gi|297183994|gb|ADI20114.1| uncharacterized protein conserved in bacteria [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 243

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 142/245 (57%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I S + RLFVD PL          DQ +YL +V+R+  GD I +FNGKDGEW + + +
Sbjct: 1   MNIRSKI-RLFVDTPLGEGQSILLDRDQANYLFNVMRLNIGDYISVFNGKDGEWQADVLH 59

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K     V +YQS  Q    D+  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGILVAKYQSMQQLNPPDLWLLFAPIKKTRTDFIVEKATEMGVSRIFPVNTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R+++++I AAEQC    +P +   + L  +LK+W  +  ++F DE    E    
Sbjct: 120 DRIKQSRLQSHSIEAAEQCGGTYVPPVDELSKLTSILKDWPKDRCLIFCDENKVGEAV-- 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           K    +     AILIGPEGG+   E + L SL FVT +SLGPRILR+DTA VAA+A+ Q 
Sbjct: 178 KTFKSSVCDKWAILIGPEGGFSKNEIKYLKSLEFVTSISLGPRILRADTAVVAALAIWQK 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 EIGDW 242


>gi|16127645|ref|NP_422209.1| hypothetical protein CC_3415 [Caulobacter crescentus CB15]
 gi|221236464|ref|YP_002518901.1| 16S ribosomal RNA methyltransferase RsmE [Caulobacter crescentus
           NA1000]
 gi|13425129|gb|AAK25377.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965637|gb|ACL96993.1| surface protein [Caulobacter crescentus NA1000]
          Length = 238

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSIRF 67
           RLFV   L        + DQ  YL  V+R+  G  +LLFNG+DGEW +  +    +    
Sbjct: 3   RLFVPNDLSAGAGVVPTVDQSRYLTSVMRLSVGAELLLFNGRDGEWRATLVEATKRGCLL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           K E Q+R  T   D+  I + +K  R++ +++K+ E+G   +R  ITR T      + R+
Sbjct: 63  KAEEQTRPMTLGPDLDLIVAMVKRGRVETIVEKAAELGARRVRLTITRRTNVDFVKLGRL 122

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               + AAEQ   L +P +  P  L+ +L  WD   ++VF DE   +   +E L      
Sbjct: 123 DAIAMEAAEQTGRLDVPEVADPEKLDKILDAWDPARRLVFCDEGGDARPMIEALSGTTG- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+  EE+E L  L FVTP+SLGPRILR+DTAA++AM L QA  GDW
Sbjct: 182 -PAAILIGPEGGFAPEERERLRGLAFVTPVSLGPRILRADTAAISAMTLWQAAAGDW 237


>gi|83950615|ref|ZP_00959348.1| hypothetical protein ISM_05935 [Roseovarius nubinhibens ISM]
 gi|83838514|gb|EAP77810.1| hypothetical protein ISM_05935 [Roseovarius nubinhibens ISM]
          Length = 234

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 131/222 (59%), Gaps = 4/222 (1%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           DQ +YL +V+R+ +G ++ LFNG+DG W ++++  GK     +V  Q+  Q    D+  +
Sbjct: 4   DQANYLFNVMRLDQGASVTLFNGRDGAWRAEVAERGKRGGALQVAEQTAPQRNPPDLWLL 63

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + I AAEQC    +P 
Sbjct: 64  FAPIKKARTDFIVEKAAEMGASRILPVQTEFTNSERIRQDRLQAHAIEAAEQCGGTFVPE 123

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENS-LEKLHAIAHIPNV--AILIGPEGGYHS 202
           +     L+ LL +W    Q++F DE      S L    A +       AILIGPEGG+  
Sbjct: 124 VADLARLDRLLSDWPEERQLMFCDEALFDRPSPLTNGDATSSGTGTPWAILIGPEGGFSD 183

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            E+  LH+LPF  P+SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 184 AERSRLHALPFAHPVSLGPRILRADTAAVAAMTLWQDRLGDW 225


>gi|114570791|ref|YP_757471.1| 16S ribosomal RNA methyltransferase RsmE [Maricaulis maris MCS10]
 gi|114341253|gb|ABI66533.1| protein of unknown function DUF558 [Maricaulis maris MCS10]
          Length = 254

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 139/248 (56%), Gaps = 12/248 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RLF+D PL        + +  HYL +V+R  EGD + +FNG+DGEW + I++   K    
Sbjct: 6   RLFIDAPLSASAAIPLAREDAHYLINVMRRGEGDVVRVFNGRDGEWSAVIAHASRKGAGL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            V  Q+R Q    D+  +F+P++ ++ + +++K+ E+G   I PV+T  TQ+     +R+
Sbjct: 66  TVADQTRPQQGVPDLWLMFAPVRRSKTELIVEKATELGAAVIAPVVTERTQSDRIKFERL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-----------GSEN 176
           +  T  AAEQ + L LP +     L  +L NW  +  ++F DE+            G   
Sbjct: 126 QAITKEAAEQTERLDLPELRTSEKLAAVLDNWPDDRLLIFCDESGDEADAAWGGARGRGQ 185

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +    A A     AILIGPEGG+   E++ L SL  V P++LGPRILR++TAA+AA+ +
Sbjct: 186 PMAAALAGAGDRPAAILIGPEGGFSPAERDRLRSLQHVVPVTLGPRILRAETAAIAALTI 245

Query: 237 VQAICGDW 244
            Q+ CGDW
Sbjct: 246 WQSTCGDW 253


>gi|323137857|ref|ZP_08072932.1| protein of unknown function DUF558 [Methylocystis sp. ATCC 49242]
 gi|322396860|gb|EFX99386.1| protein of unknown function DUF558 [Methylocystis sp. ATCC 49242]
          Length = 246

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 145/238 (60%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIR 66
           +RLFV+  L          +  +YL +VLR++EGD I+LFNG+DGE+ +++  V + S R
Sbjct: 9   QRLFVESALAPGADVLPPAEALNYLLNVLRLREGDPIVLFNGRDGEFRAELREVTRRSAR 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V  Q R QT ++D+ Y F+P+K  RLDYM QK+ EMG G + PV+TR TQ    N  R
Sbjct: 69  LAVGAQLRPQTPRADLDYCFAPLKQARLDYMAQKATEMGAGRLLPVVTRRTQVRRVNTSR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   + AAEQC +L +P +     L   L  +     +VF DE     N +  L A   
Sbjct: 129 LRANAVEAAEQCGVLAVPEVGEAADLPEFLAGFPAGRLLVFCDEDAPIANPVAAL-AGRE 187

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              +++L+GPEGG+   E+E++  LP V  LSLGPR+LR+DTAAVAA+A+VQA  GDW
Sbjct: 188 GEGISLLVGPEGGFDDVERESIARLPNVVRLSLGPRVLRADTAAVAALAVVQATIGDW 245


>gi|260427823|ref|ZP_05781802.1| surface protein [Citreicella sp. SE45]
 gi|260422315|gb|EEX15566.1| surface protein [Citreicella sp. SE45]
          Length = 269

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 141/245 (57%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           +++ +   RLFVD PL        + +Q HYL  V+R+  G  ILLFNG+DGEWL +++ 
Sbjct: 27  VRLMTAKVRLFVDHPLGAGQPVPLTREQAHYLFSVMRLGAGAPILLFNGRDGEWLCEVTE 86

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK     V + Q+R Q    D+  +F+PIK  R D++++K+VE+G+  + PV T++T +
Sbjct: 87  AGKRGGEAVCDTQTRPQQMPPDLWLLFAPIKKARTDFIVEKAVELGVRRLLPVQTQFTNS 146

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++ + + AAEQC  L +P +     L+ LL +W     ++F DE   +E    
Sbjct: 147 ERIRQDRLQAHAVEAAEQCGALFVPEVAELARLDRLLADWPAGRALLFCDE---AEAGSR 203

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                A     A+LIGPEGG+   E+  L ++     ++LGPRILR+DTA V+A+ L Q 
Sbjct: 204 AAALDAAPAPAAVLIGPEGGFADAERARLGAMDETRVIALGPRILRADTATVSAITLWQV 263

Query: 240 ICGDW 244
            CGDW
Sbjct: 264 ACGDW 268


>gi|254421059|ref|ZP_05034783.1| conserved hypothetical protein TIGR00046, putative [Brevundimonas
           sp. BAL3]
 gi|196187236|gb|EDX82212.1| conserved hypothetical protein TIGR00046, putative [Brevundimonas
           sp. BAL3]
          Length = 298

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 143/287 (49%), Gaps = 46/287 (16%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
            + + RL V  PL        + DQ  YL  V+R+K GD +L+FNG+DGEW   ++ V  
Sbjct: 10  KADMIRLHVPSPLAAAAAVAPTLDQSRYLTQVMRLKVGDELLVFNGRDGEWRCTVAEVLK 69

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           K +  + E Q+R QT   D++ I + +K  R++ +++K+ E+G   +R V+T+ T     
Sbjct: 70  KGVILRAEEQARPQTYGPDLELIVAVVKKARVETIVEKAAELGARRVRLVLTKRTNADRI 129

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE------- 175
            +DR+      AAEQ   L +P +  P  L+ LL  W+   +++F DET G+        
Sbjct: 130 RLDRLDAIAEEAAEQTGRLDVPPVDDPVKLDALLDEWEAGRRLMFCDETGGAPAMRALAP 189

Query: 176 ------------------NSLEKLHAIAHI--------------------PNVAILIGPE 197
                                E+  A+                       P  +ILIGPE
Sbjct: 190 YSPSPLRGGALARSDDGVGRAEQPDALPGPAHPASAAPSPPSPDGEGEGQPKWSILIGPE 249

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GG+  EE E L SLPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 250 GGFSPEEGERLRSLPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 296


>gi|261313181|ref|ZP_05952378.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           pinnipedialis M163/99/10]
 gi|261302207|gb|EEY05704.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella
           pinnipedialis M163/99/10]
          Length = 204

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 125/204 (61%), Gaps = 2/204 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW + +   G K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLH 209
             P+  +LIGPEGG+  EE++ LH
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLH 203


>gi|254464533|ref|ZP_05077944.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           Y4I]
 gi|206685441|gb|EDZ45923.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           Y4I]
          Length = 221

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/219 (41%), Positives = 127/219 (57%), Gaps = 2/219 (0%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV-EYQSRSQTKQSDVQYI 85
           DQ HYL  V+R+  G  + LFNGKDGEWL++++  GK     V + Q++      D+  +
Sbjct: 4   DQAHYLFGVMRLAAGAAVALFNGKDGEWLAEVAEAGKRGGTLVCQEQTKPLQLPPDLWLL 63

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + + AAEQC    +P 
Sbjct: 64  FAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSERIRQDRLQAHAVEAAEQCGGTYVPE 123

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEK 205
           +     L  LL  W    Q++F DE     N+L+           AILIGPEGG+   E+
Sbjct: 124 VADSQKLSRLLDQWPRERQLMFCDE-AEVGNALQLAAETQKDVPWAILIGPEGGFSEAER 182

Query: 206 ETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           + LH+LP    +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 183 KRLHALPQSHVVSLGPRILRADTAAVAAMTLWQQALGDW 221


>gi|77464587|ref|YP_354091.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           2.4.1]
 gi|77389005|gb|ABA80190.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 257

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 142/252 (56%), Gaps = 18/252 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGPGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             + Q+       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCKDQTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+  G+   L  L A   
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGL--LEAAGG 184

Query: 187 I-----------PNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                       P+    AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVA
Sbjct: 185 FEARGFEEGPKRPSPGPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVA 244

Query: 233 AMALVQAICGDW 244
           A+ L Q++ GDW
Sbjct: 245 ALTLWQSVLGDW 256


>gi|56698449|ref|YP_168823.1| 16S ribosomal RNA methyltransferase RsmE [Ruegeria pomeroyi DSS-3]
 gi|56680186|gb|AAV96852.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 251

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 136/246 (55%), Gaps = 10/246 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+  L      + S DQ HYL  V+R+  GD + LFNG+DGEW +++   GK     
Sbjct: 6   RLYVEQALGQGQPVQVSRDQAHYLFGVMRLGVGDWVALFNGRDGEWQARVGEAGKRGGEL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             E QS       D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  LCESQSAPLRMPPDLWLLFAPIKKARTDFIVEKAAEMGAARIVPVQTEFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKL----- 181
           + + + AAEQC    +P +     L  LL  W    Q++F DET  G  ++L  L     
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLGPLLDRWPAERQLMFCDETLAGRSSALSGLLAGQG 185

Query: 182 -HAIAHIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +A    P+   AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAA+ L Q
Sbjct: 186 ENARTGGPSGPWAILIGPEGGFSERERARLAALPNAHAVSLGPRILRADTAAVAALTLWQ 245

Query: 239 AICGDW 244
              GDW
Sbjct: 246 QALGDW 251


>gi|254293386|ref|YP_003059409.1| 16S ribosomal RNA methyltransferase RsmE [Hirschia baltica ATCC
           49814]
 gi|254041917|gb|ACT58712.1| protein of unknown function DUF558 [Hirschia baltica ATCC 49814]
          Length = 256

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 146/252 (57%), Gaps = 12/252 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           S + RLFV   L +      + +Q +YL  VLR+ + D + +FNG+DGEW + ++ V +S
Sbjct: 2   STIPRLFVKADLTLGAPIALTSEQANYLFRVLRLSKNDAVRVFNGRDGEWRASVTEVMRS 61

Query: 65  IRFK-VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
             F  +E     Q    D+Q +F+P+K    D++++K+ E+G+  I+PVIT+ TQ +   
Sbjct: 62  AGFLCLEELIVPQAVIGDLQLLFAPLKKTCTDFVVEKATELGVTMIQPVITKRTQTSTVR 121

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG--SEN----- 176
           + R+      AAEQ + L +P +  P  L   L  WD N ++VF DE     +EN     
Sbjct: 122 VSRLEKIVEEAAEQTERLDIPLVQEPIQLLEALGKWDKNRRLVFCDEAGDDPTENWGGDV 181

Query: 177 --SLEKLHAIAHIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
             +   + AI+ + +   AILIGPEGG+  EE++ L    +V P++LGPRILR++TAAV+
Sbjct: 182 GRARPMMEAISELKDGLAAILIGPEGGFSPEERKYLRQQDYVIPVTLGPRILRAETAAVS 241

Query: 233 AMALVQAICGDW 244
           A+ L QA  GDW
Sbjct: 242 ALTLWQAARGDW 253


>gi|163745648|ref|ZP_02153008.1| hypothetical protein OIHEL45_08655 [Oceanibulbus indolifex HEL-45]
 gi|161382466|gb|EDQ06875.1| hypothetical protein OIHEL45_08655 [Oceanibulbus indolifex HEL-45]
          Length = 219

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 127/220 (57%), Gaps = 6/220 (2%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--SIRFKVEYQSRSQTKQSDVQY 84
           +Q HYL  V+R   G  +LLFNG+DGEWL++++  GK   +   VE Q+R      D+  
Sbjct: 4   EQAHYLFGVMRQALGAGVLLFNGRDGEWLAEVTEAGKRGGVLTCVE-QTRPLQMPPDLWL 62

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLP 144
           +F+PIK  R D++++K+ EMG   I PV+T +T        R++ + + AAEQC    +P
Sbjct: 63  LFAPIKKTRTDFIVEKAAEMGASRIVPVMTEFTNAGRVQQTRLQAHAVEAAEQCGGTYVP 122

Query: 145 FIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEE 204
            +     L  LL  WD + QI+F DE    E+    L A A  P  AILIGPEGG+   E
Sbjct: 123 EVAEAEKLGRLLDRWDTSRQIMFCDEALAGESG--ALPADAQGP-WAILIGPEGGFSEAE 179

Query: 205 KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +  LH       ++LGPRILR+DTAAVAAM + Q   GDW
Sbjct: 180 RMRLHGFDHAHAVTLGPRILRADTAAVAAMTMWQQALGDW 219


>gi|126463427|ref|YP_001044541.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105091|gb|ABN77769.1| protein of unknown function DUF558 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 257

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 141/252 (55%), Gaps = 18/252 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGRGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAETGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCTDQTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+  G+   L  L A   
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGL--LEAAGG 184

Query: 187 I-----------PNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                       P+    AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVA
Sbjct: 185 FEARGFEEGPKRPSPRPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVA 244

Query: 233 AMALVQAICGDW 244
           A+ L Q++ GDW
Sbjct: 245 ALTLWQSVLGDW 256


>gi|332559480|ref|ZP_08413802.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           WS8N]
 gi|332277192|gb|EGJ22507.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           WS8N]
          Length = 257

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 142/252 (56%), Gaps = 18/252 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGRGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
              +++       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCTHRTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+  G+   L  L A   
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGL--LEAAGG 184

Query: 187 I-----------PNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                       P+    AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVA
Sbjct: 185 FEARGFEEGPKRPSPGPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVA 244

Query: 233 AMALVQAICGDW 244
           A+ L Q++ GDW
Sbjct: 245 ALTLWQSVLGDW 256


>gi|126740599|ref|ZP_01756286.1| hypothetical protein RSK20926_04507 [Roseobacter sp. SK209-2-6]
 gi|126718400|gb|EBA15115.1| hypothetical protein RSK20926_04507 [Roseobacter sp. SK209-2-6]
          Length = 261

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 136/253 (53%), Gaps = 18/253 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL +        DQ HYL  V+R   G ++ LFNG+DGEW ++IS  GK     
Sbjct: 10  RLYVEHPLGVGQSIPLEKDQAHYLFGVMRQALGGHVALFNGRDGEWQAEISEAGKRGGTL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T YT +     DR+
Sbjct: 70  TCIEQSKPLQMPPDLWLIFAPIKKARTDFIVEKAAEMGAAKILPVGTEYTNSERIRQDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-----------TCGSEN 176
           + + + AAEQC    +P +     L  LL +W    Q++F DE           T G   
Sbjct: 130 QAHAVEAAEQCGGTYVPEVCDLQKLSRLLDDWPAKRQLMFCDEAEVGQQRFLDLTQGGGT 189

Query: 177 SLEKLHAIAHIPNV-----AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             ++  A   +P       AILIGPEGG+  +E++ LH++     +SLGPRILR+DTAAV
Sbjct: 190 GADR-SASEPVPGAVSQPWAILIGPEGGFSDKERKRLHAMEQAHVVSLGPRILRADTAAV 248

Query: 232 AAMALVQAICGDW 244
           AAM + Q   GDW
Sbjct: 249 AAMTVWQQTLGDW 261


>gi|254475767|ref|ZP_05089153.1| conserved hypothetical protein TIGR00046 [Ruegeria sp. R11]
 gi|214030010|gb|EEB70845.1| conserved hypothetical protein TIGR00046 [Ruegeria sp. R11]
          Length = 242

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 134/239 (56%), Gaps = 6/239 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+ PL          DQ HYL  V+R   G  + LFNG+DGEW ++I+  GK     
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQAVGGQVSLFNGRDGEWRAEIAEAGKRNGLL 65

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V + QSR      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  VCQEQSRPLMLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTDFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKL-HAIA 185
           + + + AAEQC    +P +     L  +L  W    Q++F DE   G+  +L    HA A
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLSRVLDQWPQERQLMFCDEAEVGTALTLAAADHAKA 185

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AI+IGPEGG+   E++ LH LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 186 ---PWAIVIGPEGGFSEAERKRLHGLPQSHVVSLGPRILRADTAAVAALTIWQQAYGDW 241


>gi|163738856|ref|ZP_02146269.1| hypothetical protein RGBS107_08461 [Phaeobacter gallaeciensis
           BS107]
 gi|161387661|gb|EDQ12017.1| hypothetical protein RGBS107_08461 [Phaeobacter gallaeciensis
           BS107]
          Length = 242

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL          DQ HYL  V+R   G  +LLFNG+DGEW ++++   K S   
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQTVGAQLLLFNGEDGEWRAEVAEASKRSGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             + Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ICQEQTRPLVLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L  LL +W    Q++F DE   GS  +L    A A 
Sbjct: 126 QAHAVEAAEQCGGTYVPEVADLQKLSRLLDHWPEERQLMFCDEAEVGSALALASETA-AQ 184

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P  AI+IGPEGG+   E++ LH+LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 185 AP-WAIVIGPEGGFSEAERKRLHALPQSHVVSLGPRILRADTAAVAALTVWQQRYGDW 241


>gi|163795742|ref|ZP_02189707.1| hypothetical protein BAL199_07568 [alpha proteobacterium BAL199]
 gi|159179038|gb|EDP63573.1| hypothetical protein BAL199_07568 [alpha proteobacterium BAL199]
          Length = 253

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 140/241 (58%), Gaps = 7/241 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           RL+V  PL           Q HYL  VLR+  G+ + LFNG+DGEWL++I  +GK     
Sbjct: 8   RLYVTAPLAEGAVIGLESAQAHYLRSVLRLGPGEAVALFNGRDGEWLARIDGIGKGWASL 67

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            V  Q+  Q  + D+   F+PIK  R+D+  QK+ E+G   + PV+TR+T     N DR+
Sbjct: 68  VVANQTHPQCPEPDLWLAFAPIKRARIDFTAQKATELGASLLWPVMTRHTMVDRVNTDRL 127

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ D LT+P +  PT+L+ L+  W  +  ++  DE+       E L A    
Sbjct: 128 TANAIEAAEQSDRLTVPEVREPTSLDKLIAEWPEDRALLLCDESGTGLGIAEALAAAG-- 185

Query: 188 PNV----AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           P+V      +IGPEGG+  EE + L  LPFVT + LGPR+LR+DTAA+AA+A+ QA+ GD
Sbjct: 186 PSVRRRAGFVIGPEGGFAQEELDRLRKLPFVTAVGLGPRLLRADTAALAALAVWQAVAGD 245

Query: 244 W 244
           W
Sbjct: 246 W 246


>gi|294675943|ref|YP_003576558.1| hypothetical protein RCAP_rcc00386 [Rhodobacter capsulatus SB 1003]
 gi|294474763|gb|ADE84151.1| protein of unknown function DUF558, methyltransferase predicted
           [Rhodobacter capsulatus SB 1003]
          Length = 241

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL V  PL        S DQ +YL  V+R+  GD + LFNG+DGEW +++    K     
Sbjct: 7   RLCVTHPLGPGQAVPLSPDQANYLFAVMRLGPGDRVALFNGRDGEWTAEVVEGSKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
                +  Q    D+  +F+PIK  R D++++K+ E+G   I PV T +T       DR+
Sbjct: 67  ACLGLAAPQLNPPDLWLLFAPIKKERTDFIVEKAAELGCAKILPVQTEFTNAARIKQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ +LK+W+   +I++ DE+       + L  +A  
Sbjct: 127 QAHALEAAEQCLGTYVPEVSDLQPLQKVLKSWNPARRILWGDESL--VGPAQTLAGLAPG 184

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AIL+GPEGG+   E+  L +LPFVTP+SLGPRILR+DTAA AA+ L Q+  GDW
Sbjct: 185 P-WAILVGPEGGFSETERHQLRALPFVTPVSLGPRILRADTAACAAITLWQSSLGDW 240


>gi|163741896|ref|ZP_02149286.1| hypothetical protein RG210_04985 [Phaeobacter gallaeciensis 2.10]
 gi|161385069|gb|EDQ09448.1| hypothetical protein RG210_04985 [Phaeobacter gallaeciensis 2.10]
          Length = 242

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL          DQ HYL  V+R   G  +LLFNG+DGEW ++++   K S   
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQTVGAQLLLFNGEDGEWRAEVAEASKRSGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             + Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ICQEQTRPLVLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L  +L +W    Q++F DE   GS  +L +  A+  
Sbjct: 126 QAHAVEAAEQCGGTYVPEVVDLQKLSRVLDHWPEERQLMFCDEAEVGSALALARDTAV-Q 184

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P  AI+IGPEGG+   E++ LH+LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 185 AP-WAIVIGPEGGFSEAERKRLHALPQSHVVSLGPRILRADTAAVAALTVWQQRYGDW 241


>gi|304393152|ref|ZP_07375080.1| surface protein [Ahrensia sp. R2A130]
 gi|303294159|gb|EFL88531.1| surface protein [Ahrensia sp. R2A130]
          Length = 255

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +I    +R F    L      +    + +++ +VLRM +GD +LLFNG+DGEW + +   
Sbjct: 13  RIDFTTRRFFTPEALGAGGHIEPGRAEANHVLNVLRMGDGDPLLLFNGRDGEWRATVQRE 72

Query: 62  G-KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           G K   F +  Q+R Q +   ++ +F+P+K  RL+YMIQK+VEMG G ++PV+T YTQ  
Sbjct: 73  GRKKATFVLGEQTRVQPELPTLRLLFAPLKQARLEYMIQKAVEMGAGHLQPVMTAYTQMR 132

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLE 179
             N++R+ T+ + AA+QC +L LP +Y   +++  + +      ++F DE   G+  +L+
Sbjct: 133 KVNIERMETHVVEAAQQCGVLALPQVYDVLSMQDAVADCG---TVIFCDEMEAGTGGALD 189

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +     +A+LIGPEGG+  EE+E LH+   V  + LGPRILR+DTAAVAA+ALVQA
Sbjct: 190 ILRDLTITAPLAVLIGPEGGFSPEEREWLHAQSHVHAIPLGPRILRADTAAVAALALVQA 249

Query: 240 ICGDW 244
             GDW
Sbjct: 250 ARGDW 254


>gi|83854893|ref|ZP_00948423.1| hypothetical protein NAS141_09196 [Sulfitobacter sp. NAS-14.1]
 gi|83842736|gb|EAP81903.1| hypothetical protein NAS141_09196 [Sulfitobacter sp. NAS-14.1]
          Length = 240

 Score =  168 bits (426), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL           Q HYL  V+R   G ++LLFNG DGEW ++++  GK     
Sbjct: 6   RLYVDHPLGQGQSVPLDKAQAHYLFGVMRQSVGASVLLFNGIDGEWRAEVAEAGKRGGVL 65

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V   Q++      D+  IF+PIK  R D++++K+ EMG   I PV + +T       DR+
Sbjct: 66  VCAEQTKPLQMPPDLWLIFAPIKKARTDFIVEKAAEMGARRIVPVQSEFTNAGRVQRDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ L+  W+    ++F DE    E   E+  A A  
Sbjct: 126 QAHAVEAAEQCGGTFVPEVADMVRLDRLIDRWEPERSLMFCDEALAGE---EEGLASARP 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+  L  L +  P++LGPRILR+DTAAVAAM L Q   GDW
Sbjct: 183 GPWAILIGPEGGFSDSERVRLRGLDWSRPVALGPRILRADTAAVAAMTLWQKTLGDW 239


>gi|84499775|ref|ZP_00998063.1| hypothetical protein OB2597_07590 [Oceanicola batsensis HTCC2597]
 gi|84392919|gb|EAQ05130.1| hypothetical protein OB2597_07590 [Oceanicola batsensis HTCC2597]
          Length = 241

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 128/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+VD  L        + DQ HYL  V+RM  GD + LFNG+ GEW +++   GK     
Sbjct: 7   RLYVDHALGEGQTVPLARDQAHYLFGVMRMGVGDAVALFNGRAGEWRAEVVEAGKRAGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   QS  Q    D+   F+PIK  R D++++K+ EMG   I PV T +T +    +DR+
Sbjct: 67  ECVGQSAPQMDPPDLWLAFAPIKKARTDFIVEKATEMGARRILPVQTDFTNSERVRIDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +  P  L  LL  W    Q++F DE      +     + A  
Sbjct: 127 QAHCVEAAEQCGGTFVPEVAEPVKLGTLLSGWPEGRQLMFCDEALAGGPAALPTRSDAPW 186

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+  L  +    P++LGPR+LR+DTAAVAA+ L Q   GDW
Sbjct: 187 ---AILIGPEGGFSEAERARLRGMDQAHPVALGPRVLRADTAAVAALTLWQDRLGDW 240


>gi|319403717|emb|CBI77302.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 195

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 109/173 (63%), Gaps = 1/173 (0%)

Query: 72  QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYT 131
           Q R Q   SD+ Y F+P+K  RLDY+IQK+VEMG+  + PVIT +TQ T  NM R+    
Sbjct: 8   QERLQPIHSDLFYCFAPLKHMRLDYVIQKAVEMGVSVLYPVITHHTQVTRINMARIEANI 67

Query: 132 ISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA 191
           I A+EQC IL+LP   P  +LE  L+NWD    + F DE   S N +  L      P + 
Sbjct: 68  IEASEQCGILSLPKCAPAVSLETFLENWDKAHALFFCDELNESYNPIPLLRKHGTKP-LG 126

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DTAAVAA+ LV A  GDW
Sbjct: 127 VLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADTAAVAALTLVNATMGDW 179


>gi|84515820|ref|ZP_01003181.1| hypothetical protein SKA53_14261 [Loktanella vestfoldensis SKA53]
 gi|84510262|gb|EAQ06718.1| hypothetical protein SKA53_14261 [Loktanella vestfoldensis SKA53]
          Length = 244

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 136/242 (56%), Gaps = 14/242 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           RL+VD PL +      + DQ HYL  V+R+  GD + L N +DGEW + +   G K    
Sbjct: 10  RLYVDHPLGVGQSVPLNRDQAHYLFGVMRLGAGDVLSLINSRDGEWDAVVEKAGNKGGVL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH-YNMDR 126
             + Q+R      D+  +F+PI+  R  ++++K+VE+G   I PV T +TQ  +    D+
Sbjct: 70  ACQAQTRPLQTPPDLWLVFAPIRKERTAFIVEKAVELGAARIIPVQTAFTQAANRIRQDK 129

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++ + + A+EQC    +P +     L+ LL +W  + Q++F DE          + A   
Sbjct: 130 LQAHAVEASEQCGGTFVPPVDDLAKLDRLLADWPKDRQLMFCDEAA--------IGAPVR 181

Query: 187 IPNV----AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           +P +    AILIGPEGG+   E++ L +LPF   +SLGPRILR+DTAAVAA+ L Q   G
Sbjct: 182 LPAIPGPWAILIGPEGGFSPAERDKLRALPFAHAVSLGPRILRADTAAVAALTLWQQALG 241

Query: 243 DW 244
           DW
Sbjct: 242 DW 243


>gi|99078057|ref|YP_611315.1| 16S ribosomal RNA methyltransferase RsmE [Ruegeria sp. TM1040]
 gi|99035195|gb|ABF62053.1| protein of unknown function DUF558 [Ruegeria sp. TM1040]
          Length = 246

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 132/244 (54%), Gaps = 11/244 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL          DQ HYL  V+R+     + LFNG+DGEW ++++  GK     
Sbjct: 6   RLYVDHPLGAGQTVPLDRDQAHYLFGVMRLSVAARVALFNGRDGEWQAEVAEAGKRGGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ACLEQSKPLQLPPDLWLIFAPIKKARTDFIVEKAAEMGAARILPVATEFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL +W    Q++F DE   +E        +A +
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLPSLLDHWPAERQLMFCDE---AEIGQRLFLDVAQV 182

Query: 188 PNV-------AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                     AILIGPEGG+   E++ LH++P    +SLGPRILR+DTAAVAA+ L Q  
Sbjct: 183 EGSAGAAGPWAILIGPEGGFSDAERKRLHAMPQAHVVSLGPRILRADTAAVAALTLWQQR 242

Query: 241 CGDW 244
            GDW
Sbjct: 243 LGDW 246


>gi|319406725|emb|CBI80358.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 194

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 108/173 (62%), Gaps = 1/173 (0%)

Query: 72  QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYT 131
           Q R Q   SD+ Y F+P+K  RLDY+IQK+VEMG+  + PVIT +TQ T  NM R+    
Sbjct: 20  QERLQPIHSDLFYCFAPLKHMRLDYVIQKAVEMGVSVLYPVITHHTQVTRINMARIEANI 79

Query: 132 ISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA 191
           I A+EQC IL+LP   P   LE  L+NWD    + F DE   S N +  L      P + 
Sbjct: 80  IEASEQCGILSLPKCAPVVALETFLENWDKTHALFFCDELNESYNPIPLLRKHGTKP-LG 138

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DTAAVAA+ LV A  GDW
Sbjct: 139 VLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADTAAVAALTLVNATMGDW 191


>gi|103487756|ref|YP_617317.1| 16S ribosomal RNA methyltransferase RsmE [Sphingopyxis alaskensis
           RB2256]
 gi|98977833|gb|ABF53984.1| protein of unknown function DUF558 [Sphingopyxis alaskensis RB2256]
          Length = 249

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 131/237 (55%), Gaps = 6/237 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLF+D PL   +     G   HYL  V+R+K GD +LLF+ + GEWL+ ++   K S+  
Sbjct: 14  RLFIDQPLGAGSAPVIDGAAAHYLLGVMRLKAGDPVLLFDNRSGEWLAVVADAAKRSVTL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           ++E   R      D+   F+P+K  RLD++I+K+ E+G+  ++PV+T  T       +R+
Sbjct: 74  RIERHMRDIEAVPDLWLCFAPVKKARLDWIIEKATELGVRRLQPVMTERTIVERVRRERL 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQC    LP +  P  L  LLK W     ++FADE  G       +  +A  
Sbjct: 134 EAQIIEACEQCGRTALPALAEPVKLPQLLKAWPAERALLFADEAGGV-----PMARLAAP 188

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AIL GPEGG+   E+  L + P V  L+LGPRILR++TAA+AA +L  A  GDW
Sbjct: 189 APAAILTGPEGGFTDRERALLAAHPAVHRLALGPRILRAETAAIAATSLWMAQHGDW 245


>gi|259415138|ref|ZP_05739060.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259349048|gb|EEW60802.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 246

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 133/242 (54%), Gaps = 7/242 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+VD PL          DQ HYL  V+R+  G  + LFNG+DGEW ++++   K S   
Sbjct: 6   RLYVDHPLGAGQTVPLDRDQAHYLFGVMRLAVGARVALFNGRDGEWQAEVAEASKRSGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  TCVEQSKPLQLPPDLWLIFAPIKKARTDFIVEKAAEMGAARILPVATDFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L  LL +W  + Q++F DE   G    L+ + +   
Sbjct: 126 QAHAVEAAEQCGGTYVPEVADLQKLSALLDHWPEDRQLMFCDEAEVGQRLFLDAVQS-EK 184

Query: 187 IPNV----AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
            P      AILIGPEGG+   E++ L ++     +SLGPRILR+DTAAVAAM L Q   G
Sbjct: 185 PPTASGSWAILIGPEGGFSDAERKRLQAMQQAHVVSLGPRILRADTAAVAAMTLWQRALG 244

Query: 243 DW 244
           DW
Sbjct: 245 DW 246


>gi|114800139|ref|YP_760086.1| 16S ribosomal RNA methyltransferase RsmE [Hyphomonas neptunium ATCC
           15444]
 gi|114740313|gb|ABI78438.1| conserved hypothetical protein TIGR00046 [Hyphomonas neptunium ATCC
           15444]
          Length = 256

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 137/256 (53%), Gaps = 18/256 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGK 63
           + + RLFVD PL          +Q +YL  VLR+++G ++ LFNG+DGEW + +     K
Sbjct: 2   ATIPRLFVDAPLAEAGAVALDDEQSNYLLRVLRLEDGASVRLFNGRDGEWTATVHKTSAK 61

Query: 64  SIRFKVEYQSRSQTKQ--SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
                   Q+R+Q  Q  + +  +F+P+K ++ D +++K+ E+G   IRPV+T  TQ   
Sbjct: 62  RAEATPSRQTRTQPGQIGTRLTLLFAPVKKDQTDLILEKATELGAARIRPVLTERTQTRT 121

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS---- 177
              DR R   + AAEQ + L LP I    +L+  L   +    ++F DE  G E      
Sbjct: 122 VRADRFRKIALEAAEQTERLDLPEILDLASLDAALDALEPGTAVIFCDE-AGDEAEAPWG 180

Query: 178 ---------LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
                    LE L  +    + AIL GPEGG+   E+  L       P+SLGPRILR++T
Sbjct: 181 GQAGRARPMLEVLEELKGR-SAAILTGPEGGFTPAERAFLRGRAETWPVSLGPRILRAET 239

Query: 229 AAVAAMALVQAICGDW 244
           AA++AM L QA+CGDW
Sbjct: 240 AAISAMTLWQAVCGDW 255


>gi|254510112|ref|ZP_05122179.1| surface protein [Rhodobacteraceae bacterium KLH11]
 gi|221533823|gb|EEE36811.1| surface protein [Rhodobacteraceae bacterium KLH11]
          Length = 229

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 126/220 (57%), Gaps = 5/220 (2%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           DQ HYL  V+R+  G  + LFNG+DGEWLS+++  GK         Q++      D+  +
Sbjct: 12  DQAHYLFGVMRLSVGARVALFNGQDGEWLSEVAEAGKRGGVLGCIAQTKPLQLPPDLWLL 71

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + + AAEQC    +P 
Sbjct: 72  FAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRLQAHAVEAAEQCGGTFVPE 131

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEE 204
           +     L+ +L  W    Q++F DE   GS   L K          AILIGPEGG+  +E
Sbjct: 132 VAELQRLDRVLDAWPETRQLMFCDEAEVGSALRLAKQE---QNQPWAILIGPEGGFSDKE 188

Query: 205 KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           ++ L +LP+   +SLGPRILR+DTA VAAM + Q   GDW
Sbjct: 189 RKRLAALPYSHTVSLGPRILRADTAVVAAMTMWQQALGDW 228


>gi|85703484|ref|ZP_01034588.1| hypothetical protein ROS217_22122 [Roseovarius sp. 217]
 gi|85672412|gb|EAQ27269.1| hypothetical protein ROS217_22122 [Roseovarius sp. 217]
          Length = 243

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR-F 67
           RL+++ PL        S  Q HYL  V+R   GD +L+FNG+ GEW +++   GK     
Sbjct: 7   RLYLEHPLGEGQTIPLSQPQAHYLFGVMRQGVGDAVLVFNGEAGEWRAEVIEAGKRGGIL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           ++  Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 67  QIAEQTAPQRDPPDLWLMFAPIKKARTDFIVEKAAEMGAARIIPVQTEFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L+ +L +W    Q++F DE   G    L +   +  
Sbjct: 127 QAHAVEAAEQCGGTYVPEVSDLHRLDRMLADWPEARQVMFCDEALAGCAEGLGR--DLPR 184

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 185 GAPWAILIGPEGGFSEAERARLAALPQAHAVSLGPRILRADTAAVAAMTLWQNSLGDW 242


>gi|89056403|ref|YP_511854.1| 16S ribosomal RNA methyltransferase RsmE [Jannaschia sp. CCS1]
 gi|88865952|gb|ABD56829.1| protein of unknown function DUF558 [Jannaschia sp. CCS1]
          Length = 245

 Score =  164 bits (416), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 134/237 (56%), Gaps = 1/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL        S D  +YL +V+R+  G  + LFNG DGEW ++++  GK     
Sbjct: 8   RLFVDHPLGEAQSVPVSRDHANYLFNVMRLDAGAGVALFNGTDGEWRAEVAAKGKRGGVL 67

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V + Q+  Q    D+  +F+PIK  R D++++K+ E+G+  + PV T  T       D++
Sbjct: 68  VCKEQTAPQVMPPDMWLLFAPIKKARTDFIVEKAAELGVARVCPVRTERTNAERIRQDKL 127

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +    +LE +L  WD    +VFADE     +S       A  
Sbjct: 128 QAHAMEAAEQCGGTYVPPVEDIRSLEKVLDGWDDRRALVFADEAEAGRSSSLAAVLAAAP 187

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E+  L ++P V  LSLGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 188 PPAAILIGPEGGFSDAERARLRAMPNVHVLSLGPRILRADTAAVAALTLWQEHVGDW 244


>gi|149202038|ref|ZP_01879011.1| hypothetical protein RTM1035_11963 [Roseovarius sp. TM1035]
 gi|149144136|gb|EDM32167.1| hypothetical protein RTM1035_11963 [Roseovarius sp. TM1035]
          Length = 243

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 129/237 (54%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL        +  Q HYL  V+R   GD +LLF+G+ GEW + +   GK     
Sbjct: 7   RLYVEHPLGEGQTIPLTQPQAHYLFGVMRQGVGDAVLLFDGRHGEWRADVIEAGKRGGVL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T       DR+
Sbjct: 67  QVAEQTAPQRDPPDLWLLFAPIKKARTDFIVEKAAEMGAARIIPVQTEFTNAERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ +L +W  + Q++F DE      +          
Sbjct: 127 QAHAVEAAEQCGGTFVPEVGDLHRLDRMLADWPKDRQLMFCDEGLAGHAATLAGDLPRGA 186

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 187 P-WAILIGPEGGFSEAERARLAALPQAHAVSLGPRILRADTAAVAAMTLWQRALGDW 242


>gi|255264688|ref|ZP_05344030.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255107023|gb|EET49697.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 239

 Score =  164 bits (415), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD  L        + +Q HYL  V+R    + + LFNG+DGEW +++   GK     
Sbjct: 6   RLYVDHDLGAGQSVLLTKEQAHYLFGVMRKGVDEVLSLFNGRDGEWDARVVEAGKRKGIL 65

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V E QS+      DV  +F+PIK  R D++++K+ EMG   I PV T +T +     +++
Sbjct: 66  VCEAQSKPLQLPPDVWLMFAPIKKARTDFIVEKATEMGAARIMPVQTEFTNSDRVRHEKL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
             + + AAEQC    +P + P   L  +L  W  + +++F DE      ++    A A  
Sbjct: 126 VAHAVEAAEQCGGTYVPPVDPLAKLTKVLAAWPEDRKLLFCDEALVGAQAV---FAEASH 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+E L + P+VT  SLGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 183 DKWAILIGPEGGFSQAERELLGAKPYVTQASLGPRILRADTAAVAALTLWQTTQGDW 239


>gi|94496115|ref|ZP_01302693.1| hypothetical protein SKA58_03355 [Sphingomonas sp. SKA58]
 gi|94424294|gb|EAT09317.1| hypothetical protein SKA58_03355 [Sphingomonas sp. SKA58]
          Length = 248

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 135/239 (56%), Gaps = 8/239 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL V+  L         G+  HYL  V+R+K  D +LLF+G+ GEW ++   + K  +  
Sbjct: 14  RLHVETQLGDGVAVPVDGNPAHYLISVMRVKPDDIVLLFDGRSGEWAARARDIRKRDLVL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q+R+  +  D     +PI+  R+D + +K+ E+G+  ++PV+TR       N+DR+
Sbjct: 74  ECVAQTRAPEQVPDYWLCCAPIRKGRIDLIAEKACELGVAKLQPVLTRRAVVDKLNLDRL 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS--ENSLEKLHAIA 185
             + + AAEQC    LP +     L+ LL NWD    + FADE+ G+  E +L      A
Sbjct: 134 HAHLVEAAEQCGRTALPDLGSLMKLDALLGNWDSRRHLFFADESGGAPLEQTLR-----A 188

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           H    A L+GPEGG+  +E++ + ++P    +SLGPRILR++TAA+AA +   AI GDW
Sbjct: 189 HPGPAAFLVGPEGGFDPQERDAIQAMPGAVAVSLGPRILRAETAAIAATSAWMAINGDW 247


>gi|83941416|ref|ZP_00953878.1| hypothetical protein EE36_04268 [Sulfitobacter sp. EE-36]
 gi|83847236|gb|EAP85111.1| hypothetical protein EE36_04268 [Sulfitobacter sp. EE-36]
          Length = 220

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 122/218 (55%), Gaps = 4/218 (1%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HYL  V+R   G ++LLFNG DGEW ++++  GK         Q++      D+  IF
Sbjct: 5   QAHYLFGVMRQSVGASVLLFNGIDGEWRAEVAEAGKRGGVLACAEQTKPLHMPPDLWLIF 64

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           +PIK  R D++++K+ EMG   I PV + +T       DR++ + + AAEQC    +P +
Sbjct: 65  APIKKARTDFIVEKAAEMGARRIVPVQSEFTNAGRVQRDRLQAHAVEAAEQCGGTFVPEV 124

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
                L+ L+  W+    ++F DE    E   E+  A A     AILIGPEGG+   E+ 
Sbjct: 125 ADMVRLDRLIDRWEPERSLMFCDEALAGE---EEGLASARPGPWAILIGPEGGFSDSERA 181

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            L  L +  P++LGPRILR+DTAAVAAM L Q   GDW
Sbjct: 182 RLRGLDWSRPVALGPRILRADTAAVAAMTLWQKTLGDW 219


>gi|126734662|ref|ZP_01750408.1| hypothetical protein RCCS2_12334 [Roseobacter sp. CCS2]
 gi|126715217|gb|EBA12082.1| hypothetical protein RCCS2_12334 [Roseobacter sp. CCS2]
          Length = 244

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 137/247 (55%), Gaps = 8/247 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           +++ +   RL+VD  L        S +Q HYL  V+R+ EG  + L NG+DG W + +  
Sbjct: 2   VRLMASKVRLYVDHALGQGQSVPLSREQAHYLFGVMRLAEGAVLSLINGRDGAWDADVVK 61

Query: 61  VGKSIR-FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK     +   Q+       DV  +F+PI+  R  ++++K+VEMG+  + PV T +TQ+
Sbjct: 62  AGKKGGILECSAQTGPLQMPPDVWLLFAPIRKERTAFIVEKAVEMGVSRVCPVQTDFTQS 121

Query: 120 TH-YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-GSENS 177
            +    D+++T+ I AAEQC    +P +     L+ LL  W  + Q++F DE   G    
Sbjct: 122 ANRVRQDKLQTHAIEAAEQCGGTFVPPVDDLAKLDRLLAAWPEDRQLMFCDEVLIGDRVG 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  +         AILIGPEGG+   E++ L  LPF  P+SLGPRILR+DTAAVAA+ + 
Sbjct: 182 LPLVEG-----PWAILIGPEGGFSPAERDRLRGLPFAHPVSLGPRILRADTAAVAALTVW 236

Query: 238 QAICGDW 244
           Q   GDW
Sbjct: 237 QQALGDW 243


>gi|329851437|ref|ZP_08266194.1| RNA methyltransferase, RsmE family protein [Asticcacaulis
           biprosthecum C19]
 gi|328840283|gb|EGF89855.1| RNA methyltransferase, RsmE family protein [Asticcacaulis
           biprosthecum C19]
          Length = 248

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 132/225 (58%), Gaps = 8/225 (3%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           DQ  YLA V+R+   D + +FNG+DGEW +++S VGK +++  +  Q+R Q         
Sbjct: 24  DQSRYLAAVMRLSVDDTVSIFNGRDGEWGARLSEVGKKAVKLDLIEQTRPQPTGQGPILA 83

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
            + IK + L+Y+++K+ E+G G I+ + TR T  +H N++R+ +    +AEQ + L +P 
Sbjct: 84  VALIKRSALEYIVEKATELGAGTIQLLTTRRTNASHTNVERLVSIAKESAEQTERLDVPE 143

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENS------LEKLHAIAHIPNVAILIGPEGG 199
           I  P  L+  L     + +++F DE    E +      L+ L   A +    ILIGPEGG
Sbjct: 144 ILAPVKLDRFLAAAAFD-RLIFGDENSTHEGTRETLPLLQALKTTAAVERSVILIGPEGG 202

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +  +E+  L   P   P++LGPRILR+DTAA++A+ L QA+ GDW
Sbjct: 203 FDDDERLALRGRPDCIPVNLGPRILRADTAAISALTLYQAVVGDW 247


>gi|148555278|ref|YP_001262860.1| 16S ribosomal RNA methyltransferase RsmE [Sphingomonas wittichii
           RW1]
 gi|148500468|gb|ABQ68722.1| protein of unknown function DUF558 [Sphingomonas wittichii RW1]
          Length = 210

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/211 (40%), Positives = 128/211 (60%), Gaps = 6/211 (2%)

Query: 35  VLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNR 93
           ++R+K GD I LF+   GEW + I  VGK ++  +VE + R +    D+  + +PIK  R
Sbjct: 1   MMRLKAGDAIALFDDMSGEWRAVIEQVGKRAVAVRVEQRMREREAVPDLWLVAAPIKKGR 60

Query: 94  LDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE 153
           +D++ +K+ E+G+   RPVITR T     N+DR+R + I AAEQC+   LP +  P  L 
Sbjct: 61  IDWVAEKACELGVARWRPVITRRTIVDRLNLDRLRAHMIEAAEQCERTALPILDEPVKLS 120

Query: 154 FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPF 213
            +L++W  +  ++FADE    E  +    A+   P  AILIGPEGG+  EE+  + ++P 
Sbjct: 121 AMLRDWPADRALIFADE----EGGMPMAEAVKPGP-AAILIGPEGGFTDEERAAILAVPQ 175

Query: 214 VTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              +SLGPRILR+DTA  AA+AL   + GDW
Sbjct: 176 AVGVSLGPRILRADTAMAAAVALWMGLAGDW 206


>gi|332187403|ref|ZP_08389141.1| RNA methyltransferase, RsmE family protein [Sphingomonas sp. S17]
 gi|332012564|gb|EGI54631.1| RNA methyltransferase, RsmE family protein [Sphingomonas sp. S17]
          Length = 247

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 138/241 (57%), Gaps = 13/241 (5%)

Query: 9   RLFVDFPLC---IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
           RLFVD  L    I+  G A+    HYL  V+R K GD + LF+ + GEWL   + VGK  
Sbjct: 14  RLFVDQILAEGPIRIDGPAA----HYLVSVMRTKVGDPVKLFDDRTGEWLGVAASVGKRD 69

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
           +   V  + R +    D+    +P+K  R+D++ +K+ E+G+  + PV+TR T     N 
Sbjct: 70  LTLDVTQRLREREAVPDLWLCAAPLKKGRVDWLAEKACELGVARLVPVVTRRTVVDKPNT 129

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           +R+R + I AAEQC    LP +  P  L  LL++W     + FADE  G    L  L A+
Sbjct: 130 ERLRAHMIEAAEQCGRTALPQVAEPVKLPALLRDWPEERALFFADENGG----LPALEAM 185

Query: 185 -AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            AH    AILIGPEGG+ SEE+E + +LP    + LGPRILR+DTAA AA++L  A  GD
Sbjct: 186 RAHQGPAAILIGPEGGFDSEEREAIRALPSAIGIGLGPRILRADTAAAAAVSLWMAAAGD 245

Query: 244 W 244
           W
Sbjct: 246 W 246


>gi|114771337|ref|ZP_01448757.1| hypothetical protein OM2255_08270 [alpha proteobacterium HTCC2255]
 gi|114548262|gb|EAU51149.1| hypothetical protein OM2255_08270 [alpha proteobacterium HTCC2255]
          Length = 243

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I S + RLFVD PL        + DQ +YL +V+R+  GD I +FNGKDGEW +++  
Sbjct: 1   MDIRSKI-RLFVDSPLGEGQSILLARDQANYLFNVMRLNIGDFISVFNGKDGEWQAEVLQ 59

Query: 61  VGKSIRFK-VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K      V+ QS  Q    DV  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGIIIVKNQSMPQLLPPDVWLLFAPIKKTRTDFIVEKATEMGVSRICPVFTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R++ ++I AAEQC    +P +   +TL  +LK+W     ++F DE    EN ++
Sbjct: 120 DRIKQSRLQAHSIEAAEQCGGTYVPPVDELSTLTSVLKSWPKERHLLFCDEHKVGEN-VK 178

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            + A       AILIGPEGG+   E   L SL FVT +SLGPRILR+DTAAVAA+A+ Q 
Sbjct: 179 SMKATKS-DKWAILIGPEGGFSDSEVMHLKSLEFVTSISLGPRILRADTAAVAALAIWQM 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 QMGDW 242


>gi|87134653|gb|ABD25395.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 258

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 130/239 (54%), Gaps = 6/239 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV+ PL    +    G Q HYL  V+R+  GD ++L +   GEW+S+++ VGK  +  
Sbjct: 23  RLFVEMPLDQGMRLPVDGQQAHYLGKVMRVSTGDAVMLCDDATGEWVSRVAEVGKRDLVL 82

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           ++E ++R + +  D     + +K    D +++K+ E+G   + PV+TR       N +R 
Sbjct: 83  EIERRTRPREEVPDFWLCAALLKKPNFDLVLEKATELGAARVVPVVTRRCVADKLNPERA 142

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA-H 186
           RT  + AAEQC    LP +     L+ LL++W     + FADE  G    +    A + H
Sbjct: 143 RTIMVEAAEQCARTALPSLGETVKLDQLLRDWPEGRTLFFADENGG----IPAAAAFSLH 198

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDWY 245
               A+L+GPEGG+   E+  + + P    ++LGPRILR +TA++A M L   + GDW+
Sbjct: 199 CGPAALLVGPEGGFDETERSAIRAHPAAVGIALGPRILRGETASIAGMGLWMGLQGDWF 257


>gi|229324846|ref|YP_496229.2| hypothetical protein Saro_0950 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 249

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 130/239 (54%), Gaps = 6/239 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV+ PL    +    G Q HYL  V+R+  GD ++L +   GEW+S+++ VGK  +  
Sbjct: 14  RLFVEMPLDQGMRLPVDGQQAHYLGKVMRVSTGDAVMLCDDATGEWVSRVAEVGKRDLVL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           ++E ++R + +  D     + +K    D +++K+ E+G   + PV+TR       N +R 
Sbjct: 74  EIERRTRPREEVPDFWLCAALLKKPNFDLVLEKATELGAARVVPVVTRRCVADKLNPERA 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA-H 186
           RT  + AAEQC    LP +     L+ LL++W     + FADE  G    +    A + H
Sbjct: 134 RTIMVEAAEQCARTALPSLGETVKLDQLLRDWPEGRTLFFADENGG----IPAAAAFSLH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDWY 245
               A+L+GPEGG+   E+  + + P    ++LGPRILR +TA++A M L   + GDW+
Sbjct: 190 CGPAALLVGPEGGFDETERSAIRAHPAAVGIALGPRILRGETASIAGMGLWMGLQGDWF 248


>gi|307296237|ref|ZP_07576064.1| protein of unknown function DUF558 [Sphingobium chlorophenolicum
           L-1]
 gi|306878039|gb|EFN09262.1| protein of unknown function DUF558 [Sphingobium chlorophenolicum
           L-1]
          Length = 248

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 126/221 (57%), Gaps = 4/221 (1%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
            G+  HYL  V+R+K  D +LLF+G+ GEW +K   + K  +  +V  Q+++     D  
Sbjct: 30  DGNPAHYLISVMRVKPDDIVLLFDGRSGEWAAKARDIRKRDLVLEVVSQTKAPENVPDFW 89

Query: 84  YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTL 143
              +PIK  R+D + +K+ E+G+  ++PV+TR       N DR+  + + AAEQC    L
Sbjct: 90  LCCAPIKKGRIDLIAEKACELGVAKLQPVLTRRAVVDKLNFDRLHAHLVEAAEQCGRTAL 149

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSE 203
           P +     L+ L+++W  +  + FADET G E   + L   AH    A LIGPEGG+   
Sbjct: 150 PDLSEMVKLDALIRDWPDDRWLFFADET-GGEPLADTLK--AHPGPAAFLIGPEGGFDPA 206

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           E+E +  +    P+SLGPRILR++TAA+AA +    I GDW
Sbjct: 207 EREAIRGVAKAVPVSLGPRILRAETAAIAATSAWMTINGDW 247


>gi|297184217|gb|ADI20335.1| uncharacterized protein conserved in bacteria [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 243

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I S + RLFVD PL        + DQ +YL +V+R+  GD I +FNGKDGEW +++  
Sbjct: 1   MDIRSKI-RLFVDSPLGEGQSILLARDQANYLFNVMRLNIGDFISVFNGKDGEWQAEVLQ 59

Query: 61  VGKSIRFK-VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K      V+ QS  Q    DV  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGIIIVKNQSMPQLLPPDVWLLFAPIKKARTDFIVEKATEMGVSRICPVFTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R++ ++I AAEQC    +P +   +TL  +LK+W     ++F DE    EN ++
Sbjct: 120 DRIKQSRLQAHSIEAAEQCGGTYVPPVDELSTLTSVLKSWPKERHLLFCDEHKVGEN-VK 178

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            + A       AILIGPEGG+   E   L SL FVT +SLGPRILR+DTAAVAA+A+ Q 
Sbjct: 179 SMKATKS-DKWAILIGPEGGFSDSEVMHLKSLEFVTSISLGPRILRADTAAVAALAIWQM 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 QMGDW 242


>gi|296284223|ref|ZP_06862221.1| 16S ribosomal RNA methyltransferase RsmE [Citromicrobium
           bathyomarinum JL354]
          Length = 255

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 129/239 (53%), Gaps = 8/239 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFV+  L         G++ HYL  V+R+ EGD ++L +   GEW +++  V K  R  
Sbjct: 14  RLFVEDELGEGRTIALYGNRAHYLGKVMRVSEGDTVILCDDLTGEWAARVGQVDKR-RVD 72

Query: 69  VEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
           V    R + +++       P  +K +R D +++K+ E+G+ AIRPV+TR       N +R
Sbjct: 73  VTVVERLREREAVPDLWLCPALLKKDRFDLVLEKATELGVAAIRPVVTRRCVADKLNPER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA- 185
             T    AAEQC    LP +  P  L+ LL +W     + FADE  G + +     A A 
Sbjct: 133 AATIVTEAAEQCARTALPQVAGPVKLDALLADWPAERALFFADEEGGEDAA----SAFAR 188

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           H    AIL GPEGG+   E+  + +LP   P++LGPRILR +TA +AA+++  A  GDW
Sbjct: 189 HGAPAAILTGPEGGFDDAERAAIRALPQAIPITLGPRILRGETATIAAISIWMAQAGDW 247


>gi|83591910|ref|YP_425662.1| 16S ribosomal RNA methyltransferase RsmE [Rhodospirillum rubrum
           ATCC 11170]
 gi|83574824|gb|ABC21375.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 247

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 140/237 (59%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL      +  G Q HYL  V+R+  G  + LFNG+DGEWL+ +  +GK+    
Sbjct: 9   RLYVDAPLAAGLDVRLDGAQAHYLRDVMRLGPGAAVALFNGRDGEWLATLDTLGKAGAQA 68

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V +   R Q  +     +F+P+K    DY+++K+VE+G GA+ PV+TR TQ+     DR+
Sbjct: 69  VAQTLLRPQGDEDGPWLLFAPLKKEATDYLVEKAVELGCGALLPVMTRRTQSQKVRTDRL 128

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC+ LTLP ++ P  L  +L++W    ++    E   +  +         +
Sbjct: 129 RAQVIGAAEQCERLTLPAVFEPRPLAKVLEDWPAERRLFVLAERRDALPAARAFAGARAL 188

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              A+L+GPEGG   ++ + L +LP  TP+ LGPRILR++TAA AA+A+ QA+ GDW
Sbjct: 189 -KAALLVGPEGGLDDKDLDALLALPSSTPVGLGPRILRAETAAAAALAVWQAVAGDW 244


>gi|254486640|ref|ZP_05099845.1| conserved hypothetical protein TIGR00046 [Roseobacter sp. GAI101]
 gi|214043509|gb|EEB84147.1| conserved hypothetical protein TIGR00046 [Roseobacter sp. GAI101]
          Length = 240

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 129/241 (53%), Gaps = 12/241 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+  L           Q HYL  V+R   G  +LLFNGKDGEW +++   GK  R  
Sbjct: 6   RLYVEHGLGQGQSVPLDKAQAHYLFGVMRQAVGAAVLLFNGKDGEWRAEVVEAGK--RGG 63

Query: 69  VEYQSRSQTKQ----SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
           V  Q  +QTK      D+  IF+PIK  R D++++K+ EMG   I PV T +T       
Sbjct: 64  V-LQCVAQTKPLQMPPDLWLIFAPIKKTRTDFIVEKAAEMGARRIVPVQTDFTNAGRVQR 122

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHA 183
           DR++ + + AAEQC    +  +     L+ L+  WD    ++F DE   GS+  L +   
Sbjct: 123 DRLQAHAVEAAEQCGATFVAEVTEMVKLDRLIDQWDAGRSLMFCDEALAGSDAVLGQSGR 182

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A      ILIGPEGG+   E+  L  L +   ++LGPRILR+DTAAVAAM + Q   GD
Sbjct: 183 GAW----GILIGPEGGFSDRERSRLRGLEYARSVTLGPRILRADTAAVAAMTVWQQAFGD 238

Query: 244 W 244
           W
Sbjct: 239 W 239


>gi|315499603|ref|YP_004088406.1| hypothetical protein Astex_2610 [Asticcacaulis excentricus CB 48]
 gi|315417615|gb|ADU14255.1| protein of unknown function DUF558 [Asticcacaulis excentricus CB
           48]
          Length = 248

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 132/227 (58%), Gaps = 12/227 (5%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDV-QY 84
           DQ  Y+A V+R+ +GD I +FNG+DGEW  ++  V K  +  ++  Q+R Q    +  + 
Sbjct: 24  DQARYVAAVMRLGDGDEISVFNGRDGEWRGRLQAVSKKHVHVELIAQARPQPAAGNAPKL 83

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLP 144
           + + +K  RL+ +I+K+ E+G+G I+ +ITR T   H N+ R++     AAEQ + L +P
Sbjct: 84  LIALVKRGRLETIIEKATELGVGEIQLLITRRTNADHTNLARLQLIAQEAAEQTERLDVP 143

Query: 145 FIYPPTTLEFLLKNWDHNCQIVFADETCGSENS-------LEKLHAIAHIPNVAILIGPE 197
            +  P  LE  LK       +++ DE    E         LE L  +     V+ILIGPE
Sbjct: 144 QVLAPVKLEVYLKAASET--LIYGDEDSTHETGERTISPMLEALSGLGE-GAVSILIGPE 200

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GG+ + E++TL   P    ++LGPRILR+DTAA++A+ L QA+ GDW
Sbjct: 201 GGFDAVERQTLSVQPNTVAVNLGPRILRADTAAISALTLYQAVRGDW 247


>gi|114763454|ref|ZP_01442861.1| hypothetical protein 1100011001336_R2601_17754 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543992|gb|EAU47003.1| hypothetical protein R2601_17754 [Roseovarius sp. HTCC2601]
          Length = 208

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 123/210 (58%), Gaps = 4/210 (1%)

Query: 36  LRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRL 94
           +RM  G  ILLFNG DGEW ++I+  GK     V + Q+R+Q    D+  +F+PIK  R 
Sbjct: 1   MRMATGGEILLFNGHDGEWRAEITEAGKKAGTAVCDTQTRAQAMPPDLWLLFAPIKKART 60

Query: 95  DYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEF 154
           D++++K+VE+G+  I PV T++T +     DR++ + + AAEQC  L +P +     L+ 
Sbjct: 61  DFIVEKAVELGVRRILPVQTQFTNSERIRQDRLQAHALEAAEQCGALFVPEVAELVRLDR 120

Query: 155 LLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFV 214
           LL +W     ++F DE   +E         +     A+LIGPEGG+   E+  L  +   
Sbjct: 121 LLADWPDERGLLFCDE---AEAGSRAGALASAPAPSAVLIGPEGGFSDAERTRLGRMEQT 177

Query: 215 TPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             ++LGPRILR+DTAAVAA+ L Q+  GDW
Sbjct: 178 RVIALGPRILRADTAAVAALTLWQSQSGDW 207


>gi|154251112|ref|YP_001411936.1| hypothetical protein Plav_0656 [Parvibaculum lavamentivorans DS-1]
 gi|154155062|gb|ABS62279.1| protein of unknown function DUF558 [Parvibaculum lavamentivorans
           DS-1]
          Length = 264

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 144/251 (57%), Gaps = 8/251 (3%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +  S   RL+++ PL    +     DQ HYL +VLRM EG  +LLFNG+DGEW ++I+  
Sbjct: 14  RCASGKARLYIEEPLNAGARLTLERDQSHYLVNVLRMGEGAAVLLFNGRDGEWAARIAEA 73

Query: 62  -GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
             K+   ++  Q+R Q    D+  +F+P+K  RLD++ QK+ EMG   I+PVIT  T  T
Sbjct: 74  HKKNCVLELTAQTRVQEPLPDIWLLFAPVKKARLDFIAQKATEMGAAVIQPVITERTVVT 133

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC---QIVFADETCGSENS 177
               +R++   + AAEQC ++ +P +     L  LL  W+      +I+F DE+     +
Sbjct: 134 RLKDERLQANAVEAAEQCGLVAVPEVREAEKLGSLLARWEEAAPGRRILFCDESEEPGAA 193

Query: 178 LEKLHAIAHI----PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            E L  +A        +AILIGPEGG+  +E++ L        LSLGPRI+R+DTAA+AA
Sbjct: 194 REALARLAEEGWRGAPLAILIGPEGGFSPKERDMLRGRKDTAVLSLGPRIMRADTAAIAA 253

Query: 234 MALVQAICGDW 244
           +A+V    GDW
Sbjct: 254 LAVVGLALGDW 264


>gi|159045639|ref|YP_001534433.1| 16S ribosomal RNA methyltransferase RsmE [Dinoroseobacter shibae
           DFL 12]
 gi|157913399|gb|ABV94832.1| protein of unknown function DUF558 [Dinoroseobacter shibae DFL 12]
          Length = 249

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 130/239 (54%), Gaps = 4/239 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL+V+ PL        SG Q HYL  V+R   G+ + LFNG  G W +++   GK     
Sbjct: 11  RLYVEHPLGQGQTVPLSGAQAHYLFGVMRRGVGEVVTLFNGHAGAWAARVVEAGKRGGVL 70

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +VE Q+  Q    D+   F+PIK  R D++++K+ EMG   I PV T +T       DR+
Sbjct: 71  EVETQTAPQRDPPDLWLCFAPIKKARTDFIVEKAAEMGARRIVPVQTAFTNAERIRRDRL 130

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ LL +W  +  ++F DE    E +       A +
Sbjct: 131 QAHAVEAAEQCGGTFVPEVADLVGLDRLLSDWPSDRSLMFCDEALAEEGAAAAADTPA-L 189

Query: 188 PN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P+   AILIGPEGG+   E+  L ++P    + LGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 190 PDGPWAILIGPEGGFSEPERARLRAMPQAQSVRLGPRILRADTAAVAALTLWQIRYGDW 248


>gi|254437857|ref|ZP_05051351.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 307]
 gi|198253303|gb|EDY77617.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 307]
          Length = 234

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 135/237 (56%), Gaps = 6/237 (2%)

Query: 10  LFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFK 68
           ++VD PL  + +   S +Q HYL  V+R+  G ++ LFNG+DGEW + ++   K S    
Sbjct: 1   MYVDHPLGPQERVALSREQAHYLFGVMRLDVGADVSLFNGRDGEWRALVAAASKKSGVLD 60

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH-YNMDRV 127
              Q++      D+  +F+PIK +R  ++++K+ E+G   I P+ T YTQ+ +    DR+
Sbjct: 61  CVVQTKPLQMPPDLWLVFAPIKKDRTSFIVEKAAELGAARIVPLQTEYTQSANRVRQDRL 120

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +        +L  W+   +I+F DE    +  +   +A    
Sbjct: 121 QAHALEAAEQCGGTYVPEVAELQKFAKMLDTWNPTRRILFCDEAMVDKPLILPTNAGPW- 179

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+  +E++ L+S+     +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 180 ---AILIGPEGGFSDKERDRLNSMLCAHAISLGPRILRADTAAVAAMTLWQQAMGDW 233


>gi|294010080|ref|YP_003543540.1| hypothetical protein SJA_C1-00940 [Sphingobium japonicum UT26S]
 gi|292673410|dbj|BAI94928.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 253

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RL V+  L         G+  HYL  V+R+K  D +LLF+G+ GEW +K   + K  +  
Sbjct: 19  RLHVETQLGEGVSVPVDGNPAHYLISVMRVKADDIVLLFDGRSGEWAAKARDIRKRDLVL 78

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  ++R      D     +PI+  R+D + +K+ E+G+  ++PV+TR       N+DR+
Sbjct: 79  EVVSRTRPPEDVPDFWLCCAPIRKGRIDLVAEKACELGVARLQPVLTRRAVVDKLNLDRL 138

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
             + + AAEQC    LP +     L+ LL++W     + FADE+ G E   + L   AH 
Sbjct: 139 YAHLVEAAEQCGRTALPELGQMAKLDALLRDWPEGRWLFFADES-GGEPLADTLK--AHP 195

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              A LIGPEGG+   E+E +  +    P+SLGPRILR++TAA+AA +    I GDW
Sbjct: 196 GPAAFLIGPEGGFDPAEREAIRRVAKAIPVSLGPRILRAETAAIAATSAWMTINGDW 252


>gi|86139068|ref|ZP_01057639.1| hypothetical protein MED193_10953 [Roseobacter sp. MED193]
 gi|85824299|gb|EAQ44503.1| hypothetical protein MED193_10953 [Roseobacter sp. MED193]
          Length = 259

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 127/248 (51%), Gaps = 30/248 (12%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           +Q HYL  V+R + G  + LFNG DGEW ++++  GK         QS++     D+  I
Sbjct: 12  EQAHYLFGVMRQRLGGAVALFNGFDGEWQAEVTEAGKRGGTLTCVAQSKTLQMPPDLWLI 71

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+PIK  R D++++K+ EMG   I PV T YT +     DR++ + + AAEQC    +P 
Sbjct: 72  FAPIKKARTDFIVEKAAEMGAARILPVGTDYTNSERIRQDRLQAHAVEAAEQCGGTYVPE 131

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADET-----------------------------CGSEN 176
           +     L  LL +W    Q++F DE                               G++ 
Sbjct: 132 VCDLQKLSQLLDHWPDERQLMFCDEAEVGQRRFLEVARGSAGPEGGREAPALGGGTGADR 191

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S  +      +   AILIGPEGG+  +E++ LH++     +SLGPRILR+DTAAVAAM L
Sbjct: 192 SASEPFGKLSLQPWAILIGPEGGFSDKERKRLHAMAQAHVVSLGPRILRADTAAVAAMTL 251

Query: 237 VQAICGDW 244
            Q   GDW
Sbjct: 252 WQQTLGDW 259


>gi|85708013|ref|ZP_01039079.1| hypothetical protein NAP1_02220 [Erythrobacter sp. NAP1]
 gi|85689547|gb|EAQ29550.1| hypothetical protein NAP1_02220 [Erythrobacter sp. NAP1]
          Length = 253

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 128/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           RLFV+  L         G+Q HYL  V+R+  GD ++L +   GEW +++  V K  +  
Sbjct: 14  RLFVEDELGDGRIFALEGNQAHYLGKVMRVSPGDTVILCDNITGEWAARVGQVEKRRVDL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            V    R + +  D+    + +K +R D++++K+ E+G   I+P+ITR       NM+R 
Sbjct: 74  TVTDHLRPRGEVPDLWLCPALLKKDRFDFVLEKATELGSARIQPMITRRCVADKLNMERA 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R     AAEQC    LP I  P  L+ LL +W     I FADE  G E++ +      H 
Sbjct: 134 RIIATEAAEQCARTALPDIAEPVKLDALLADWPSERAIFFADEE-GGEHAADAF--CFHE 190

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+  + + P    +SLGPRILR +TAA+AA+++  A  GDW
Sbjct: 191 GPAAILIGPEGGFDDAERAAIRAHPQARAISLGPRILRGETAAIAALSVWMAEAGDW 247


>gi|326386680|ref|ZP_08208302.1| 16S ribosomal RNA methyltransferase RsmE [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208995|gb|EGD59790.1| 16S ribosomal RNA methyltransferase RsmE [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 255

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 123/237 (51%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLFV  PL         G Q HYL  V+R+  GD ++L +   GEW ++   VGK  +  
Sbjct: 18  RLFVTGPLGDGVSVTIEGGQAHYLVRVMRIAPGDVVVLCDDATGEWATQAGPVGKRDLVL 77

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               + R +    D     + +K +R D +++K+ E+G+  +RP++ R       N +R 
Sbjct: 78  TCTTRLREREDVPDFWLCPALLKKDRFDLVLEKASELGVARLRPMLARRCVADKLNPERA 137

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC    LP    P  +E LL +W  +  + FADE  G+  +       AH 
Sbjct: 138 RATLIEAAEQCARTALPQCDAPVRIEALLADWPQDRTLFFADENGGAPAAA---SFAAHP 194

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               +L+GPEGG+   E+  + + P   P++LGPRILR +TAA+AA +L   +CGDW
Sbjct: 195 GPAGLLVGPEGGFDEAERAAIRAHPAAVPITLGPRILRGETAAIAATSLWMGLCGDW 251


>gi|126730424|ref|ZP_01746235.1| hypothetical protein SSE37_11729 [Sagittula stellata E-37]
 gi|126709157|gb|EBA08212.1| hypothetical protein SSE37_11729 [Sagittula stellata E-37]
          Length = 247

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 138/237 (58%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL VD PL  +     S DQ HYL  V+R++ G  + LFNG+DGEW ++++  GK     
Sbjct: 13  RLCVDQPLAEEQAVALSRDQAHYLFGVMRLERGARVALFNGRDGEWAAEVADAGKRGGTL 72

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V   +  +Q    D+  +F+P+K  R D++++K+VEMG+  I PV T +T +    +D+ 
Sbjct: 73  VCRDRQAAQGTPPDLWLLFAPVKKARTDFIVEKAVEMGVRRILPVQTDFTNSERLRVDKQ 132

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     LE LL  WD   QI+F DET     ++  L  +   
Sbjct: 133 QAHAVEAAEQCGATFVPEVAEMARLERLLSEWDTTRQILFCDETAAGAPTI--LGGLEPG 190

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  A+LIGPEGG+   E+  L  +     +SLGPRILR++TAAVAA+AL QA  GDW
Sbjct: 191 P-WAVLIGPEGGFSDRERARLAEMDCARAVSLGPRILRAETAAVAALALWQAHLGDW 246


>gi|221640498|ref|YP_002526760.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           KD131]
 gi|221161279|gb|ACM02259.1| Hypothetical Protein RSKD131_2399 [Rhodobacter sphaeroides KD131]
          Length = 224

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 126/225 (56%), Gaps = 18/225 (8%)

Query: 36  LRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRL 94
           +R+  G  + LFNG+DGEW ++++  GK         Q+       D+  +F+PIK  R 
Sbjct: 1   MRLARGAAVSLFNGRDGEWRAEVAETGKRGGTLLCTDQTAPLRLPPDLWLLFAPIKKART 60

Query: 95  DYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEF 154
           D++++K+ EMG   I PV TR+T +     DR++ + + AAEQC    +P +    +LE 
Sbjct: 61  DFIVEKAAEMGAARILPVQTRFTNSERIRQDRLQAHAVEAAEQCGGTFVPEVADLASLER 120

Query: 155 LLKNWDHNCQIVFADET-CGSENSLEKLHAIAHI-----------PNV---AILIGPEGG 199
           LL +W    +I++ DE+  G+   L  L A               P+    AILIGPEGG
Sbjct: 121 LLADWPAERRIMWCDESLVGARAGL--LEAAGGFEARGFEEGPKRPSPGPWAILIGPEGG 178

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +  EE+  L  +  V P+SLGPRILR+DTAAVAA+ L Q++ GDW
Sbjct: 179 FSEEEQARLRRMEQVVPVSLGPRILRADTAAVAALTLWQSVLGDW 223


>gi|228879506|ref|YP_457473.2| 16S ribosomal RNA methyltransferase RsmE [Erythrobacter litoralis
           HTCC2594]
          Length = 276

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 133/262 (50%), Gaps = 27/262 (10%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFV  P+   T     G+  HYL  V+R+  GD ++L +   GEW  K++ V K I   
Sbjct: 14  RLFVPEPIAAGTAVTVDGNAAHYLGKVMRVSAGDAVILCDDATGEWACKVTDVEKRI-VT 72

Query: 69  VEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
           +E   + + ++    +   P  +K +R D +++K+ E+G+ AIRPV+TR       N +R
Sbjct: 73  LEPVEKLREREQVPDFWLCPALLKKDRFDLVLEKATELGVRAIRPVVTRRCVADKLNAER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS---------ENS 177
            R     AAEQC    LP +  P  L+ LL++W  +  + FADE  G+           S
Sbjct: 133 ARAIVTEAAEQCARTALPELAEPVKLDSLLRDWPEDRALFFADELGGAPAGEAFVTYSES 192

Query: 178 LEKLHAIA----HIPN-----------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPR 222
           L +    A    H+ +            A+LIGPEGG+   E++ + + P    ++LGPR
Sbjct: 193 LRRQGPQAGKDPHLDDQAARGPRLRGGAALLIGPEGGFDDAERKAIRAHPQARAITLGPR 252

Query: 223 ILRSDTAAVAAMALVQAICGDW 244
           ILR +TAA+AA AL     GDW
Sbjct: 253 ILRGETAAIAATALWMGTVGDW 274


>gi|149186955|ref|ZP_01865263.1| hypothetical protein ED21_24936 [Erythrobacter sp. SD-21]
 gi|148829344|gb|EDL47787.1| hypothetical protein ED21_24936 [Erythrobacter sp. SD-21]
          Length = 239

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 126/229 (55%), Gaps = 4/229 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           RLFV   L         G+Q +YLA V+R+ +GD ++L +   GEW+++++  GK  +  
Sbjct: 14  RLFVSDELGTGRIVCIEGNQANYLARVMRVGKGDAVILCDDVTGEWIARVTEAGKRRVEL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           KVE   R + +  D     + +K +R D +++KS E+G+ AI PVITR       N +R 
Sbjct: 74  KVEDHLRPREEVPDFWLCPALLKKDRFDVVLEKSTELGVAAIHPVITRRCVADKLNGERA 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
            T    AAEQC    LP +  P  L+ LL++W  +  + FADE  G   +    +A    
Sbjct: 134 STIVTEAAEQCARTALPQVAEPVKLDALLRDWPEDRILFFADEEGGEPAADAFCYADGP- 192

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
              A+L GPEGG+   E+  + + P   P+SLGPRILR +TAA+A +A+
Sbjct: 193 --AALLTGPEGGFDDAERAAIRAHPAARPISLGPRILRGETAALAGIAV 239


>gi|84786494|gb|ABC62676.1| hypothetical protein ELI_02920 [Erythrobacter litoralis HTCC2594]
          Length = 260

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/256 (32%), Positives = 129/256 (50%), Gaps = 27/256 (10%)

Query: 15  PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSR 74
           P+   T     G+  HYL  V+R+  GD ++L +   GEW  K++ V K I   +E   +
Sbjct: 4   PIAAGTAVTVDGNAAHYLGKVMRVSAGDAVILCDDATGEWACKVTDVEKRI-VTLEPVEK 62

Query: 75  SQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTI 132
            + ++    +   P  +K +R D +++K+ E+G+ AIRPV+TR       N +R R    
Sbjct: 63  LREREQVPDFWLCPALLKKDRFDLVLEKATELGVRAIRPVVTRRCVADKLNAERARAIVT 122

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS---------ENSLEKLHA 183
            AAEQC    LP +  P  L+ LL++W  +  + FADE  G+           SL +   
Sbjct: 123 EAAEQCARTALPELAEPVKLDSLLRDWPEDRALFFADELGGAPAGEAFVTYSESLRRQGP 182

Query: 184 IA----HIPN-----------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
            A    H+ +            A+LIGPEGG+   E++ + + P    ++LGPRILR +T
Sbjct: 183 QAGKDPHLDDQAARGPRLRGGAALLIGPEGGFDDAERKAIRAHPQARAITLGPRILRGET 242

Query: 229 AAVAAMALVQAICGDW 244
           AA+AA AL     GDW
Sbjct: 243 AAIAATALWMGTVGDW 258


>gi|304321780|ref|YP_003855423.1| hypothetical protein PB2503_11169 [Parvularcula bermudensis
           HTCC2503]
 gi|303300682|gb|ADM10281.1| hypothetical protein PB2503_11169 [Parvularcula bermudensis
           HTCC2503]
          Length = 262

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 22/237 (9%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQY 84
           G Q+HYL HVLR+ +   +LLF+G+ GEW + I+   K      VE Q+R  T  S +  
Sbjct: 28  GAQWHYLHHVLRLDQNAPVLLFDGRSGEWAAAITIASKKHGVLTVERQTRPMTPPSPLTL 87

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM--DRVRTYTISAAEQCDILT 142
            F+P+K +  + +IQK  E+G+   RPV T  T      +  DR+ +  + AAEQC+ L 
Sbjct: 88  YFAPLKKDPTELIIQKGTELGITDFRPVRTDRTIVPKAGLKDDRLASIAVEAAEQCERLD 147

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS----------------LEKLHAIAH 186
            P I+P  +L+ L+     +C +V+ DE     ++                L +  ++A 
Sbjct: 148 TPTIHPLISLQDLIAA-PPSC-LVYCDEAGDDPSARWGGPSGHGEGAAAALLTRQESLAG 205

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            P  A+LIGPEGG+   E++TL +LP    +SLGPR+LR++TAA+ A++L QA+ GD
Sbjct: 206 SPG-ALLIGPEGGFTPTERQTLRALPGTLAVSLGPRVLRAETAALVAISLWQAVLGD 261


>gi|241761515|ref|ZP_04759602.1| protein of unknown function DUF558 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753879|ref|YP_003226772.1| 16S ribosomal RNA methyltransferase RsmE [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|241373823|gb|EER63356.1| protein of unknown function DUF558 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258553242|gb|ACV76188.1| protein of unknown function DUF558 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 256

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 139/239 (58%), Gaps = 4/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L RL+V+  L ++        Q HYL  V+R K G  ++LF+   GEWL ++   G K +
Sbjct: 12  LPRLYVEEKLSLEAVITPDRAQAHYLLSVMRFKMGSQLVLFDNLTGEWLGEVIEAGRKHL 71

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           + K+ +    +    D+  + +PIK  R+D++ +K+ E+G+  I PVIT+ T     N++
Sbjct: 72  QLKITHHLNEKESIPDLWLLTAPIKKGRIDWIYEKACELGVARITPVITQRTIVDRVNLE 131

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R++ + + AAEQC   +L  +    +L+ LL  W  +  + FADET G E  +E L    
Sbjct: 132 RLQAHIVEAAEQCGRTSLSEVTEACSLKSLLAEWPEDRALFFADET-GGEPMIEALSKRK 190

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AIL+GPEGG+  +E++ ++++    P+SLGPRILR+DTAA+AA AL  A  GDW
Sbjct: 191 M--AAAILVGPEGGFTDQERDMINAVKQAVPVSLGPRILRADTAAIAATALWMAAAGDW 247


>gi|294084693|ref|YP_003551451.1| hypothetical protein SAR116_1124 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664266|gb|ADE39367.1| protein of unknown function DUF558 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 253

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 132/245 (53%), Gaps = 4/245 (1%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           H    RL+VD PL        + +Q HYL +V+R+  G  I LFNG+DGEW   I  + K
Sbjct: 8   HPAKARLYVDAPLQASGFVTVTKEQAHYLGNVMRLPLGTVIALFNGQDGEWHGVIDALDK 67

Query: 64  -SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
              +  +  Q+R QT   D+  +F+P+K  RLD++ QK+ E+G   I PV T + Q +  
Sbjct: 68  QGGQIALTDQTRPQTNSPDLWLLFAPVKKARLDFIAQKASELGASRIWPVRTEFCQISRV 127

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET---CGSENSLE 179
             +R+    I AAEQ + L +  I     L   L   + +  +++ DE      + N   
Sbjct: 128 KDERLAANAIEAAEQTERLDVARIMKFEKLATALAEREDDRLLIWCDEASAGAANHNITT 187

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L AI      AILIGPEGG+   E++ L  +      SLGPRILR+DTAA+AA+A  QA
Sbjct: 188 ALAAIDPPKKAAILIGPEGGFSPAERKVLTQVDNCLTTSLGPRILRADTAAIAALACYQA 247

Query: 240 ICGDW 244
           ICGDW
Sbjct: 248 ICGDW 252


>gi|254454094|ref|ZP_05067531.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 238]
 gi|198268500|gb|EDY92770.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 238]
          Length = 209

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 122/216 (56%), Gaps = 14/216 (6%)

Query: 35  VLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKTNR 93
           ++R+  G ++ LFNG+DGEW ++++   K +       Q++      D+  +F+PIK +R
Sbjct: 1   MMRLDVGADVSLFNGRDGEWHAQVAAASKKNGVLDCIVQTKPLQLPPDLWLVFAPIKKDR 60

Query: 94  LDYMIQKSVEMGMGAIRPVITRYTQNTH-YNMDRVRTYTISAAEQCDILTLPFIYPPTTL 152
             ++++K+ E+G   I PV T YTQ+ +    DR++ + + AAEQC    +P +      
Sbjct: 61  TSFIVEKAAELGAARIVPVQTEYTQSANRVRQDRLQAHALEAAEQCGGTYVPEVAEIQKF 120

Query: 153 EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN----VAILIGPEGGYHSEEKETL 208
             +   WD   +I+F DET   + ++        IP      AILIGPEGG+  +E+E L
Sbjct: 121 AKMFNRWDPTRRILFCDETMVGQGAV--------IPTGEGPWAILIGPEGGFSDKERERL 172

Query: 209 HSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           + +     +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 173 NGMACAHAISLGPRILRADTAAVAAMTLWQQALGDW 208


>gi|56552450|ref|YP_163289.1| 16S ribosomal RNA methyltransferase RsmE [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544024|gb|AAV90178.1| protein of unknown function DUF558 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 256

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 139/239 (58%), Gaps = 4/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L RL+V+  L ++        Q HYL  V+R K G  ++LF+   GEWL ++   G K +
Sbjct: 12  LPRLYVEEKLSLEAVIIPDRAQAHYLLSVMRFKMGSQLVLFDNLTGEWLGEVIEAGRKHL 71

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           + K+ +    +    D+  + +PIK  R+D++ +K+ E+G+  I PVIT+ T     N++
Sbjct: 72  QLKITHHLNEKESIPDLWLLTAPIKKGRIDWIYEKACELGVARITPVITQRTIVDRVNLE 131

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R++ + + AAEQC   +L  +    +L+ LL  W  +  + FADET G E  +E L    
Sbjct: 132 RLQAHIVEAAEQCGRTSLSEVTEACSLKSLLAEWPEDRALFFADET-GGEPMIEALSKRK 190

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AIL+GPEGG+  +E++ ++++    P+SLGPRILR+DTAA+AA AL  A  GDW
Sbjct: 191 M--AAAILVGPEGGFTDQERDMINAVKQAVPVSLGPRILRADTAAIAATALWMAAAGDW 247


>gi|58617229|ref|YP_196428.1| hypothetical protein ERGA_CDS_05020 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416841|emb|CAI27954.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 238

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 123/209 (58%), Gaps = 5/209 (2%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           HY++ V+R  + D++ +FNGKDGEW+ +I  +  +I+ +++  +R Q K  ++   F  +
Sbjct: 30  HYISKVMRATKCDHVKIFNGKDGEWIGEICELSNNIKIRIDKLTRKQVKSKNLTLCFGIV 89

Query: 90  KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPP 149
           K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ R + I A+EQC+ L +P I  P
Sbjct: 90  KGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKCRKWAIEASEQCERLDIPQISHP 149

Query: 150 TTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLH 209
            +   L K    N   +  DET   +   E L    +  N+ I++GPEGG+ SEE +  +
Sbjct: 150 ISFTDLKKLDTANINFIICDETGNGKKPAEIL---TNKNNIYIIVGPEGGFSSEELDFAY 206

Query: 210 SLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +  F   LSLG RILR DTA V+A+A V 
Sbjct: 207 T--FCNGLSLGTRILRVDTAVVSALAYVN 233


>gi|6580788|gb|AAF18294.1| hypothetical protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 256

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 138/239 (57%), Gaps = 4/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L RL+V+  L ++        Q HYL  V+R K G  ++LF+   GEWL ++   G K +
Sbjct: 12  LPRLYVEEKLSLEAVIIPDRAQAHYLLSVMRFKMGSQLVLFDNLTGEWLGEVIEAGRKHL 71

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           + K+ +    +    D+  + +PIK  R+D++ +K+ E+G+  I PVIT+ T     N++
Sbjct: 72  QLKITHHLNEKESIPDLWLLTAPIKKGRIDWIYEKACELGVARITPVITQRTIVDRVNLE 131

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R++ + + AAEQC   +L  +    +L  LL  W  +  + FADET G E  +E L    
Sbjct: 132 RLQAHIVEAAEQCGRTSLSEVTEACSLISLLAEWPEDRALFFADET-GGEPMIEALSKRK 190

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AIL+GPEGG+  +E++ ++++    P+SLGPRILR+DTAA+AA AL  A  GDW
Sbjct: 191 M--AAAILVGPEGGFTDQERDMINAVKQAVPVSLGPRILRADTAAIAATALWMAAAGDW 247


>gi|57239217|ref|YP_180353.1| 16S ribosomal RNA methyltransferase RsmE [Ehrlichia ruminantium
           str. Welgevonden]
 gi|57161296|emb|CAH58217.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 238

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 122/209 (58%), Gaps = 5/209 (2%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           HY++ V+R  + D + +FNGKDGEW+ +I  +  +I+ +++  +R Q K  ++   F  +
Sbjct: 30  HYISKVMRATKCDYVKIFNGKDGEWIGEICELSNNIKIRIDKLTRKQVKSKNLTLCFGIV 89

Query: 90  KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPP 149
           K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ R + I A+EQC+ L +P I  P
Sbjct: 90  KGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKCRKWAIEASEQCERLDIPQISHP 149

Query: 150 TTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLH 209
            +   L K    N   +  DET   +   E L    +  N+ I++GPEGG+ SEE +  +
Sbjct: 150 ISFTDLKKLDTANINFIICDETGNGKKPAEIL---TNKNNIYIIVGPEGGFSSEELDFAY 206

Query: 210 SLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +  F   LSLG RILR DTA V+A+A V 
Sbjct: 207 T--FCNGLSLGTRILRVDTAVVSALAYVN 233


>gi|262276809|ref|ZP_06054602.1| RNA methyltransferase, RsmE family [alpha proteobacterium HIMB114]
 gi|262223912|gb|EEY74371.1| RNA methyltransferase, RsmE family [alpha proteobacterium HIMB114]
          Length = 234

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 133/229 (58%), Gaps = 6/229 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRF 67
           RLF    L  K      GD YHYL++V+R + G +I LFN  +GE+L +I     K +  
Sbjct: 5   RLFFIESLEEKKTINIIGDDYHYLSNVMRCEVGSDIFLFNENNGEYLCRIIEKNKKKLIL 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  ++  +  Q+++  IF P K+++LD +IQK  E+G+ +  PVI+ +T+N   N++R+
Sbjct: 65  EVIQKAEYEKIQNNINLIFCPPKSHKLDTLIQKCTEIGVKSFIPVISDHTENRKLNLNRI 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R     + EQ + L +P I+ P + +  L    +  ++ FAD    S+ +L KL  I   
Sbjct: 125 RKIIKESVEQSNQLNIPHIFDPISFDQFLNQQKY--KVFFAD--IQSDINLSKL-KINLK 179

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            N +ILIGPEG + S+E +TL S       SLG RILRS+TAA+A++ L
Sbjct: 180 ENNSILIGPEGDFSSKELKTLRSNNNFISFSLGKRILRSETAAIASLVL 228


>gi|310815076|ref|YP_003963040.1| hypothetical protein EIO_0578 [Ketogulonicigenium vulgare Y25]
 gi|308753811|gb|ADO41740.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 244

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW-LSKISYVGKSIRF 67
           RLFVD PL        + DQ +YL +V+R++ G  + L NG+DGEW  S +S   +    
Sbjct: 6   RLFVDHPLGPGQTVPLNADQANYLFNVMRLQPGTVLSLINGRDGEWDASVVSAAKRHGTL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q++      D+   F+PIK  R D++I+K+ E+G   + P+++ +T +    +DR+
Sbjct: 66  LASRQTKPLQLPPDLWLAFAPIKKTRTDFIIEKATELGTARMIPILSDHTNSERVRVDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + I A EQC    LP +  P  L   L ++     + F DE    + S     A A  
Sbjct: 126 QAHVIEAVEQCGGTALPEVADPVALSAFLDHFPAGRTLWFCDEALVGQPS--GFPADATA 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               ILIGPEGG+ + E++ L +LPF   ++LGPRILR+DTAA+AA+ L QA  GDW
Sbjct: 184 GPACILIGPEGGFSARERDRLRTLPFARSIALGPRILRADTAALAALTLWQAGLGDW 240


>gi|58579175|ref|YP_197387.1| hypothetical protein ERWE_CDS_05110 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417801|emb|CAI27005.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 121/209 (57%), Gaps = 5/209 (2%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           HY++ V+R  + D + +FNGKDGEW+ +I  +   I+ +++  +R Q K  ++   F  +
Sbjct: 31  HYISKVMRATKCDYVKIFNGKDGEWIGEICELSNHIKIRIDKLTRKQVKSKNLTLCFGIV 90

Query: 90  KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPP 149
           K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ R + I A+EQC+ L +P I  P
Sbjct: 91  KGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKCRKWAIEASEQCERLDIPQISHP 150

Query: 150 TTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLH 209
            +   L K    N   +  DET   +   E L    +  N+ I++GPEGG+ SEE +  +
Sbjct: 151 ISFTDLKKLDTANINFIICDETGNGKKPAEIL---TNKNNIYIIVGPEGGFSSEELDFAY 207

Query: 210 SLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +  F   LSLG RILR DTA V+A+A V 
Sbjct: 208 T--FCNGLSLGTRILRVDTAVVSALAYVN 234


>gi|71082844|ref|YP_265563.1| hypothetical protein SAR11_0136 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061957|gb|AAZ20960.1| conserved hypothetical protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 233

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 122/231 (52%), Gaps = 7/231 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RLF    L +    K    Q HY+  V+R+K G+   LFN   GEW +KI  + KSI  F
Sbjct: 5   RLFFKESLSLNLTAKLDKSQSHYVNKVMRIKVGEVFSLFNN-SGEWEAKILTISKSIVEF 63

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q R +    D+   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+
Sbjct: 64  NITKQLRQKENVKDLWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERL 123

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ + + +P I  P +L+  L +      ++F D    SEN     + +AH 
Sbjct: 124 EKVIIEAAEQSNRINVPLIEDPQSLKSFLNH--EKMDLIFTD--LNSENKKLDFNKLAHN 179

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           P   ++IGPEG +  EE+  + +   V P+ +   ILRS+TA ++A+++V 
Sbjct: 180 P-TCVIIGPEGDFSEEERGEILAFKGVQPIKINENILRSETAVISALSIVN 229


>gi|91762733|ref|ZP_01264698.1| hypothetical protein PU1002_05671 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718535|gb|EAS85185.1| hypothetical protein PU1002_05671 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 233

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 122/231 (52%), Gaps = 7/231 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RLF    L +    K    Q HY+  V+R+K G+   LFN   GEW +KI  + KSI  F
Sbjct: 5   RLFFKESLSLNLTAKLDKSQSHYVNKVMRIKVGEVFSLFNN-SGEWEAKILTISKSIVEF 63

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q R +    D+   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+
Sbjct: 64  NITKQLRQKENVKDLWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERL 123

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ + + +P I  P +L+  L +      ++F D    SEN     + +AH 
Sbjct: 124 EKVIIEAAEQSNRINVPLIEDPQSLKSFLNH--EKMGLIFTD--LNSENKKLDFNKLAHN 179

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           P   ++IGPEG +  EE+  + +   V P+ +   ILRS+TA ++A+++V 
Sbjct: 180 P-TCVIIGPEGDFSEEERGEILAFKGVQPIKINENILRSETAVISALSIVN 229


>gi|330813642|ref|YP_004357881.1| ribosomal RNA small subunit methyltransferase E [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486737|gb|AEA81142.1| ribosomal RNA small subunit methyltransferase E [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 238

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 125/230 (54%), Gaps = 3/230 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS-YVGKSIRF 67
           R+F+   L    + +   DQ HY+++V+R+K GD +LLFNG DGE+L K++    K    
Sbjct: 6   RIFLSERLEENNKIELGKDQSHYISNVMRLKSGDELLLFNGIDGEFLGKVAGSEKKQTII 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V  + R Q+K S++   F P+K  RLD++IQK  E+G+ +  PVI+ +T   + N +R+
Sbjct: 66  QVHAKQRDQSKPSNISLAFCPLKGQRLDFLIQKCTEVGLKSFIPVISDHTIVRNVNENRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   I ++EQ D L +P +     LE  L        ++F D      N L +L      
Sbjct: 126 KKIIIESSEQSDQLHIPQVLSALNLEEFLHFLKKEDVVLFGD-ISSKNNDLTQLIEDKS- 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            N  + IGPEG +  +E+E +         SLG  ILRS+TAA+A + L+
Sbjct: 184 KNYILFIGPEGDFSPKEREIILKNVKFKSFSLGKNILRSETAAIAGLVLL 233


>gi|73667112|ref|YP_303128.1| hypothetical protein Ecaj_0493 [Ehrlichia canis str. Jake]
 gi|72394253|gb|AAZ68530.1| Conserved hypothetical protein 46 [Ehrlichia canis str. Jake]
          Length = 239

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 121/211 (57%), Gaps = 9/211 (4%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           HY+ +V+R    D I LFNGKDGEW+ +I  V  + +  V  Q R Q     +   F+ +
Sbjct: 30  HYICNVMRAANLDEIKLFNGKDGEWIGEIFEVSHNTKIIVNEQIRKQVATKCLVLCFAIV 89

Query: 90  KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPP 149
           K   L  ++++S EMG+  ++P+ T++   ++ N+D+ + + I AAEQC+ L +P I  P
Sbjct: 90  KNTALQNVVRQSTEMGVTLMQPLYTKHIATSNINLDKCKKWAIEAAEQCERLDIPDILSP 149

Query: 150 TTLEFL--LKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKET 207
            +   L  LK+ D+N   V  DET   ++  E L    +  N+ I+IGPEGG+ ++E   
Sbjct: 150 ISFVDLGKLKSSDNN--FVICDETGKGKHPSEVLK---NKDNIHIIIGPEGGFSNDELNF 204

Query: 208 LHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +S  F   LSLG RIL+ DTA V+A+A V 
Sbjct: 205 AYS--FCDGLSLGTRILKVDTAVVSALAYVN 233


>gi|329114600|ref|ZP_08243359.1| Ribosomal RNA small subunit methyltransferase E [Acetobacter
           pomorum DM001]
 gi|326696080|gb|EGE47762.1| Ribosomal RNA small subunit methyltransferase E [Acetobacter
           pomorum DM001]
          Length = 257

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 114/221 (51%), Gaps = 11/221 (4%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF-KVEYQSRSQTKQSDVQYI 85
           DQ  YL  VLR K GD++ +FN K GEWL++I+ + K   F  +E+Q RS T Q  +   
Sbjct: 34  DQARYLGTVLRKKTGDHVRIFNAKSGEWLARITEIRKDKGFFALEHQLRSPTPQPALVLA 93

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+ +K +  D  ++   E+G+    P+IT  T     N DR+      A EQC+   +P 
Sbjct: 94  FALLKRDATDLALRMGTELGVTHFVPLITERTNTHRINPDRLHAIATEATEQCERFDVPH 153

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV----AILIGPEGGYH 201
           I  P +    L +W    ++  A E    EN    +H  A +P+       L+GPEGG  
Sbjct: 154 IESPQSFTDFLASWPQEHRLFAAIER--GEN--RAIHTPALLPDAHAGDGFLVGPEGGLS 209

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
             E + +     +TP+SLGP +LR+DTA  A +AL+   CG
Sbjct: 210 DRECQMMLKYSCITPISLGPLVLRADTAVAAGLALIG--CG 248


>gi|254455755|ref|ZP_05069184.1| conserved hypothetical protein TIGR00046 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082757|gb|EDZ60183.1| conserved hypothetical protein TIGR00046 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 232

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 122/230 (53%), Gaps = 8/230 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           RLF    L I  + K    Q HY++ V+R+KE +   LFN   GEW +KI  + K S+ F
Sbjct: 5   RLFFPKSLSINLKDKLDKSQSHYVSKVMRIKENEVFSLFNS-SGEWEAKIISISKSSVEF 63

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q R +    ++   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+
Sbjct: 64  NITKQLRQKENLKELWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERL 123

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQ + +T+P I  P  L+  L N   +  ++F D    + N+   L  +   
Sbjct: 124 EKVIIEAAEQSNRITVPIIEEPQKLKNFLSN---DMDLIFTD--LNTSNTKIDLKKLTTK 178

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           P   ++IGPEG +  EE+E +     V  + +   ILRS+TA ++A++++
Sbjct: 179 P-TCVIIGPEGDFSEEEREKILKFNGVQSIKINENILRSETAVISALSII 227


>gi|58002818|gb|AAW61712.1| Hypothetical protein GOX1976 [Gluconobacter oxydans 621H]
          Length = 254

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 114/217 (52%), Gaps = 9/217 (4%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ-SRSQTKQSDVQYIF 86
           Q HYL +V+R   G  + +FN +DGEW ++I+ + K     + ++  R+      V+ +F
Sbjct: 42  QAHYLGNVMRQGVGSAVRVFNERDGEWAAEIASLKKDKGSVLLHRCERTPAPTDGVELLF 101

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           +P+K +  + +I+   E+G+   RPV+T  T     N++R+      AAEQC+ L +P I
Sbjct: 102 APLKRDATELVIRMGTELGVTRFRPVVTERTNTHRLNLERLSLIATEAAEQCERLDIPEI 161

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            PP +L  +L  W  +  +  A E    E+        A +   A+LIGPEGG+   E E
Sbjct: 162 LPPESLRVVLAGWPDDRPLFAALERRPGED--------AGVQAAALLIGPEGGFSEAEVE 213

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            L     V  LSLGP +LR++TA  A ++ + A   D
Sbjct: 214 LLRRHAAVHALSLGPLVLRAETAVCAGLSRLAARAED 250


>gi|229557995|ref|YP_192368.2| 16S ribosomal RNA methyltransferase RsmE [Gluconobacter oxydans
           621H]
          Length = 250

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 114/217 (52%), Gaps = 9/217 (4%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ-SRSQTKQSDVQYIF 86
           Q HYL +V+R   G  + +FN +DGEW ++I+ + K     + ++  R+      V+ +F
Sbjct: 38  QAHYLGNVMRQGVGSAVRVFNERDGEWAAEIASLKKDKGSVLLHRCERTPAPTDGVELLF 97

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           +P+K +  + +I+   E+G+   RPV+T  T     N++R+      AAEQC+ L +P I
Sbjct: 98  APLKRDATELVIRMGTELGVTRFRPVVTERTNTHRLNLERLSLIATEAAEQCERLDIPEI 157

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            PP +L  +L  W  +  +  A E    E+        A +   A+LIGPEGG+   E E
Sbjct: 158 LPPESLRVVLAGWPDDRPLFAALERRPGED--------AGVQAAALLIGPEGGFSEAEVE 209

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            L     V  LSLGP +LR++TA  A ++ + A   D
Sbjct: 210 LLRRHAAVHALSLGPLVLRAETAVCAGLSRLAARAED 246


>gi|258542801|ref|YP_003188234.1| 16S ribosomal RNA methyltransferase RsmE [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633879|dbj|BAH99854.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636938|dbj|BAI02907.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639991|dbj|BAI05953.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643047|dbj|BAI09002.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646102|dbj|BAI12050.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649155|dbj|BAI15096.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652142|dbj|BAI18076.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655199|dbj|BAI21126.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 275

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 114/216 (52%), Gaps = 9/216 (4%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF-KVEYQSRSQTKQSDVQYI 85
           DQ  YL  VLR K GD++ +FN   GEWL++I+ + K   F ++E Q R+ T+Q  +   
Sbjct: 52  DQARYLGTVLRKKAGDHVRIFNANSGEWLARITEIRKDKGFFELERQLRAPTQQPTLVLA 111

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+ +K +  D +++   E+G+    P+IT  T     N DR+      A EQC+   +P 
Sbjct: 112 FALLKRDATDLVLRMGTELGVTHFMPLITERTNTHRINPDRLHAIATEATEQCERFDVPQ 171

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV----AILIGPEGGYH 201
           I  P +    L +W    ++ FA    G + +   +H  + +PN       L+GPEGG  
Sbjct: 172 IESPQSFTDFLASWPQEHRL-FAAVERGEDRA---IHTPSLLPNAHAGDGFLVGPEGGLS 227

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             E + +     +TP+SLGP +LR+DTA  A +AL+
Sbjct: 228 DRECQMMLKYSCITPISLGPLVLRADTAVAAGLALI 263


>gi|218661479|ref|ZP_03517409.1| 16S rRNA m3U1498 methyltransferase [Rhizobium etli IE4771]
          Length = 151

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 102/151 (67%), Gaps = 1/151 (0%)

Query: 94  LDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE 153
           +DY++QK+VEMG G ++PV+T++ Q    N+D++R   + AAEQC +L +P +  P  L 
Sbjct: 1   MDYLVQKAVEMGAGLLQPVMTQHVQGKITNLDKLRANVVEAAEQCGVLGIPAVAEPVKLS 60

Query: 154 FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPF 213
            LL  W    +I++ DE    +N L  L AI    ++A+L+GPEGG+  EE+  L SL F
Sbjct: 61  DLLDRWPKERRIIYCDEGDAGQNPLPVLSAIRE-RHLALLVGPEGGFSEEERARLRSLDF 119

Query: 214 VTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           VT + LGPRILR+DTAAVAA+A+VQA  GDW
Sbjct: 120 VTAIPLGPRILRADTAAVAALAVVQATIGDW 150


>gi|326404264|ref|YP_004284346.1| hypothetical protein ACMV_21170 [Acidiphilium multivorum AIU301]
 gi|325051126|dbj|BAJ81464.1| hypothetical protein ACMV_21170 [Acidiphilium multivorum AIU301]
          Length = 226

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
           S  Q HYL  V+R + GD +L+FN   GE+ + I  + + +    +  ++R+   + D  
Sbjct: 10  SAAQAHYLGAVMRRRAGDRLLVFNAGSGEFAATIGALDRRAATLVLGARTRAPEPEPDCW 69

Query: 84  YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTL 143
             F+P++ +  + +++K+ E+G+  + PV+T  TQ      DR+      AAEQ + LT+
Sbjct: 70  LCFAPLRRDMTELVVEKATELGVSRLVPVLTARTQPARLRADRLAAIATEAAEQSERLTI 129

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSE 203
           P I  P  L   L ++  + ++  A E     ++   L     +   A+L+GPEGG   E
Sbjct: 130 PDIAEPAPLAAFLASFPPSRRLFVAAE----RHAAPPLSPADPLQPHALLVGPEGGLAPE 185

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           E + +    FV+P++LGPRILR++TAA+A +A
Sbjct: 186 ELDAMARHAFVSPVTLGPRILRAETAAIAGLA 217


>gi|162149021|ref|YP_001603482.1| 16S ribosomal RNA methyltransferase RsmE [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787598|emb|CAP57194.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 250

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 115/236 (48%), Gaps = 7/236 (2%)

Query: 9   RLFVDFPLCIKTQGKASGD----QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           RLF D       +  A  D    Q HYL  VLR+  GD + LFN +DGEWL++I  + + 
Sbjct: 6   RLFADPATQPPMEADAVRDLTPGQAHYLGTVLRLGVGDEVALFNPRDGEWLARIEAMRRD 65

Query: 65  I-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
             + ++  Q R+    +    +F+P+K +  D +++   E+G+    PV+T  T     N
Sbjct: 66  RGQVRLLRQRRAAEPVAGPVLLFAPLKRDATDMVVRMGTELGVTRFLPVLTERTNTHRVN 125

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
             R+ T    AAEQC+ L +P I  P  L   L  W    ++  A E          +  
Sbjct: 126 EARLETIAGEAAEQCERLDVPAIDAPRRLADRLGEWPPERRLFVAAERADRRGGAGGIED 185

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +A      +LIGPEGG+   E   L + PFV  +SLG  ILR+DTA    ++L+ A
Sbjct: 186 VAD--GDGLLIGPEGGFSDVEVNMLRARPFVRMISLGGLILRADTAVACGLSLMGA 239


>gi|209545229|ref|YP_002277458.1| 16S ribosomal RNA methyltransferase RsmE [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532906|gb|ACI52843.1| protein of unknown function DUF558 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 250

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 115/236 (48%), Gaps = 7/236 (2%)

Query: 9   RLFVDFPLCIKTQGKASGD----QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           RLF D       +  A  D    Q HYL  VLR+  GD + LFN +DGEWL++I  + + 
Sbjct: 6   RLFADPATQPPMEADAVRDLTPGQAHYLGTVLRLGVGDEVALFNPRDGEWLARIEAMRRD 65

Query: 65  I-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
             + ++  Q R+    +    +F+P+K +  D +++   E+G+    PV+T  T     N
Sbjct: 66  RGQVRLLRQRRAAEPVAGPVLLFAPLKRDATDMVVRMGTELGVTRFLPVLTERTNTHRVN 125

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
             R+ T    AAEQC+ L +P I  P  L   L  W    ++  A E          +  
Sbjct: 126 EARLETIAGEAAEQCERLDVPAIDAPRRLADRLGEWPPERRLFVAAERADRRGGAGGIED 185

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +A      +L+GPEGG+   E   L + PFV  +SLG  ILR+DTA    ++L+ A
Sbjct: 186 VAD--GDGLLVGPEGGFSDVEVNMLRARPFVRMISLGGLILRADTAVACGLSLMGA 239


>gi|114328853|ref|YP_746009.1| 16S ribosomal RNA methyltransferase RsmE [Granulibacter
           bethesdensis CGDNIH1]
 gi|114317027|gb|ABI63087.1| surface protein [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 111/213 (52%), Gaps = 7/213 (3%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQYIF 86
           + HYL  V+R   GD + LFN  DGEW + I  +  K     +  Q RS   +     +F
Sbjct: 35  RAHYLGTVMRRGVGDALSLFNATDGEWRAVIERIDRKGATLSLTEQIRSPVPEEGPWLVF 94

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K    + ++QK+ E+G+  + PV+T  T     N  R+    + AAEQC+ L++P +
Sbjct: 95  ALLKRTNTELVVQKATELGVSRLIPVMTTRTNAERINAARLEAIAVEAAEQCERLSIPVL 154

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
             P  L  LL++W  + ++  A E        +  HA       A+L GPEGG+  +E  
Sbjct: 155 QAPQPLPALLRDWPEDRRLYAAIERS------DVAHARGVAGPSALLTGPEGGFAEQELV 208

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L S   V P+SLG  +LR++TAA+A +AL+ A
Sbjct: 209 MLRSHAHVIPVSLGRTVLRAETAAIAGLALLTA 241


>gi|190571358|ref|YP_001975716.1| hypothetical protein WPa_0963 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018754|ref|ZP_03334562.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357630|emb|CAQ55071.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995705|gb|EEB56345.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 231

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 13/238 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           RL+V+  L           Q HY+ +V+R+K+ DNI LFNGKDGEWL ++  +  KS + 
Sbjct: 5   RLYVEEALSQNVSLALHPRQSHYIYNVMRLKKHDNIYLFNGKDGEWLGEVVNISSKSTKI 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            ++ +++ Q  + ++    + +K+  L  +++++ EMG+  I+ + T  T   + N+ R 
Sbjct: 65  IIKERTKQQQHEKNLYLYCALVKSGALSNIVRQATEMGVTCIQFISTERTVVKNINLSRA 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   I AAEQ    ++P I+ P  + F   +   N   V  DET G      K+  +   
Sbjct: 125 KLQAIEAAEQSGRTSIPQIFLP--INFCELSDSQNKNFVLCDET-GEGQPPNKV--LKGK 179

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDWY 245
            NVAI++GPEGG+ S E ++ +   F   LSLG RILR DTA VAA+        +WY
Sbjct: 180 KNVAIIVGPEGGFSSCELDSAN--KFCQKLSLGKRILRVDTAVVAALTFT-----NWY 230


>gi|157825352|ref|YP_001493072.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia akari str.
           Hartford]
 gi|157799310|gb|ABV74564.1| hypothetical protein A1C_01170 [Rickettsia akari str. Hartford]
          Length = 254

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 132/231 (57%), Gaps = 4/231 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D + +FNG +GE+L+ I+ +GK +I  
Sbjct: 5   RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRIFNGTEGEFLAHITAIGKHNISV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++ Q +    +S +    + IK ++L   I  + ++G+  I P+IT   Q    N++R+
Sbjct: 65  RLKEQLKKPYTESALTLAVAIIKQDKLMLAINMATQLGITKIIPLITSRCQFRTVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + L  P I    T++  LK   HN  +++A+E    ENS+ ++ ++   
Sbjct: 125 TKCVIEATEQSERLIPPIIEKAITIQDCLK--KHNNFMLYANEHEKEENSILRISSLLD- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            N+AI+IGPEGG+ ++E E L S      +SLG  ILR++TA + A+  V+
Sbjct: 182 NNIAIIIGPEGGFTNDELELLASYKNTKSVSLGSNILRAETAVITAIVQVK 232


>gi|88607769|ref|YP_505371.1| hypothetical protein APH_0794 [Anaplasma phagocytophilum HZ]
 gi|88598832|gb|ABD44302.1| conserved hypothetical protein TIGR00046 [Anaplasma phagocytophilum
           HZ]
          Length = 239

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 119/213 (55%), Gaps = 9/213 (4%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQY 84
            DQ HY+  V+R++  D ++LF+G  G+W + IS +  K +  +VE+      K  D+  
Sbjct: 29  SDQAHYIRDVMRVRISDAVVLFDGVTGDWFATISEISRKKVEVRVEHLVSEYVKSRDLML 88

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLP 144
             + +K + +  +++++ EMG+  I+P+ T Y+  +  N+ + R + I AAEQC+   +P
Sbjct: 89  CIALVKQDTMRSVVRQATEMGVTQIQPIRTEYSVVSDINVQKCRQWAIEAAEQCERQDIP 148

Query: 145 FIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEE 204
            I   + +EF   N D   ++V  DET       E L +     N+ I+IGPEGG+   E
Sbjct: 149 EI--ASVMEFTHLN-DLGKKLVLCDETGKGRMPAEVLRS---KENLGIIIGPEGGFS--E 200

Query: 205 KETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +E + +  F   +SLG RILR DTA VAA+A V
Sbjct: 201 RELVCAESFCEKMSLGHRILRVDTAVVAALAYV 233


>gi|68171492|ref|ZP_00544876.1| Conserved hypothetical protein 46 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658073|ref|YP_507353.1| hypothetical protein ECH_0540 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999098|gb|EAM85765.1| Conserved hypothetical protein 46 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599530|gb|ABD44999.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 241

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 124/234 (52%), Gaps = 13/234 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD  L   +         HY+ HV+R  + D + LFNG+DGEW+ +I  +  + + +
Sbjct: 11  RLYVDCTLSKSSIVILDNIASHYICHVMRAAKLDEVKLFNGRDGEWIGEIFELSSNTKIR 70

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V    R Q     +    S +K   L  +I+++ EMG+  I+P+ T++   ++ N+ + +
Sbjct: 71  VNELIRRQYVPKSLTLCLSIVKNTALQNVIRQATEMGVTFIQPIYTQHIATSNINLSKCK 130

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFL----LKNWDHNCQIVFADETCGSENSLEKLHAI 184
            + I AAEQC  L +P I  P  ++F+    LK  D+N   V  DET       E L   
Sbjct: 131 KWAIEAAEQCGRLDIPDISFP--IDFIDLKQLKTDDNN--FVICDETGKGHPPSEVLKGK 186

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
               NV I+IGPEGG+ ++E    +S  F   LSLG  ILR DTA V+A+A V+
Sbjct: 187 N---NVHIIIGPEGGFSNDELSFAYS--FCDGLSLGTTILRVDTAVVSALAYVK 235


>gi|229594326|ref|YP_001499059.2| 16S ribosomal RNA methyltransferase RsmE [Rickettsia massiliae
           MTU5]
          Length = 243

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 134/231 (58%), Gaps = 3/231 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ +  
Sbjct: 5   RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 65  RLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRRCQFRSVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + LT P I    T++  LK   +N  +++A+E    +NS+ ++ +    
Sbjct: 125 TKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEDNSILRISSSLSN 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            ++ I++GPEGG+ ++E E L S      +SLG  ILR++TAA+ A+  V+
Sbjct: 183 SDITIIVGPEGGFTNDELELLASYKNTKSISLGRNILRAETAAITAIVQVR 233


>gi|120555960|ref|YP_960311.1| 16S ribosomal RNA methyltransferase RsmE [Marinobacter aquaeolei
           VT8]
 gi|120325809|gb|ABM20124.1| 16S rRNA m(3)U-1498 methyltransferase [Marinobacter aquaeolei VT8]
          Length = 244

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 137/249 (55%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            + R+F D PL +  Q +   +  +++  VLRM+ G  +LLFNG   ++ + I+  GK  
Sbjct: 2   RIPRIFTDSPLAVGGQCQLDDNAANHVGRVLRMQAGQALLLFNGDGQDYHATITEAGKKH 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           ++  V   + ++T +S ++ + +    K +R+DY +QK+VEMG+  I P+ T    +   
Sbjct: 62  VQVAVTEAAENET-ESSLRVVLAQTLSKGDRMDYAVQKAVEMGVSEIVPLTTERC-DVKL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGS 174
             DR        +   ISAAEQC    +P I P  T++  L++    + ++V    T  S
Sbjct: 120 KGDREDKRLRHWQQVAISAAEQCGRARVPEIQPVMTVQQWLEHARACDLRLVLHHRTERS 179

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+LEK  +I      A++IGPEGG  +EE        F+ P++LGPR+LR++TA VAA+
Sbjct: 180 LNTLEKPSSI------ALMIGPEGGLTAEEIALAEDNGFL-PVALGPRVLRTETAPVAAI 232

Query: 235 ALVQAICGD 243
           AL Q + GD
Sbjct: 233 ALCQWLWGD 241


>gi|157844011|gb|ABV84512.1| hypothetical protein RMA_0218 [Rickettsia massiliae MTU5]
          Length = 283

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 134/231 (58%), Gaps = 3/231 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ +  
Sbjct: 45  RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLSV 104

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 105 RLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRRCQFRSVNIERL 164

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + LT P I    T++  LK   +N  +++A+E    +NS+ ++ +    
Sbjct: 165 TKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEDNSILRISSSLSN 222

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            ++ I++GPEGG+ ++E E L S      +SLG  ILR++TAA+ A+  V+
Sbjct: 223 SDITIIVGPEGGFTNDELELLASYKNTKSISLGRNILRAETAAITAIVQVR 273


>gi|42521009|ref|NP_966924.1| hypothetical protein WD1212 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|225630878|ref|YP_002727669.1| putative methyltransferase [Wolbachia sp. wRi]
 gi|225677207|ref|ZP_03788200.1| putative methyltransferase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|42410750|gb|AAS14858.1| conserved hypothetical protein TIGR00046 [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225590731|gb|EEH11965.1| putative methyltransferase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225592859|gb|ACN95878.1| putative methyltransferase [Wolbachia sp. wRi]
          Length = 228

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 121/229 (52%), Gaps = 11/229 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+  L        +  Q HY+ +V+R+K+ DN+ LFNGKDGEWL ++  + + +   
Sbjct: 5   RLYVEEALSQGVSLALNPQQSHYICNVMRLKKYDNLSLFNGKDGEWLGEVVNISRKLTEV 64

Query: 69  VEYQSRSQTKQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
              +   Q +  +  Y++   +K+  L+ +++++ EMG+  I+ + T  T   + N+ R 
Sbjct: 65  TPKECTKQQQYEENLYLYCAMVKSAALNNIVRQATEMGVICIQFISTERTVVKNINLSRA 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   I AAEQ   +++P I PP     L  +   N   V  DET  ++  L+        
Sbjct: 125 KLQAIEAAEQSGRISIPEILPPINFCELPDSQSKN--FVLCDETGKADKVLKGKK----- 177

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            NVAI++GPEGG+ S E +      F   LSLG RILR DTA VAA+  
Sbjct: 178 -NVAIIVGPEGGFSSYELDLADK--FCQKLSLGKRILRVDTAVVAALTF 223


>gi|218516761|ref|ZP_03513601.1| 16S rRNA m3U1498 methyltransferase [Rhizobium etli 8C-3]
          Length = 133

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 87/133 (65%), Gaps = 1/133 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFVD PL      +A+ +Q++YLA+VLRM+    ILLFNG+DGEW + +S+
Sbjct: 1   MRANFRMQRLFVDAPLSAGAAIEANAEQFNYLANVLRMEADAEILLFNGRDGEWKASLSF 60

Query: 61  -VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEQMRPQPAPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTI 132
              N+D++R   +
Sbjct: 121 KITNLDKLRANVV 133


>gi|49082184|gb|AAT50492.1| PA0419 [synthetic construct]
          Length = 241

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 125/253 (49%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLSL-GQHDLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLV------------ 169

Query: 179 EKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             LH +A     H P   +A L+GPEGG    E E   +  F +   LGPR+LR++TA V
Sbjct: 170 --LHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHS-ARLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|15595616|ref|NP_249110.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PAO1]
 gi|218889161|ref|YP_002438025.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           LESB58]
 gi|254237347|ref|ZP_04930670.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254243517|ref|ZP_04936839.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9946275|gb|AAG03808.1|AE004479_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126169278|gb|EAZ54789.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126196895|gb|EAZ60958.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218769384|emb|CAW25144.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 240

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 125/253 (49%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLSL-GQHDLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLV------------ 169

Query: 179 EKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             LH +A     H P   +A L+GPEGG    E E   +  F +   LGPR+LR++TA V
Sbjct: 170 --LHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHS-ARLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|296386918|ref|ZP_06876417.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PAb1]
 gi|313111958|ref|ZP_07797747.1| hypothetical protein PA39016_004050033 [Pseudomonas aeruginosa
           39016]
 gi|310884249|gb|EFQ42843.1| hypothetical protein PA39016_004050033 [Pseudomonas aeruginosa
           39016]
          Length = 240

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 124/253 (49%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLAL-GQHDLPETQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLV------------ 169

Query: 179 EKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             LH +A     H P   +A L+GPEGG    E E   +  F     LGPR+LR++TA V
Sbjct: 170 --LHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHA-ARLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|58698200|ref|ZP_00373121.1| conserved hypothetical protein TIGR00046 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58535281|gb|EAL59359.1| conserved hypothetical protein TIGR00046 [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 228

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 121/229 (52%), Gaps = 11/229 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+  L        +  Q HY+ +V+R+K+ DN+ LFNGKDGEWL ++  + + +   
Sbjct: 5   RLYVEEALSQGVSLALNPQQSHYICNVMRLKKYDNLSLFNGKDGEWLGEVVNISRKLTEV 64

Query: 69  VEYQSRSQTKQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
              +   Q +  +  Y++   +K+  L+ +++++ EMG+  I+ + T  T   + N+ R 
Sbjct: 65  TPKECTKQQQYEENLYLYCAMVKSAALNNIVRQATEMGVICIQFISTERTVVKNINLSRA 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   I AAEQ   +++P I PP     L  +   N   V  DET  ++  L+        
Sbjct: 125 KLQAIEAAEQSGRISIPEILPPINFCELPDSQSKN--FVLCDETGKADKVLKGKK----- 177

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            NVAI++GPEGG+ S E +      F   LSLG RILR DTA +AA+  
Sbjct: 178 -NVAIIVGPEGGFSSYELDLADK--FCQKLSLGKRILRVDTAVLAALTF 223


>gi|116054150|ref|YP_788593.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115589371|gb|ABJ15386.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 240

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 124/253 (49%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLAL-GQHDLPETQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+  D   ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDELRLV------------ 169

Query: 179 EKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             LH +A     H+P   +A L+GP+GG    E E   +  F     LGPR+LR++TA V
Sbjct: 170 --LHPVAAPLASHVPPSRLAFLVGPKGGLSDAEVEQAKAAGFHA-ARLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|148260870|ref|YP_001234997.1| hypothetical protein Acry_1876 [Acidiphilium cryptum JF-5]
 gi|146402551|gb|ABQ31078.1| protein of unknown function DUF558 [Acidiphilium cryptum JF-5]
          Length = 238

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 122/232 (52%), Gaps = 5/232 (2%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK- 63
           + L RL +  PL        S  Q HYL  V+R + GD +L+FN   GE+ + I  + + 
Sbjct: 2   ASLIRLHLPSPLSPGATLATSAAQAHYLGAVMRRRAGDPLLVFNAGSGEFAATIGALDRR 61

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
           +    +  ++R+   + D    F+P++ +  + +++K+ E+G+  + PV+T  TQ     
Sbjct: 62  AATLVLGARTRAPEPEPDCWLCFAPLRRDMTELVVEKATELGVSRLVPVLTARTQPARLR 121

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
            DR+      AAEQ + LT+P I  P  L   L  +  + ++  A E     ++   L  
Sbjct: 122 ADRLAAIATEAAEQSERLTIPDIAEPAPLAAFLAAFPPSRRLFVAAE----RHAAPPLSP 177

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
              +   A+L+GPEGG   EE + +    FV+P++LGPRILR++TAA+A +A
Sbjct: 178 ADPLQPHALLVGPEGGLAPEELDAMARHAFVSPVTLGPRILRAETAAIAGLA 229


>gi|149375982|ref|ZP_01893748.1| hypothetical protein MDG893_03350 [Marinobacter algicola DG893]
 gi|149359619|gb|EDM48077.1| hypothetical protein MDG893_03350 [Marinobacter algicola DG893]
          Length = 244

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 130/249 (52%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            + R++ D PL          +   ++  VLRM+ G  +LLFNG   ++ + I+  GK  
Sbjct: 2   RIPRIYTDSPLSEGATAGLDDNAAQHVGRVLRMQPGQELLLFNGDGNDYPATITEAGKKH 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +  +V   S + T +S ++ +      K +R+DY +QK+VEMG+  I P+ T    +   
Sbjct: 62  VSVEVGTPSANAT-ESHLEIVLGQTLSKGDRMDYAVQKAVEMGVTRIVPLTTERC-DVKL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGS 174
             DR        ++  ISAAEQC    +P I P  TL E+   + D + ++V    T  S
Sbjct: 120 KGDREDKRLRHWQSVAISAAEQCGRARVPEIVPVMTLSEWFENSGDCDLRLVLHHRTEQS 179

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L K         VA++IGPEGG   +E     +  F+ P++LGPR+LR++TA VAAM
Sbjct: 180 LNTLAKPT------RVALMIGPEGGLSPDEITAAANAGFL-PVALGPRVLRTETAPVAAM 232

Query: 235 ALVQAICGD 243
           AL Q + GD
Sbjct: 233 ALCQWLWGD 241


>gi|152984501|ref|YP_001345914.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PA7]
 gi|150959659|gb|ABR81684.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 240

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 122/246 (49%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLAL-GQHDLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELIEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+  D   ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPRIHPPLALEDWLRQRDDELRLVLHPVAA------ 175

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L + A   ++A L+GPEGG    E E   +  F +   LGPR+LR++TA V A+A+ Q
Sbjct: 176 -PLASHARPASLAFLVGPEGGLGDAEVEQAQAAGFHS-ARLGPRVLRTETAPVVALAVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|104783966|ref|YP_610464.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas entomophila
           L48]
 gi|95112953|emb|CAK17681.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 239

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +    +    Q HY+  VLRM  GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFIDAPLGLGEH-ELPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKKTV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R  ++     Q + S   ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVSLDQALPGQAESSLHVHLGQGLSRGERMDWAIQKATELGVNEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   ++P I+PP TL   +K  D + ++V            
Sbjct: 122 RADKRLAHWRQVAISACEQCGRSSVPVIHPPVTLAEWIKGSDADLKLVLHPVAA------ 175

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L + A    +A LIGPEGG +  E E   +  F     LGPR+LR++TA V A+++ Q
Sbjct: 176 -PLTSHAKPARLAFLIGPEGGLNDAEVEQAKAAGFHA-ARLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|107099405|ref|ZP_01363323.1| hypothetical protein PaerPA_01000417 [Pseudomonas aeruginosa PACS2]
          Length = 240

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 124/253 (49%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R FVD PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFVDQPLSL-GQHDLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKKNV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R ++  Q   Q       ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   +LP I+PP  LE  L+    + ++V            
Sbjct: 122 RADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRGDDLRLV------------ 169

Query: 179 EKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             LH +A     H P   +A L+GPEGG    E E   +  F +   LGPR+LR++TA V
Sbjct: 170 --LHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHS-ARLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|269958740|ref|YP_003328527.1| putative methyltransferase [Anaplasma centrale str. Israel]
 gi|269848569|gb|ACZ49213.1| putative methyltransferase [Anaplasma centrale str. Israel]
          Length = 243

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 115/224 (51%), Gaps = 8/224 (3%)

Query: 18  IKTQGKAS--GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSR 74
           I+T  + +    Q  Y+  V+R +  D +LLF+G  GEWL +IS + K ++  + E  SR
Sbjct: 19  IRTGARVTLNSSQARYVRDVMRARHDDAVLLFDGIRGEWLCRISCISKKTVEVEAETLSR 78

Query: 75  SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISA 134
              +   +   F+ +K++ +  +++++ EMG+   +P+ T Y+     +  +   + + A
Sbjct: 79  KHVRTRTLVLCFALVKSDTVRNVVRQATEMGVTLFQPIRTEYSSVHDVDSKKCHLWAVEA 138

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
           +EQC    +P + P      L +  +   Q V  DET G     E LH      +V +++
Sbjct: 139 SEQCGRQDVPEVAPVVDFRTLCEFHNPERQFVLCDETGGGRPPYEVLHGGR---DVWVVV 195

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           GPEGG+  EE     S  F   +SLGPRILR DTA V A+A V 
Sbjct: 196 GPEGGFSDEELRL--SENFCDKMSLGPRILRVDTAVVCALAHVN 237


>gi|157828086|ref|YP_001494328.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|157800567|gb|ABV75820.1| hypothetical protein A1G_01190 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 244

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 127/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 5   RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 65  VRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ ++  
Sbjct: 125 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSLLS 182

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 183 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 221


>gi|319717302|ref|YP_001649575.3| 16S ribosomal RNA methyltransferase RsmE [Rickettsia rickettsii
           str. Iowa]
 gi|165907873|gb|ABY72169.1| hypothetical protein RrIowa_0258 [Rickettsia rickettsii str. Iowa]
          Length = 257

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 127/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 18  RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 77

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 78  VRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 137

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ ++  
Sbjct: 138 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSLLS 195

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 196 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 234


>gi|292571762|gb|ADE29677.1| hypothetical protein rpr22_CDS160 [Rickettsia prowazekii Rp22]
          Length = 236

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 136/237 (57%), Gaps = 16/237 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D++ +FNG DGE+L++I+ +GK ++  
Sbjct: 5   RIYINSNLAENSKLELARDYVHYVKTVLRLKIHDSLRIFNGSDGEFLAQITQIGKNNLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            ++ Q +    +S +    + IK+++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 65  VLKEQLKKAYIESALTLAVAIIKSDKLMLTINMATQLGITKIIPLITRRCQFRTVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-HAIAH 186
               I A EQ + L  P I    TL+  LK   +N  I++A+E        EK+ H+I H
Sbjct: 125 MKCVIEATEQSERLNPPIIEQAITLKDYLK--KNNNLILYANEH-------EKVKHSILH 175

Query: 187 IP-----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           I      ++AI+IGPEGG+ ++E E L        +SLG  ILR++TAA++ ++ V+
Sbjct: 176 ISSLLSKDIAIIIGPEGGFTNDELELLALYNNTQSISLGSNILRTETAAISLISQVR 232


>gi|330994720|ref|ZP_08318643.1| Ribosomal RNA small subunit methyltransferase E [Gluconacetobacter
           sp. SXCC-1]
 gi|329758361|gb|EGG74882.1| Ribosomal RNA small subunit methyltransferase E [Gluconacetobacter
           sp. SXCC-1]
          Length = 246

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 104/203 (51%), Gaps = 8/203 (3%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY--I 85
           Q HYL  VLR + G  + +FN +DG+W   I ++ +  R ++    R++  ++ V    +
Sbjct: 29  QAHYLGAVLRQQAGGEVAVFNARDGQWQGVIDHLRRE-RCQIRLVERTRAPEATVGLGLL 87

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           F+P+K +  + +I+   E+G+    PV+T  T     N  R+ +    AAEQC+ L +P 
Sbjct: 88  FAPLKRDATETVIRMGTELGVTRFCPVVTERTNTHRLNAARLESIAREAAEQCERLDVPG 147

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEK 205
           I P   L  LL  W     +  A      E S  +  A        +LIGPEGG+ + E+
Sbjct: 148 IDPLVPLVNLLAQWPEGISLFAA-----LERSAPRPMAAPAQAGDCVLIGPEGGFSAREQ 202

Query: 206 ETLHSLPFVTPLSLGPRILRSDT 228
           + L +  FV P+SLG  +LR+DT
Sbjct: 203 DMLRARAFVRPVSLGSLVLRADT 225


>gi|229220790|ref|YP_153918.2| hypothetical protein AM686 [Anaplasma marginale str. St. Maries]
          Length = 243

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (52%), Gaps = 6/211 (2%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HY+  V+R K GD +LLF+G  GEWL ++S + K ++  + E   R   +   +   F
Sbjct: 31  QAHYVRDVMRAKHGDAVLLFDGTHGEWLCRVSCISKKTVEVEAEKLLRKHVRTRTLVLCF 90

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K   +  +++++ EMG+   +P+ T Y+     +  + R + + A+EQC    +P +
Sbjct: 91  ALVKGEAMRNVVRQATEMGVTLFQPMRTEYSSAHDIDSRKCRLWAVEASEQCGRQDVPEV 150

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            P      L +  + + Q V  DET G +   E L    +   V +++GPEGG+ +EE  
Sbjct: 151 APVVDFRTLRELHNPDRQFVLCDETGGGKPPREVLQ---NDREVWVIVGPEGGFSNEELC 207

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     F   +SLG RIL+ DTA V A+A V
Sbjct: 208 SCED--FCDKMSLGSRILKVDTAVVCALAYV 236


>gi|222475209|ref|YP_002563625.1| hypothetical protein AMF_516 [Anaplasma marginale str. Florida]
 gi|56388076|gb|AAV86663.1| hypothetical protein AM686 [Anaplasma marginale str. St. Maries]
 gi|222419346|gb|ACM49369.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (52%), Gaps = 6/211 (2%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HY+  V+R K GD +LLF+G  GEWL ++S + K ++  + E   R   +   +   F
Sbjct: 48  QAHYVRDVMRAKHGDAVLLFDGTHGEWLCRVSCISKKTVEVEAEKLLRKHVRTRTLVLCF 107

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K   +  +++++ EMG+   +P+ T Y+     +  + R + + A+EQC    +P +
Sbjct: 108 ALVKGEAMRNVVRQATEMGVTLFQPMRTEYSSAHDIDSRKCRLWAVEASEQCGRQDVPEV 167

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            P      L +  + + Q V  DET G +   E L    +   V +++GPEGG+ +EE  
Sbjct: 168 APVVDFRTLRELHNPDRQFVLCDETGGGKPPREVLQ---NDREVWVIVGPEGGFSNEELC 224

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     F   +SLG RIL+ DTA V A+A V
Sbjct: 225 SCED--FCDKMSLGSRILKVDTAVVCALAYV 253


>gi|255003188|ref|ZP_05278152.1| 16S ribosomal RNA methyltransferase RsmE [Anaplasma marginale str.
           Puerto Rico]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 111/211 (52%), Gaps = 6/211 (2%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HY+  V+R K GD +LLF+G  GEWL +IS + K ++  + E   R   +   +   F
Sbjct: 32  QAHYVRDVMRAKHGDAVLLFDGTHGEWLCRISCISKKTVEVEAEKLLRKHVRTRTLVLCF 91

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K   +  +++++ EMG+   +P+ T Y+     +  + R + + A+EQC    +P +
Sbjct: 92  ALVKGEAMRNVVRQATEMGVTLFQPMRTEYSSVHDIDSRKCRLWAVEASEQCGRQDVPEV 151

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            P      L +  + + Q V  DET G +   E L    +   V +++GPEGG+ +EE  
Sbjct: 152 APVVDFRTLRELHNPDRQFVLCDETGGGKPPREVLQ---NDREVWVIVGPEGGFSNEELC 208

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     F   +SLG RIL+ DTA V A+A V
Sbjct: 209 SCED--FCDKMSLGSRILKVDTAVVCALAYV 237


>gi|254995038|ref|ZP_05277228.1| 16S ribosomal RNA methyltransferase RsmE [Anaplasma marginale str.
           Mississippi]
          Length = 244

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (52%), Gaps = 6/211 (2%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HY+  V+R K GD +LLF+G  GEWL ++S + K ++  + E   R   +   +   F
Sbjct: 32  QAHYVRDVMRAKHGDAVLLFDGTHGEWLCRVSCISKKTVEVEAEKLLRKHVRTRTLVLCF 91

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K   +  +++++ EMG+   +P+ T Y+     +  + R + + A+EQC    +P +
Sbjct: 92  ALVKGEAMRNVVRQATEMGVTLFQPMRTEYSSAHDIDSRKCRLWAVEASEQCGRQDVPEV 151

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            P      L +  + + Q V  DET G +   E L    +   V +++GPEGG+ +EE  
Sbjct: 152 APVVDFRTLRELHNPDRQFVLCDETGGGKPPREVLQ---NDREVWVIVGPEGGFSNEELC 208

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     F   +SLG RIL+ DTA V A+A V
Sbjct: 209 SCED--FCDKMSLGSRILKVDTAVVCALAYV 237


>gi|255004318|ref|ZP_05279119.1| 16S ribosomal RNA methyltransferase RsmE [Anaplasma marginale str.
           Virginia]
          Length = 244

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (52%), Gaps = 6/211 (2%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIF 86
           Q HY+  V+R K GD +LLF+G  GEWL ++S + K ++  + E   R   +   +   F
Sbjct: 32  QAHYVRDVMRAKHGDAVLLFDGTHGEWLCRVSCISKKTVEVEAEKLLRKHVRTRTLVLCF 91

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           + +K   +  +++++ EMG+   +P+ T Y+     +  + R + + A+EQC    +P +
Sbjct: 92  ALVKGEAMRNVVRQATEMGVTLFQPMRTEYSSAHDIDSRKCRLWAVEASEQCGRQDVPEV 151

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKE 206
            P      L +  + + Q V  DET G +   E L    +   V +++GPEGG+ +EE  
Sbjct: 152 APVVDFRTLRELHNPDRQFVLCDETGGGKPPREVLQ---NDREVWVIVGPEGGFSNEELC 208

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     F   +SLG RIL+ DTA V A+A V
Sbjct: 209 SCED--FCDKMSLGSRILKVDTAVVCALAYV 237


>gi|167036024|ref|YP_001671255.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida GB-1]
 gi|166862512|gb|ABZ00920.1| protein of unknown function DUF558 [Pseudomonas putida GB-1]
          Length = 239

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 123/254 (48%), Gaps = 33/254 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+L ++  VG K++
Sbjct: 3   LSRFFIDAPLSLGEHDLPEA-QAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKKTV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY 116
           R  ++   ++ T Q+D     SP+         +  R+D+ IQK+ E+G   I P+++  
Sbjct: 62  RVSLD---QALTGQAD-----SPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSER 113

Query: 117 T------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE 170
                  +     +   R   ISA EQC   TLP I+PP  L   L +   + ++V    
Sbjct: 114 CEVRLKDERADKRLAHWRQVAISACEQCGRSTLPVIHPPVPLTEWLSSTQADLKLVL--- 170

Query: 171 TCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
                   E L + A    +A LIGPEGG    E E   +  F     LGPR+LR++TA 
Sbjct: 171 ----HPVAEPLTSHAKPAGLAFLIGPEGGLSEAEVEQAKAAGFHA-ARLGPRVLRTETAP 225

Query: 231 VAAMALVQAICGDW 244
           V A+++ Q + GD+
Sbjct: 226 VVALSVAQQLWGDF 239


>gi|90020116|ref|YP_525943.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
 gi|89949716|gb|ABD79731.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
          Length = 241

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 121/246 (49%), Gaps = 15/246 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R+++D P+         G   HYL  VLRM+ G  ++LFNGK GE+ + I   GK  
Sbjct: 2   RIPRIYIDKPITANANLDLDGPTAHYLLKVLRMESGRELILFNGKGGEYSAVIESAGKKN 61

Query: 66  RF-KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            F KV ++ +R        +      + +R+D+++QK+ E+G+  I P+    +      
Sbjct: 62  VFCKVGKHNTRESESSLQTELAIGISRGDRMDWVLQKATELGVSRIIPLFADRSEVKLKG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     M   +   ISA EQC   TLP + P   L+  L +     + V    T      
Sbjct: 122 ERLEKKMQHWQQILISACEQCTRNTLPTLLPACPLDEYLASTQAEQKFVLHHRTH----- 176

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            +KL  I    + A+LIGPEGG    E +      F   L+LGPRILR++TA +AA++++
Sbjct: 177 -KKLRDITKPKSAALLIGPEGGLTDNEIQNAERKGF-NALALGPRILRTETAPIAALSIL 234

Query: 238 QAICGD 243
           Q + GD
Sbjct: 235 QFVWGD 240


>gi|51473368|ref|YP_067125.1| hypothetical protein RT0159 [Rickettsia typhi str. Wilmington]
 gi|51459680|gb|AAU03643.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 240

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 131/231 (56%), Gaps = 4/231 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R++++  L   ++ +   D  HY+  VLR+K  D++ +FNG DGE+L+ I+ +GK+ I  
Sbjct: 5   RIYINSHLAENSKIELVRDNVHYVKTVLRLKINDSLRIFNGSDGEFLAHITKIGKNNISV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q +    +  +    + IK+++L  +I  + ++G+  I P+IT   Q    N++R+
Sbjct: 65  VLTEQLKKAYIEPALTLAVAIIKSDKLMLIINMATQLGITKIIPLITSRCQFKTVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + L  P I    TL+  LK   +N  I++A+E    +NS+ ++ ++   
Sbjct: 125 IKCVIEATEQSERLNPPIIEHAITLKDYLK--KNNNLILYANEHEKVKNSILRISSLLA- 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            ++AI+IGPEGG+ ++E E L        +SLG  ILR++TAA+  +A V+
Sbjct: 182 NDIAIIIGPEGGFTNDELELLALYKNTQSISLGSNILRTETAAITVIAQVR 232


>gi|325273070|ref|ZP_08139378.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas sp. TJI-51]
 gi|324101804|gb|EGB99342.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas sp. TJI-51]
          Length = 239

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 116/246 (47%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+   +  VG K++
Sbjct: 3   LSRFFIDAPLSLGEHDLPEA-QAHYVGRVLRMAPGDAVQLFDGSGQEYRGHLLEVGKKTV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R  ++     Q       ++   + +  R+D+ IQK+ E+G  AI P+I+         +
Sbjct: 62  RVSLDQAFAGQADSPLHIHLGQGLSRGERMDWAIQKATELGANAITPIISERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   TLP I PPTTL   L +     ++V            
Sbjct: 122 RADKRLAHWRQVAISACEQCGRSTLPAINPPTTLAEWLSSTHAELKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A    +A LIGPEGG    E E      F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLTSHARPATLAFLIGPEGGLGDAEVEQAQRAGFQA-ARLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|312963582|ref|ZP_07778063.1| hypothetical protein PFWH6_5505 [Pseudomonas fluorescens WH6]
 gi|311282091|gb|EFQ60691.1| hypothetical protein PFWH6_5505 [Pseudomonas fluorescens WH6]
          Length = 239

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 119/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F D PL +    +    Q HY++ VLRM EGD + LF+G   E+L  +  VGK  R
Sbjct: 3   LSRFFTDTPLSLGDH-ELPEAQAHYISRVLRMGEGDAVQLFDGSGQEFLGTLLEVGKK-R 60

Query: 67  FKVEYQSRSQTKQSDVQYIF---SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+       +     +I       +  R+D+ IQK+ E+G+ AI P+ +         
Sbjct: 61  VTVQLTQHFAGQAESPLHIHLGQGLSRGERMDWAIQKATELGVNAITPIFSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     +   R   ISA EQC   T+P I+PP  L   LK  + + ++V           
Sbjct: 121 ERADKRLLHWRQVAISACEQCGRSTVPVIHPPLLLADWLKQTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E + + A   ++A LIGPEGG    E ET     +     LGPR+LR++TA V A+A+ 
Sbjct: 174 AEPMVSHAKPSSLAFLIGPEGGLTDNEVETAQGAGYHAA-RLGPRVLRTETAPVVALAVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|70733090|ref|YP_262863.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           Pf-5]
 gi|68347389|gb|AAY94995.1| conserved hypothetical protein TIGR00046 [Pseudomonas fluorescens
           Pf-5]
          Length = 239

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 118/247 (47%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F+D PL +    +    Q HY+  VLRM EG  + +F+G   E+   +  VGK  R
Sbjct: 3   LSRFFIDAPLSLGEH-ELPEAQAHYIGRVLRMAEGAALQVFDGSGTEFRGALVEVGKK-R 60

Query: 67  FKVEYQSRSQTKQSDVQYIF---SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            +V+       +Q     I       +  R+D+ IQK+ E+G+  I P+ +   +     
Sbjct: 61  VRVQLNESFAGQQESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPIFSERCEVRLKD 120

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 +   R   ISA EQC    +P I+PP  L   +K    + ++V           
Sbjct: 121 ERADKRLLHWRQVAISACEQCGRSQVPVIHPPVLLADWIKQARADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            + L + A   ++A LIGPEGG    E E  HS  F+ P  LGPR+LR++TA V A+A+ 
Sbjct: 174 AQPLESHAKPASLAFLIGPEGGLTDAEVELSHSAGFL-PARLGPRVLRTETAPVVALAVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|126665848|ref|ZP_01736829.1| hypothetical protein MELB17_04747 [Marinobacter sp. ELB17]
 gi|126629782|gb|EBA00399.1| hypothetical protein MELB17_04747 [Marinobacter sp. ELB17]
          Length = 244

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 132/251 (52%), Gaps = 22/251 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++ D PL      +   +   ++  VLRM+ G  + LFNG   ++ + I+   K +
Sbjct: 2   RIPRIYTDTPLQAGADAQLDDNAAQHVGRVLRMQPGQALSLFNGDGQDYRALIASASKKN 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +  +VE Q  + + +S ++ +      K +R+DY +QK+ EMG+  I P+ T    +   
Sbjct: 62  VTVQVE-QPTANSSESALEIVLGQTLSKGDRMDYAVQKATEMGVTRIVPLSTERC-DVRL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGS 174
             DR        R+  ISAAEQC    +P I P   + E+L  +   + ++V    T  S
Sbjct: 120 KGDREDKRLSHWRSVAISAAEQCGRARVPDILPVMNITEWLEYSQRCDVRLVLHHRTEQS 179

Query: 175 ENSLEKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            +SL K       PN VA++IGPEGG  ++E        F+ P++LGPR+LR++TA VAA
Sbjct: 180 LDSLAK-------PNSVALMIGPEGGLSADEIAQAEKSGFL-PIALGPRVLRTETAPVAA 231

Query: 234 MALVQAICGDW 244
           MAL Q + GD+
Sbjct: 232 MALCQWLWGDF 242


>gi|67459503|ref|YP_247127.1| hypothetical protein RF_1111 [Rickettsia felis URRWXCal2]
 gi|67005036|gb|AAY61962.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 240

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 121/218 (55%), Gaps = 3/218 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D + +FNG DGE+L++I+Y+GK  +  
Sbjct: 5   RIYINSHLAENSKIELANDHVHYVKTVLRLKVNDGLRIFNGTDGEFLAQITYIGKHKLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 65  RLKEQLKKPYTESALTLAAAIIKQDKLMLAINMATQLGITKIIPLITRRCQFRTINIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ +    
Sbjct: 125 TKCVIEATEQSERLTPPIIEKAITIQDYLK--QNNNLMLYANEHEKEENSILRILSSLSN 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            ++ I+IGPEGG   +E   L S      +SLG  ILR
Sbjct: 183 SDITIIIGPEGGLTDDELGLLASYKNTKSVSLGNNILR 220


>gi|237747297|ref|ZP_04577777.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378648|gb|EEO28739.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 243

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 136/248 (54%), Gaps = 25/248 (10%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLF DFPL +        D   ++  V+R+  G+ I LFNG+ GE+ ++I   G++ R
Sbjct: 1   MTRLFCDFPLAVGACLDLPKDTARHI-MVVRLSRGEAITLFNGQGGEYRARILETGRN-R 58

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIK----TNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
            + E  S S   + ++ Y  S ++      ++D++I+K+ E+G+  I P+ T+ +     
Sbjct: 59  VRAEIVSFS-PHEVELPYEISLVQGIPEAGKMDWIIEKAAELGVHRIVPLATQRSV-VRV 116

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF---ADETC 172
           N DR+       ++  +SA+EQC    L  I  P   +  L+N     +I+F   A  + 
Sbjct: 117 NADRIEKRLARWQSIVVSASEQCGRNRLLAIGQPVNFDAYLQNSPEPSKIMFSPRASHSL 176

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
            S  + +K HAI+      +LIGPEGG+ +EE+E L     VT LS+GPRILR++TA +A
Sbjct: 177 ASWATGQKPHAIS------LLIGPEGGFSAEEEE-LARQKGVTFLSMGPRILRTETAGLA 229

Query: 233 AMALVQAI 240
           A++ + AI
Sbjct: 230 AVSAINAI 237


>gi|296116281|ref|ZP_06834897.1| 16S ribosomal RNA methyltransferase RsmE [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977100|gb|EFG83862.1| 16S ribosomal RNA methyltransferase RsmE [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 247

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 111/225 (49%), Gaps = 7/225 (3%)

Query: 9   RLFVDF----PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           RLF+D     P+C     +   D+ HYL +VLR+  G  +++FN +DGEW + I  + + 
Sbjct: 6   RLFMDPQAFPPMCPDAVIRLEPDRAHYLGNVLRLSAGGRVVVFNARDGEWSATIEVLRRD 65

Query: 65  I-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
               ++ +  R          +F+P+K +  + +I+   E+G+    PVIT  T     N
Sbjct: 66  RGEIRLVHMDRPPRVTQGPGIMFAPLKRDATEMIIRMGTELGVECFYPVITERTNTHRLN 125

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
             R+      A+EQC+ L +P I P   +   + +   + Q+  A E    + + ++   
Sbjct: 126 EGRLSAIAREASEQCERLDVPAIAPIRPMMEAIAHAPTDMQLFVALERL--DPTAQESEV 183

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
               P  A+LIGPEGG+   E++ L   P    LSLGP +LR+DT
Sbjct: 184 PRACPGDALLIGPEGGFSPREQDFLRGRPATRLLSLGPLVLRADT 228


>gi|311695817|gb|ADP98690.1| ribosomal RNA small subunit methyltransferase E [marine bacterium
           HP15]
          Length = 244

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 131/253 (51%), Gaps = 28/253 (11%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++ +  L   +  +   +   ++  VLRM+ G  +LLFNG   ++ + IS   K  
Sbjct: 2   RIPRIYTNSALAQGSTAELDDNAAQHVGRVLRMQAGQELLLFNGDGNDYPATISSASKK- 60

Query: 66  RFKVEYQ---SRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
              VE Q     + T +S ++ +      K +R+DY +QK+VEMG+  I P+ T    + 
Sbjct: 61  --NVEVQVGTPEANTTESPLEIVLGQTLSKGDRMDYAVQKAVEMGVTRIVPLTTERC-DV 117

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETC 172
               DR        ++  ISAAEQC    +P I P  T+ E+L  + D   ++V    T 
Sbjct: 118 KLKGDREDKRLRHWQSVAISAAEQCGRARVPEILPVMTVSEWLEHSRDCEVRLVLHHRT- 176

Query: 173 GSENSLEKLHAIAHIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
             E++L+ +     IP   VA++IGPEGG   EE        F+ P++LGPR+LR++TA 
Sbjct: 177 --EHALKSI-----IPPERVALMIGPEGGLSPEEIAHAEKEGFL-PVALGPRVLRTETAP 228

Query: 231 VAAMALVQAICGD 243
           VAAMAL Q + GD
Sbjct: 229 VAAMALCQWLWGD 241


>gi|229593101|ref|YP_002875220.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           SBW25]
 gi|229364967|emb|CAY53089.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 239

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 123/253 (48%), Gaps = 31/253 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F D PL +    +    Q HY++ VLRM EGD + LF+G   E+L  +  VGK  R
Sbjct: 3   LSRFFTDTPLSLGDH-ELPEAQAHYISRVLRMGEGDAVQLFDGSGQEFLGSLLEVGKK-R 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYT 117
             V+  + S   Q++     SP+         +  R+D+ IQK+ E+G+ AI P+ +   
Sbjct: 61  VTVQL-TESVAGQAE-----SPLHIHLGQGLSRGERMDWAIQKATELGVNAITPIFSDRC 114

Query: 118 ------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET 171
                 +     +   R   ISA EQC   T+P I+PP  L   LK  + + ++V     
Sbjct: 115 EVRLKDERADKRLLHWRQVAISACEQCGRSTVPLIHPPLLLADWLKQTEADLKLVL---- 170

Query: 172 CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
                  E + + A   ++A LIGPEGG    E +      +     LGPR+LR++TA V
Sbjct: 171 ---HPVAEPMVSHAKPSSLAFLIGPEGGLTDAEVQAAQGAGYHAA-RLGPRVLRTETAPV 226

Query: 232 AAMALVQAICGDW 244
            A+A+ Q + GD+
Sbjct: 227 VALAVAQQLWGDF 239


>gi|229586410|ref|YP_002844911.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia africae ESF-5]
 gi|228021460|gb|ACP53168.1| Unknown [Rickettsia africae ESF-5]
          Length = 246

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 126/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 5   RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 65  VRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ +   
Sbjct: 125 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSSLS 182

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 183 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 221


>gi|34580836|ref|ZP_00142316.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262221|gb|EAA25725.1| unknown [Rickettsia sibirica 246]
          Length = 244

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 126/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 5   RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 65  VRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ +   
Sbjct: 125 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSSLS 182

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 183 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 221


>gi|89091936|ref|ZP_01164891.1| hypothetical protein MED92_07211 [Oceanospirillum sp. MED92]
 gi|89083671|gb|EAR62888.1| hypothetical protein MED92_07211 [Oceanospirillum sp. MED92]
          Length = 242

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--- 63
           + R +   PL  K++ + S +   +++  LRMK GD ++LFNG   E+L+++S V K   
Sbjct: 3   IPRFYDPQPLSEKSEIQLSDEVVQHVSRALRMKVGDQLILFNGNGVEYLAELSQVEKRKA 62

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
           S       QS S+T  + V    S  +  R+DY +QKS EMG+  I P+ +         
Sbjct: 63  SAHIVETIQSNSETPLT-VHIGQSLSRGERMDYAVQKSTEMGVHQITPLFSERCEVKLPE 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     ++  +   ISA EQ   +  P I  P  L+  L   D   ++V       SE  
Sbjct: 122 ERQAKRINHWQQIAISACEQSGRVNPPLIAKPENLKSWLAQQDAELKLVLHHH---SEMP 178

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L+++   +   +VA+LIGPEGG   +E E      F  PL+LGPR++R++TA VAA+ L+
Sbjct: 179 LQEMKPPS---SVALLIGPEGGLTEDEVELAQEFGF-KPLTLGPRVMRTETAPVAALTLL 234

Query: 238 QAICGD 243
             + GD
Sbjct: 235 NYLWGD 240


>gi|229301334|ref|NP_359847.2| hypothetical protein RC0210 [Rickettsia conorii str. Malish 7]
 gi|39932538|sp|Q92J59|RSME_RICCN RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
          Length = 244

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 126/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 5   RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 65  VRLKEQLKKPYTKSTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ +   
Sbjct: 125 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSSLS 182

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 183 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 221


>gi|157803384|ref|YP_001491933.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia canadensis
           str. McKiel]
 gi|157784647|gb|ABV73148.1| hypothetical protein A1E_01000 [Rickettsia canadensis str. McKiel]
          Length = 257

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 122/218 (55%), Gaps = 3/218 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D + +FNG DGE+L++I+ +GK+ +  
Sbjct: 5   RIYINSHLAENSKLELANDHIHYIKTVLRLKVNDGLRIFNGTDGEFLAQITDIGKNNLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           K++ Q +    +S +    + IK ++L   I  + ++G+  I P+IT+  Q    N+ R+
Sbjct: 65  KLKEQLKKPDTESALTLAVAIIKQDKLMLTINMATQLGITKIIPLITKRCQFRSVNIKRL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + L  P I     L+  LK   +N  +++A+E    ENS+ ++ ++ + 
Sbjct: 125 TKCMIEATEQSERLIPPIIEQAIKLQDYLK--KNNNLMLYANEYEKEENSILQITSLLNN 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            ++ I+IGPEGG+  +E + L S      +SLG  ILR
Sbjct: 183 SDIDIVIGPEGGFTIDELQLLASYKNTKSISLGSNILR 220


>gi|15619261|gb|AAL02748.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 257

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 126/219 (57%), Gaps = 4/219 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFNG DGE+L++I+ +GK+ + 
Sbjct: 18  RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLS 77

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 78  VRLKEQLKKPYTKSTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 137

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQ + LT P I    T++  LK   +N  +++A+E    ENS+ ++ +   
Sbjct: 138 LTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRISSSLS 195

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
             ++ I++GPEGG+ ++E E L S      +SLG  ILR
Sbjct: 196 NSDITIIVGPEGGFTNDELELLASYKNTKSISLGSNILR 234


>gi|26991662|ref|NP_747087.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida
           KT2440]
 gi|24986759|gb|AAN70551.1|AE016697_6 conserved hypothetical protein TIGR00046 [Pseudomonas putida
           KT2440]
 gi|313500961|gb|ADR62327.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 239

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+  ++  VG K++
Sbjct: 3   LSRFFIDAPLSLGEHDLPEA-QAHYIGRVLRMAPGDAVQLFDGSGQEYRGQLLEVGKKTV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R  ++     Q       ++   + +  R+D+ IQK+ E+G   I P+++         +
Sbjct: 62  RVSLDQAFAGQADSPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   TLP I+PP TL   L +   + ++V            
Sbjct: 122 RADKRLAHWRQVAISACEQCGRSTLPVIHPPVTLAEWLSSTKADLKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L +      +A +IGPEGG    E E   +  F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLISHEKPATLAFVIGPEGGLSEAEVEQAKAAGFHA-ARLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|189184337|ref|YP_001938122.1| hypothetical protein OTT_1430 [Orientia tsutsugamushi str. Ikeda]
 gi|189181108|dbj|BAG40888.1| hypothetical protein OTT_1430 [Orientia tsutsugamushi str. Ikeda]
          Length = 263

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 126/246 (51%), Gaps = 24/246 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R++   PL      K S +Q +Y+ +VLR K  D I +FN  +GE+L+ I +   K +
Sbjct: 6   LHRIYSSIPLSKAGTIKLSREQTNYIINVLRCKNNDKIRVFNELNGEYLAIIHHTNNKQV 65

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP-------IKTNRLDYMIQKSVEMGMGAIRPVITRYTQ 118
             ++  Q++   K+ D     SP       IK  R+  +I  + + G+  I P+I+ Y+Q
Sbjct: 66  LLQIINQTKVVEKEVDENN--SPLVLAQCIIKPERMARVIDMATQAGITNIVPIISEYSQ 123

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
           +  +N+++     I +  Q + LT+P +  P TL   L   +  C I+ A+E        
Sbjct: 124 HLKFNIEKYNKIIIESCRQSERLTMPILSSPVTLSHFLSQSNSGC-ILCANEQ------- 175

Query: 179 EKLHAIAHIP-----NVAILIGPEGGYHSEEKETLHSL-PFVTPLSLGPRILRSDTAAVA 232
           E++  I HIP       +ILIGPEGG+  +++  L      +  +S+G  +LRS+TAA+ 
Sbjct: 176 ERIQQIHHIPASILSKASILIGPEGGFSEQDQSILRKAGGLIKSISIGRNVLRSETAAIY 235

Query: 233 AMALVQ 238
            ++ +Q
Sbjct: 236 LLSQLQ 241


>gi|170719665|ref|YP_001747353.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida W619]
 gi|169757668|gb|ACA70984.1| protein of unknown function DUF558 [Pseudomonas putida W619]
          Length = 239

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 116/247 (46%), Gaps = 17/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
            L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+L ++  VG K+
Sbjct: 2   RLSRFFIDAPLSLGEHDLPEA-QAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKKT 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
           +R  ++     Q +     ++   + +  R+D+ IQK+ E+G   I P+++         
Sbjct: 61  VRVSLDQAVAGQAESPLHIHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     +   R   ISA EQC    LP I  P TL   +K  D + ++V           
Sbjct: 121 ERADKRLAHWRQVAISACEQCGRSILPIIRAPVTLGDWIKGSDADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +      +A LIGPEGG    E +      F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPARLAFLIGPEGGLSEAEVDQAKGAGF-QAARLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|148284290|ref|YP_001248380.1| hypothetical protein OTBS_0493 [Orientia tsutsugamushi str.
           Boryong]
 gi|146739729|emb|CAM79559.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 250

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 126/244 (51%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R++   PL      K S +Q +Y+ +VLR K  D I +FN  +GE+L+ I +   K +
Sbjct: 6   LHRIYSSIPLSKAGTIKLSREQANYIINVLRCKNNDQIRVFNELNGEYLAIIHHNNNKEV 65

Query: 66  RFKVEYQSRSQTKQSDVQ---YIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
             ++  Q++   K+ D      + +   IK  R+  +I  + ++G+  I P+I+ Y+Q+ 
Sbjct: 66  LLQIINQTKVVAKEVDANNSHLVLAQCIIKPERMARVIDMATQVGITNIVPIISEYSQHL 125

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
            +N ++     I +  Q + LT+P +  P TL   L   +  C I+ A+E        EK
Sbjct: 126 KFNTEKYNKIIIESCRQSERLTIPILSSPVTLLHFLSQSNSEC-ILCANEQ-------EK 177

Query: 181 LHAIAHIP-----NVAILIGPEGGYHSEEKETLHSL-PFVTPLSLGPRILRSDTAAVAAM 234
           +  I HIP       +ILIGPEGG+  +++  L      +  +S+G  +LRS+TAA+  +
Sbjct: 178 IQQIHHIPASILSKASILIGPEGGFSEQDQSILRKAGRLIKSISIGRNVLRSETAAIYLL 237

Query: 235 ALVQ 238
           + +Q
Sbjct: 238 SQLQ 241


>gi|237749444|ref|ZP_04579924.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380806|gb|EEO30897.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 242

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 125/243 (51%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLF DFPL + T      +   ++  VLR+ EG+ I+LFNG+ GE+ ++I  + ++ +
Sbjct: 1   MTRLFCDFPLVVGTNIDLPKETSRHI-QVLRLTEGNEIVLFNGEGGEYSARIISLDRT-K 58

Query: 67  FKVEYQSRSQTKQS---DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYT 117
             V+  SR   +     D+    +  +  ++D++I+K+VE+G   I+P      V+    
Sbjct: 59  TNVKILSRHDREVELPYDITLAQALPEAGKMDWIIEKAVELGAAGIQPLAAQRSVVRLNA 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 + R +T   +A+EQC   TL  I  P      + N     +++F      + + 
Sbjct: 119 DRAEKRLARWQTIVTAASEQCGRNTLMEISEPVAFNTFIDNSGGCLRVMFTPRATETLSG 178

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             +  A   I    I+IGPEGG+  EE+E L     V PLS+G RILR++TA +AA++ +
Sbjct: 179 WARKQAPQAI---TIMIGPEGGFSPEEEE-LAIQNGVIPLSMGSRILRTETAGMAAISAI 234

Query: 238 QAI 240
            AI
Sbjct: 235 NAI 237


>gi|77461509|ref|YP_351016.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           Pf0-1]
 gi|77385512|gb|ABA77025.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 239

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 118/246 (47%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L R F+D PL      +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  +
Sbjct: 3   LSRFFIDAPLSTGEH-ELPEAQAHYISRVLRMAEGDAVQLFDGSGHEFRGSLVEVGKKRV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
             +++ Q   Q +     ++   + +  R+D+ IQK+ E+G+  I P+ +         +
Sbjct: 62  VVQIDEQFAGQVESPLKIHLGQGLSRGERMDWAIQKATELGVTEITPIFSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC    +P I+PP  L   LK  +   ++V            
Sbjct: 122 RADKRLLHWRQVAISACEQCGRSRVPVIHPPVLLADWLKQTEAELKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A    +A LIGPEGG    E E   +  F     LGPR+LR++TA V A+A+ Q
Sbjct: 175 EPLVSHAKPSTLAFLIGPEGGLSDAEVEQAKAGGF-HAARLGPRVLRTETAPVVALAVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|148550061|ref|YP_001270163.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida F1]
 gi|148514119|gb|ABQ80979.1| protein of unknown function DUF558 [Pseudomonas putida F1]
          Length = 239

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 116/246 (47%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+  ++  VG K++
Sbjct: 3   LSRFFIDAPLSLGEHDLPEA-QAHYIGRVLRMAPGDAVQLFDGSGQEYRGQLLEVGKKTV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R  ++     Q       ++   + +  R+D+ IQK+ E+G   I P+++         +
Sbjct: 62  RVSLDQAFAGQADSPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   TLP I+PP  L   L +   + ++V            
Sbjct: 122 RADKRLAHWRQVAISACEQCGRSTLPVIHPPVPLAEWLSSTKADLKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L +      +A +IGPEGG    E E   +  F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLTSHEKPATLAFVIGPEGGLSEAEVEQAKAAGFHA-ARLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|325983172|ref|YP_004295574.1| ribosomal RNA small subunit methyltransferase E [Nitrosomonas sp.
           AL212]
 gi|325532691|gb|ADZ27412.1| Ribosomal RNA small subunit methyltransferase E [Nitrosomonas sp.
           AL212]
          Length = 248

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 119/230 (51%), Gaps = 11/230 (4%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV--EYQSRSQTKQSDV 82
           S +  H+   VLR+K G+ I +FNG  GE+ + I  + KS    +   Y    +     +
Sbjct: 20  SAENKHHATRVLRLKNGNPITIFNGLGGEFSAHIEAISKSSATVLIDAYHHTDRESPLSI 79

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
           +   +     ++D++IQKSVE+G+  I+PV T  +      + ++  +   +   ISA E
Sbjct: 80  ELAQAICINEKMDWIIQKSVELGITRIQPVFTARSIVHLSDERSYKRLQHWKKIIISACE 139

Query: 137 QCDILTLPFIYPPTTLEFLL--KNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
           QC    LP + P   L   L  K   H    V    +  + N L+ +   A   N+ ++I
Sbjct: 140 QCGRNCLPQVLPLIPLAEWLSQKKTSHCANDVHLMLSTRTTNGLKNISKPAADANITLVI 199

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GPEGG+ +EE+  +    F+ PL LG RILR+++AA+A +A +QA+ GD+
Sbjct: 200 GPEGGFTAEEETAISYSGFI-PLRLGKRILRTESAALATIAAMQALWGDY 248


>gi|83644376|ref|YP_432811.1| 16S ribosomal RNA methyltransferase RsmE [Hahella chejuensis KCTC
           2396]
 gi|83632419|gb|ABC28386.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 247

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 125/244 (51%), Gaps = 17/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R+F+D PL   +Q   +GDQ +Y+  VLRM+ GD   LF+G   ++  K+  VG+     
Sbjct: 5   RIFIDQPLDGLSQLTLTGDQANYVGRVLRMRPGDAFHLFSGDGRDFPVKVLAVGRRDVEV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
              +  +   +S ++     +  +  R+DY +QKS EMG+ A+ P+++   +    + +R
Sbjct: 65  ALSEPLAIEAESPLRVHLGQVLSRGERMDYAVQKSTEMGVTALTPLLSERCE-VRLDGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                   R  +ISA EQC    +P I   T LE  L++   + +++      G   +  
Sbjct: 124 QDKRWRHWRQVSISACEQCGRARVPDIGDVTPLESWLQSATADLKLILHP---GDARAWS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                A   +V +LIGPEGG+  EE        FV    LGPRILR++TA VAA+AL+Q 
Sbjct: 181 PAQPPA---SVCLLIGPEGGFTDEEVALAERHGFVH-APLGPRILRTETAPVAALALMQW 236

Query: 240 ICGD 243
           + GD
Sbjct: 237 LWGD 240


>gi|330812331|ref|YP_004356793.1| RNA methyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380439|gb|AEA71789.1| putative RNA methyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 239

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 120/246 (48%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L R F+D PL +    +    + HY+  VLRM EGD + +F+G   E+   ++ VGK  +
Sbjct: 3   LSRFFIDAPLSLGDH-ELPEAKAHYIGRVLRMAEGDAVQVFDGSGQEFRGTLAEVGKKRV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           R +++ Q   Q +     ++   + +  R+D+ IQK+ E+G+  I P+ +         +
Sbjct: 62  RVQLDEQFAGQPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPIFSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   R   ISA EQC   ++P I+PP  L   LK  +   ++V            
Sbjct: 122 RADKRLLHWRQVAISACEQCGRSSVPVIHPPLLLADWLKQTEAELRLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L +      +A LIGPEGG    E E   +  +     LGPR+LR++TA V A+A+ Q
Sbjct: 175 EPLVSHDKPSTLAFLIGPEGGLSDAEVEQAKTAGYHA-ARLGPRVLRTETAPVVALAVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|146284257|ref|YP_001174410.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas stutzeri
           A1501]
 gi|145572462|gb|ABP81568.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 238

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 117/248 (47%), Gaps = 20/248 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L R F+D PL +           HY+  VLR+  G  + LF+G   E+  ++  VGK  
Sbjct: 2   RLSRFFIDAPLSLGQHALPEASA-HYIGRVLRLSAGSAVQLFDGSGAEYRGELLEVGKKS 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                Y+  +   +S ++        +  R+D+ IQK+ E+G+  I P+I+   +    N
Sbjct: 61  VSVELYERLAGMPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPLISERCE-VRLN 119

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R        R   ISA EQC    LP I+ P TL    ++W      V AD       
Sbjct: 120 DERADKRLAHWRQIAISACEQCGRSVLPIIHAPVTL----RDWLD----VEADLKLVLHP 171

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             E L + A   ++A LIGPEGG    E E      F+ P  LGPR+LR++TA V A+++
Sbjct: 172 VAEPLASHAKPQSLAFLIGPEGGLSDSEVELASGQGFL-PARLGPRVLRTETAPVVALSV 230

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 231 AQQLWGDF 238


>gi|330501385|ref|YP_004378254.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas mendocina
           NK-01]
 gi|328915671|gb|AEB56502.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas mendocina
           NK-01]
          Length = 239

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 119/259 (45%), Gaps = 45/259 (17%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F+D PL +  Q +    Q HY+  VLR   GD + LF+G   E+L ++  VGK   
Sbjct: 3   LSRFFIDAPLSL-GQHELPEAQAHYIGRVLRHAVGDAVQLFDGSGQEYLGELIEVGKK-- 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTN---------RLDYMIQKSVEMGMGAIRPVITRYT 117
                  R + ++S      SP++ +         R+D+ IQK+ E+G   I P+++   
Sbjct: 60  -----SVRVELRESIAGLAESPLRIHLGQGLSRGERMDWAIQKATELGASEITPIVSTRC 114

Query: 118 ------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET 171
                 +     M   R   ISA EQC    LP I+ P  L+  L+  + + ++V     
Sbjct: 115 EVRLKDERADKRMAHWRQVAISACEQCGRSVLPLIHAPLELDAWLQQIEADLKLV----- 169

Query: 172 CGSENSLEKLHAIA-----HIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
                    LH +A     H P   +A LIGPEGG    E +      F     LGPR+L
Sbjct: 170 ---------LHPVAEPWVGHAPPRALAFLIGPEGGLSDAEVDQAKGAGFHAA-RLGPRVL 219

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA V A+++ Q + GD
Sbjct: 220 RTETAPVVALSVAQQLWGD 238


>gi|226942481|ref|YP_002797554.1| 16S ribosomal RNA methyltransferase RsmE [Azotobacter vinelandii
           DJ]
 gi|226717408|gb|ACO76579.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 239

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 119/247 (48%), Gaps = 17/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
            L R F+D PL +         Q HY+  VLR+  GD + LF+G   E+  ++  VG KS
Sbjct: 2   RLSRFFIDAPLALGLLDLPEA-QAHYIGRVLRLAPGDAVQLFDGSGREFRGELVEVGKKS 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           +R ++  Q     +     ++   + +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VRVELREQLPGLAESPLRIHLGQGLSRGERMDWAIQKATELGVAEITPLLSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     +   +   ISA EQC    LP I+PP  LE  LK  +   ++V           
Sbjct: 121 ERADKRLAHWQQIAISACEQCGRSVLPTIHPPAPLEDWLKGIEAELKLVL-------HPF 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L + A   ++A LIGPEGG  SE +             LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLASHARPASLAFLIGPEGGL-SETEVDAARRAGYRAARLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|92112185|ref|YP_572113.1| hypothetical protein Csal_0049 [Chromohalobacter salexigens DSM
           3043]
 gi|91795275|gb|ABE57414.1| 16S rRNA m(3)U-1498 methyltransferase [Chromohalobacter salexigens
           DSM 3043]
          Length = 242

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 116/221 (52%), Gaps = 15/221 (6%)

Query: 31  YLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSPI 89
           ++A  LR++EG  + LF+G+  E  ++I  VG+  +R ++   +    +     ++   I
Sbjct: 27  HVAGALRLREGAALRLFDGEGHEADAEIVAVGRREVRVRITAVTEGGAESPLAVHLGQAI 86

Query: 90  -KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
            K +R+DY IQK+ E+G+ AI P+ T +       +     +   +   +SA EQC    
Sbjct: 87  SKGDRMDYAIQKATELGVAAITPLYTEHGDVRLKGEREAKKLAHWQAVAVSACEQCGRSR 146

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           +P ++PP TL+  L   D   ++V    T  +       HA + +  VA+L+GPEGG   
Sbjct: 147 VPTVHPPQTLDAWLARRDETLRLVLHPSTDTTWR-----HA-SDVARVALLVGPEGGLSP 200

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            E +T  +  F   L+LGPRILR++TA V A+ L+Q   GD
Sbjct: 201 NEIDTARAADFAA-LTLGPRILRTETAPVVALTLLQYHFGD 240


>gi|327482639|gb|AEA85949.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas stutzeri DSM
           4166]
          Length = 238

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 118/248 (47%), Gaps = 22/248 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F+D PL +           HY+  VLR+  G  + LF+G   E+  ++  VGK   
Sbjct: 3   LSRFFIDAPLSLGQHALPEAS-AHYIGRVLRLSAGSAVQLFDGSGAEYRGELLEVGKK-S 60

Query: 67  FKVEYQSR-SQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
             VE   R +   +S ++        +  R+D+ IQK+ E+G+  I P+I+   +    N
Sbjct: 61  VSVELHERLAGMPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPLISERCE-VRLN 119

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R        R   ISA EQC    LP I+ P TL    ++W      V AD       
Sbjct: 120 DERADKRLAHWRQIAISACEQCGRSVLPIIHAPVTL----RDWLD----VEADLKLVLHP 171

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             E L + A   ++A LIGPEGG    E E      F+ P  LGPR+LR++TA V A+++
Sbjct: 172 VAEPLASHAKPQSLAFLIGPEGGLSDNEVELASGQGFL-PARLGPRVLRTETAPVVALSV 230

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 231 AQQLWGDF 238


>gi|146305452|ref|YP_001185917.1| hypothetical protein Pmen_0412 [Pseudomonas mendocina ymp]
 gi|145573653|gb|ABP83185.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudomonas mendocina ymp]
          Length = 241

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 118/246 (47%), Gaps = 19/246 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           L R F+D PL +  Q      Q HY+  VLR   GD + LF+G   E+L ++  VG KS+
Sbjct: 3   LSRFFIDAPLSL-GQHDLPEAQAHYIGRVLRHAVGDALQLFDGSGQEYLGELIEVGKKSV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R ++       ++     ++   + +  R+D+ IQK+ E+G   I P+++         +
Sbjct: 62  RVELREAIAGMSESPLRIHLGQGLSRGERMDWAIQKATELGAAEITPIVSARCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                M   R   ISA EQC    LP I PP  L   L+  + + ++V          S 
Sbjct: 122 RADKRMAHWRQVAISACEQCGRSVLPLINPPLELAAWLQQIEADLKLVL-HPVAAPLQSH 180

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +K       PN +A L+GPEGG    E +   +  F     LGPR+LR++TA V A+++ 
Sbjct: 181 DK-------PNSLAFLVGPEGGLSEAEVDQTKAAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGD 243
           Q + GD
Sbjct: 233 QQLWGD 238


>gi|297170744|gb|ADI21766.1| uncharacterized protein conserved in bacteria [uncultured gamma
           proteobacterium HF0130_22O14]
          Length = 246

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 134/251 (53%), Gaps = 25/251 (9%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            ++R  VD     K+  + +G+Q HY+  VLR++ GD ++LF+G   EW +KI    ++ 
Sbjct: 5   RIQRFHVDQIDNSKSHLEIAGEQSHYVTRVLRLQTGDRMILFDGSGSEWTAKIIDTKRN- 63

Query: 66  RFKVEYQSRSQTKQS---DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
           R  +E + R+   +    ++  I S  ++ R+D ++QKS E+G+  I PV   ++ NT  
Sbjct: 64  RLLLELEERATPDRESPINLTLIQSISRSQRMDLVMQKSTELGVTRIVPV---FSTNTIV 120

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEF-LLKNWDHNCQIVFADETC 172
             N D++       R   ISA+EQ     +P +  P  LE   LK +  +  I +  +T 
Sbjct: 121 KMNEDKIEKKINHWRNILISASEQSGRTKIPDLISPIQLETECLKRYKSDLSIFY--DTT 178

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           G ++     +   +  ++  +IGPEGG+  +EK+      ++  +  GPR+LR++TA + 
Sbjct: 179 GKDS-----YDANNPKDITAVIGPEGGFTEDEKQIAIDAGYMV-MQSGPRLLRTETAPIM 232

Query: 233 AMALVQAICGD 243
           A++++Q + GD
Sbjct: 233 ALSILQYLYGD 243


>gi|325295443|ref|YP_004281957.1| ribosomal RNA small subunit methyltransferase E [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065891|gb|ADY73898.1| Ribosomal RNA small subunit methyltransferase E [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 241

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 119/227 (52%), Gaps = 16/227 (7%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKV--EYQSRSQTKQSDV 82
           G +  +   VLR+++GD I++F+G+  E+L++I      S+R KV  E      +     
Sbjct: 18  GQEARHALKVLRLRKGDEIIIFDGEGREYLAEIEAASPTSVRLKVLEEININRDSHLKTT 77

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY------NMDRVRTYTISAAE 136
            Y+    K  + +  IQK+ E+G+  I PV+ + + N          + R     ++AA+
Sbjct: 78  LYMGLTNKLQKFELAIQKATELGVTEIIPVVCKRSSNAQNIKNWDNKLRRWEEIVVNAAK 137

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC    LP ++ P  L  +    ++N  ++F     G + SL+   + +   +V++++GP
Sbjct: 138 QCGRNILPIVHSPVKLPEI----ENNSDLLFVLWEKGGK-SLKDYESFSA-SSVSLIVGP 191

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG+  EE E L    F  P+ LG RILR++TAA+A M LVQ + GD
Sbjct: 192 EGGFDKEEIEILKEKGF-KPIYLGKRILRAETAAIAGMTLVQFLWGD 237


>gi|91205956|ref|YP_538311.1| hypothetical protein RBE_1141 [Rickettsia bellii RML369-C]
 gi|157826683|ref|YP_001495747.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia bellii OSU
           85-389]
 gi|91069500|gb|ABE05222.1| unknown [Rickettsia bellii RML369-C]
 gi|157801987|gb|ABV78710.1| hypothetical protein A1I_01600 [Rickettsia bellii OSU 85-389]
          Length = 234

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 117/218 (53%), Gaps = 5/218 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R++++  L    + +   D  HY+  VLR+K  D   +FNG DGE+L++I+ + ++ +  
Sbjct: 5   RIYINNHLAENIKLELGSDHTHYIKTVLRLKVNDQFRIFNGTDGEFLAQITKLDRNNLII 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            ++   R    +S +    S IK ++L   I  + ++G+  I  +IT   Q    N++R+
Sbjct: 65  TIQECLRKPRAESSLTLAMSIIKQDKLMLAINMATQLGVTKIVTLITERCQFRSVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I A EQ + L  P I P  +++  LK   +N  +++A+E    ENS+ KL+    I
Sbjct: 125 TKCVIEATEQSERLNPPVIEPAISIQNYLK--KNNNFVLYANEHEKEENSILKLNK--DI 180

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            N++I+IGPEGG+ ++E   L S      +SLG  ILR
Sbjct: 181 TNISIVIGPEGGFTNDEIALLASYKNAYSISLGKNILR 218


>gi|330964692|gb|EGH64952.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 239

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 121/246 (49%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  +
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKKRV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R ++      Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVQLNKCFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                    +   ISA EQC    +P I+PP TL   +K  + + ++V            
Sbjct: 122 RAEKRQAHWQQIAISACEQCGRSVVPVIHPPMTLADWIKLTEADLKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLTSHAKPVSLAFLIGPEGGLNDAEVDQAQTAGFHAA-RLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|213971885|ref|ZP_03399986.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato T1]
 gi|301385288|ref|ZP_07233706.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061292|ref|ZP_07252833.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato K40]
 gi|302131396|ref|ZP_07257386.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213923369|gb|EEB56963.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato T1]
          Length = 239

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 121/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            +V+   R   Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VRVQLTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+PP  L   +K  + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHAKPASLAFLIGPEGGLNDAEVDQAQNAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|158521743|ref|YP_001529613.1| hypothetical protein Dole_1732 [Desulfococcus oleovorans Hxd3]
 gi|158510569|gb|ABW67536.1| protein of unknown function DUF558 [Desulfococcus oleovorans Hxd3]
          Length = 245

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 124/248 (50%), Gaps = 15/248 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+D           +G   +++ +VLRMK GD I LFNG   E+   I  V  S  
Sbjct: 1   MRRFFIDAAAAAGAICPITGPDANHIKNVLRMKPGDAIWLFNGAGMEFKGVIHSV-DSEA 59

Query: 67  FKVEYQSR-SQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             VE     S   +S ++   +   +K  ++D +++++ E+G+    PV T+ T      
Sbjct: 60  VTVEITGAFSCATESPIRLTLAQAFLKDKKMDALVRQATELGVTRWIPVFTQRTIPRPDA 119

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL-KNWDHNCQIVFADETC-GSE 175
           +     M+R +     + +QC    LP I PP   E LL ++ D + +I+FAD    G  
Sbjct: 120 RRVSSRMERWQAIAAESLKQCGRGRLPEIEPPILFEDLLSRSDDWSLKIIFADAKAPGLN 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           ++L    A      V ++IGPEGG+  EE +      F+   SLGPRIL++DTA V A A
Sbjct: 180 DTLPSQEATVR--RVLVMIGPEGGFTPEEIDRAIKKGFIA-ASLGPRILKADTATVGACA 236

Query: 236 LVQAICGD 243
           +VQ + GD
Sbjct: 237 IVQHLLGD 244


>gi|28872189|ref|NP_794808.1| hypothetical protein PSPTO_5076 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855443|gb|AAO58503.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 239

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 121/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFSGTLLEVGKK-R 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            +V+   R   Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VRVQLTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+PP  L   +K  + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHAKPASLAFLIGPEGGLNDAEVDQAQNAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|330878069|gb|EGH12218.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 239

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 119/246 (48%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  +
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKKRV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R ++      Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         +
Sbjct: 62  RVQLTECFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                    +   ISA EQC    +P I+PP  L   +K  D + ++V            
Sbjct: 122 RAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTDADLKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A   ++A LIGPEGG +  E     +  F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLTSHARPASLAFLIGPEGGLNDAEVHQAQTAGFHAA-RLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|238651023|ref|YP_002916879.1| 16S rRNA m3U1498 methyltransferase [Rickettsia peacockii str.
           Rustic]
 gi|238625121|gb|ACR47827.1| 16S rRNA m3U1498 methyltransferase [Rickettsia peacockii str.
           Rustic]
          Length = 244

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 125/220 (56%), Gaps = 6/220 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           R++++  L   ++ + + D + HY+  VLR+K  D + LFN  DGE+L++I+ +GK+ + 
Sbjct: 5   RIYINSRLAENSKIELASDHHVHYVKTVLRLKVNDGLRLFNSTDGEFLAQINDIGKNNLS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR+ Q    N++R
Sbjct: 65  VRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRWCQFRSVNIER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           +    I A EQ + LT P I    T++ +L KN +    +++A+E    ENS+ ++ +  
Sbjct: 125 LTKCVIEATEQSERLTPPIIEKAITIQDYLKKNKN---LMLYANEHEKEENSILRISSSL 181

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
              ++ I++GPEGG+ ++E E L S      + LG  ILR
Sbjct: 182 SNSDITIIVGPEGGFTNDELELLASYKNTKSIILGSNILR 221


>gi|330957011|gb|EGH57271.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 239

 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 120/246 (48%), Gaps = 17/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  +
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGLEFRGTLLEVGKKRV 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R ++      Q +     ++   + +  R+D+ IQK+ E+G+  I P+I+         +
Sbjct: 62  RVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIISERCEVRLKDE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                    +   ISA EQC    +P I+PP  L   ++  + + ++V            
Sbjct: 122 RAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIRLTEADLKLVL-------HPVA 174

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ Q
Sbjct: 175 EPLTSHAKPASLAFLIGPEGGLNEAEVDQAQTAGFHAA-RLGPRVLRTETAPVVALSVAQ 233

Query: 239 AICGDW 244
            + GD+
Sbjct: 234 QLWGDF 239


>gi|289209554|ref|YP_003461620.1| hypothetical protein TK90_2394 [Thioalkalivibrio sp. K90mix]
 gi|288945185|gb|ADC72884.1| protein of unknown function DUF558 [Thioalkalivibrio sp. K90mix]
          Length = 255

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 122/242 (50%), Gaps = 9/242 (3%)

Query: 10  LFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFK 68
           L  D  L       AS D+ HY  +VLR+K      +F+G+  E+ +++   G+ S  F 
Sbjct: 7   LINDTDLAAGQSIPASQDRLHYATNVLRLKNDAACRVFDGQGNEFHARLEVTGRRSGTFH 66

Query: 69  VEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT--HYNMD 125
           +  ++ + T  +  ++ +    + + +D  +QK+VE+G+  IRPV+   +++   H  +D
Sbjct: 67  LGDRAAAPTTPARPIELLQGIARGDHMDLAVQKAVELGISVIRPVLCERSRSAAAHRGLD 126

Query: 126 RVRTY----TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
           + + +      +AAEQC    LP + PP TL+  L        +V  ++      +L+  
Sbjct: 127 KRQAHWAGIIQAAAEQCGRNELPLLVPPATLDEALDASSPGLDLVADEQGPPLSGALDSF 186

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
                   V ILIGPEGG   EE+    +  F   +++GPR LR++TAA++ + LVQ   
Sbjct: 187 GKGGTSGRVRILIGPEGGLTDEERIQARNAGFQA-VAMGPRTLRTETAAISLLTLVQWRL 245

Query: 242 GD 243
           GD
Sbjct: 246 GD 247


>gi|166712896|ref|ZP_02244103.1| hypothetical protein Xoryp_15990 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 244

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 126/248 (50%), Gaps = 16/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL  + +   S +  ++L  VLR+++GD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCEQEVALSEESANHLLRVLRLRQGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERVEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSEN 176
             T   +   R+  +SA EQ     LP +  P  L+   +  D H  ++    +    E+
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVATPLGLQDAAQASDTHALRLTLDPQ---GEH 178

Query: 177 SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            L  L   + IP ++ + IGPEGG+   ++ TL    F + L LGPRILR++TA +AA+A
Sbjct: 179 RLGTL--ASSIPQHIVVAIGPEGGWSPRDRATLAEAGF-SGLQLGPRILRTETAGLAAIA 235

Query: 236 LVQAICGD 243
            +Q+  GD
Sbjct: 236 ALQSRFGD 243


>gi|239948513|ref|ZP_04700266.1| ribosomal RNA small subunit methyltransferase E [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922789|gb|EER22813.1| ribosomal RNA small subunit methyltransferase E [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 298

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 141/283 (49%), Gaps = 51/283 (18%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++++  L   ++ + +GD  HY+  VLR+K  D + +FNG DGE+L++I+ +GK ++  
Sbjct: 5   RIYINSRLAENSKLELAGDHVHYVKTVLRLKVNDGLRIFNGMDGEFLAQITDIGKHNLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++ Q +    +S +    S IK ++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 65  RLKEQLKKPYTESTLILAISIIKQDKLMLAINMATQLGITKIIPLITRRCQFRSVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS-LEKLHAIAH 186
               I A EQ + LT P I    T++  LK   +N  +++A+E    ENS L  L ++++
Sbjct: 125 TKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEENSILRILSSLSN 182

Query: 187 I-----------------------------------------------PNVAILIGPEGG 199
           I                                                ++ I++GPEGG
Sbjct: 183 IYSCEMKRGYTKNNLEKSKESVSRGAERILIREHLRTYKDDVANFSSSSSITIIVGPEGG 242

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           + ++E E L S      +SLG  ILR++TAA+ A+A V+  CG
Sbjct: 243 FTNDELELLASYKNTKSISLGSNILRAETAAITAIAQVRLWCG 285


>gi|88608373|ref|YP_505938.1| hypothetical protein NSE_0036 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600542|gb|ABD46010.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 227

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 120/217 (55%), Gaps = 26/217 (11%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV-EYQSRSQTKQS--DVQYIF 86
           HYL  V+R+++   +++FNG+ GEW++K+++      F V + Q R QT     D+   F
Sbjct: 22  HYLFSVMRLQKEGQVIVFNGRSGEWIAKVNH-----NFLVPDIQIRPQTASYPYDINLCF 76

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFI 146
           +  K   L  +++++ E+ +  +RP+ +  T+N + +++++  + I AA+QC  +++P +
Sbjct: 77  AVPKHKALKEIVRQATELDVTVLRPIYSSRTENKNKDLEKLELWAIEAAQQCRRMSIPVL 136

Query: 147 YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA---ILIGPEGGYHSE 203
            PP  L+  ++ +  N  +   DET            I  IP ++   I+IGPEGG+  E
Sbjct: 137 LPPIALKE-VETYHEN--VFICDETLSDS-------VICDIPILSSYTIVIGPEGGFSHE 186

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           E   ++       +SLG  ILR  TAA +A+A V+++
Sbjct: 187 ELSLINKR-----ISLGRTILRCSTAATSAIAQVRSV 218


>gi|331007217|ref|ZP_08330426.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC1989]
 gi|330418984|gb|EGG93441.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC1989]
          Length = 257

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 129/271 (47%), Gaps = 47/271 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFN-----GKDGEWLSKISY 60
           H+ R+++  PL   TQ +      H+L  V+RMK G  ++LFN     G+ GE+ + ++ 
Sbjct: 2   HIPRIYIPLPLSEHTQIELDKASMHHLVTVMRMKVGRQVILFNNVPIDGRYGEFTATLAS 61

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSP---------IKTNRLDYMIQKSVEMGMGAIRP 111
           V K        Q+R    +     I SP         IK +R+D+++QK+ E+G+  I P
Sbjct: 62  VDKK-------QARVDIGEFVSPQIESPLQVHLGACLIKNDRMDWLLQKATELGVSEITP 114

Query: 112 VITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE------------ 153
           + ++YT      +     M   R   I+A EQ   + LP ++ P  LE            
Sbjct: 115 LFSQYTDVKLPAERIEKKMGHWRKIVINACEQSGRVRLPVLHTPLALEKWVASSTHVRQK 174

Query: 154 FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPF 213
           F+L  +  +     AD     E+SL      + I  +A+L+GPEGG   +E +      F
Sbjct: 175 FVLHPYASSSPHTSADRP--QESSLS-----SDINAIALLVGPEGGLTEDEVDLAVQSQF 227

Query: 214 VTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              + LGPRILR++TA + A+A++    GD+
Sbjct: 228 -KGMRLGPRILRAETAPLVALAVLSQQLGDF 257


>gi|307824730|ref|ZP_07654953.1| protein of unknown function DUF558 [Methylobacter tundripaludum
           SV96]
 gi|307734088|gb|EFO04942.1| protein of unknown function DUF558 [Methylobacter tundripaludum
           SV96]
          Length = 253

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 128/252 (50%), Gaps = 25/252 (9%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
            + RL+   PL      +   D  HY+  VLR+K+  +I+LFNG  GE+L  ++ V  K+
Sbjct: 2   RVSRLYTSAPLATGKLIELDDDNGHYVRTVLRLKKDAHIILFNGHGGEYLCTVAEVSRKA 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
           +   V ++  RS      +       + +R+D  +QK+VE+G+  I P++T         
Sbjct: 62  VLIDVGQWSDRSVESPLQITLGLGISRGDRMDLTVQKAVELGVNHITPLLTERCVVQFKG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQ--IVFAD---ETC 172
           +     +   +     AAEQ    +LP   P   +E  L+NW  N Q   VF D   ET 
Sbjct: 122 EKKPQRLLHWQKIVQHAAEQSGRTSLP---PLLEVE-QLQNWLGNQQGLKVFLDPYAETT 177

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
            SE   E +        V +L GPEGG+ ++E++   +  F+ P+ LG RILR++TA++A
Sbjct: 178 LSELKPETM-------KVTLLTGPEGGFSNQERDAAKASGFI-PVRLGSRILRTETASLA 229

Query: 233 AMALVQAICGDW 244
           A+A VQ + GD+
Sbjct: 230 ALAAVQMLWGDF 241


>gi|53802677|ref|YP_112559.1| hypothetical protein MCA0018 [Methylococcus capsulatus str. Bath]
 gi|53756438|gb|AAU90729.1| conserved hypothetical protein TIGR00046 [Methylococcus capsulatus
           str. Bath]
          Length = 243

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 123/247 (49%), Gaps = 17/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + RL++  PL         G++ HYL  VLR+K G ++ +FNG+ GE+ ++I    +  
Sbjct: 2   RISRLYLPVPLASGADVVLDGERAHYLRTVLRLKRGFDLTVFNGEGGEFAARIGVCHREA 61

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                   R   ++S  DV+      +  R+D  IQK+VE+G+GAI P+ T         
Sbjct: 62  VSLTVGAHRPDDRESRLDVRLGLGISRGERMDLAIQKAVELGVGAITPLFTERCVVQLDG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     ++  R    +A EQ     +P +  P +LE  L               C   ++
Sbjct: 122 ERKAQRLEHWRRVVWAACEQSGRNRVPEVLEPRSLEAWLPE-------AAGLRICLDPHA 174

Query: 178 LEKLHAIA-HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +  L  +A  + +V +L GPEGG+   E++   +  FV P+ LGPR+LR++TAA+AA+A 
Sbjct: 175 VHGLRELAPPVGSVTLLSGPEGGFSDAERDMAVAAAFV-PIRLGPRVLRTETAALAALAA 233

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 234 IQTLWGD 240


>gi|56461316|ref|YP_156597.1| 16S ribosomal RNA methyltransferase RsmE [Idiomarina loihiensis
           L2TR]
 gi|56180326|gb|AAV83048.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 243

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 121/247 (48%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    + ++ + + S D + +L  VLR+  GD+I+LFNG    + +KI+ V K  
Sbjct: 2   RVPRIYHPASISLQNETELSADAFQHLIKVLRLNVGDSIVLFNGDGQNYEAKITSVQKKS 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
              V   S++   +S V    + +  + +R+D+++QKSVE+G+  I P+ +        +
Sbjct: 62  AQFVATSSQANASESPVNIHLAQVVSRGDRMDFVLQKSVELGVTEITPLFSERC-GVKLS 120

Query: 124 MDRVRTYTI-------SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            DR+    +       SA EQC    +P + P   L   + +     ++          +
Sbjct: 121 GDRLEKKQLQWQKIVHSACEQCGRSVVPQVKPAQQLTDFIASSFEGLRLTLDPTATQPLS 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S ++         + +LIGPEGG+   E      L F  P+ LGPRILR++TAA++A+  
Sbjct: 181 SFQQAEK-----GIQLLIGPEGGFTDTEVSAAGQLGF-KPMRLGPRILRTETAALSALTA 234

Query: 237 VQAICGD 243
           VQ   GD
Sbjct: 235 VQYQFGD 241


>gi|71898620|ref|ZP_00680790.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|71731567|gb|EAO33628.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
          Length = 244

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 123/250 (49%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++   G+  
Sbjct: 2   RLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRRE 61

Query: 65  ----IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
               I    E  + S    + VQ I    +  ++D ++QK+ E+G+ AI PV T  +   
Sbjct: 62  AWARIEGVSEVCNESPLAITLVQAI---TRGEKMDLIVQKATELGVVAIVPVDTERS-GV 117

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
             + +RV           ISA EQC    +P +  P  L+ L +  D +   +  D    
Sbjct: 118 RLDSERVAKRLAHWNNVVISACEQCGRTRVPEVQMPCALQVLPEILDPDTLRLILDPK-- 175

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           SE+ L  L  +  +  V I IGPEGG+   + E L    F+   SLGPRILR++TA + A
Sbjct: 176 SEHRLSTLSRLTPV-EVTIAIGPEGGWSPRDLEILKDAGFIG-FSLGPRILRTETAGLTA 233

Query: 234 MALVQAICGD 243
           +A++QA  GD
Sbjct: 234 IAVLQAQLGD 243


>gi|302389476|ref|YP_003825297.1| protein of unknown function DUF558 [Thermosediminibacter oceani DSM
           16646]
 gi|302200104|gb|ADL07674.1| protein of unknown function DUF558 [Thermosediminibacter oceani DSM
           16646]
          Length = 256

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 119/233 (51%), Gaps = 19/233 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV---GKSIRFKVEYQSRSQTKQSD 81
           SG+  H++A VLRM +GD + L NG D     +I  +    + I+ KV  +++ + ++  
Sbjct: 19  SGEDAHHIARVLRMGKGDLLSLSNGLDALGTGQILELFPEDRKIKVKVIEKNKFEPRRPR 78

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
           +    S  K  + D ++QK+ E+G+    PVIT  T      ++     +R R  T  AA
Sbjct: 79  ITLFQSVPKGQKFDLILQKNTELGVSEFVPVITERTVVEIEGESKSKKAERWRKITKEAA 138

Query: 136 EQCDILTLPFIYPPTTLEF---LLKNWDHNCQIVFADETCGSENSLEKL--HAIAHIPNV 190
           +QC    LP +  P + +    LLKN+    +IV        E  L+ +  +    +P++
Sbjct: 139 KQCRRPDLPVVREPVSFDGCLELLKNY----RIVLVPWEGEREVFLKSILSNVPPDVPDI 194

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           A+LIGPEGG+  +E E       VT +SLGPRILR++TA     A++    GD
Sbjct: 195 AVLIGPEGGFSVQEIERARKSGAVT-VSLGPRILRTETAGFVVTAVLMYELGD 246


>gi|325914126|ref|ZP_08176479.1| hypothetical protein TIGR00046 [Xanthomonas vesicatoria ATCC 35937]
 gi|325539629|gb|EGD11272.1| hypothetical protein TIGR00046 [Xanthomonas vesicatoria ATCC 35937]
          Length = 244

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 125/256 (48%), Gaps = 32/256 (12%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLRCDQEVTLPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGK-- 59

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTN---------RLDYMIQKSVEMGMGAIRPVITRY 116
                 ++R+  +++D+    SP++           ++D ++QK+ E+G+ AI PV    
Sbjct: 60  -----REARALIERADMLSNESPLRITLLQGIARGEKMDLILQKATELGVTAIVPV---N 111

Query: 117 TQNTHYNMD------RV---RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF 167
            + T   +D      RV   R   +SA EQ     +P +  P  L+   +  D   + + 
Sbjct: 112 AERTEVKLDAARMEKRVAHWRNVVVSACEQSGRARVPTVAAPLGLQEAAQTSDPQVRRLT 171

Query: 168 ADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
            D     E+ L  L A      + + IGPEGG+   ++ TL    F T L LGPRILR++
Sbjct: 172 LDPQ--GEHRLSTLRADVE-QGLIVAIGPEGGWSPRDRATLADAGF-TGLQLGPRILRTE 227

Query: 228 TAAVAAMALVQAICGD 243
           TA +AA+A +QA  GD
Sbjct: 228 TAGLAAIAALQARFGD 243


>gi|197334623|ref|YP_002155192.1| protein YggJ [Vibrio fischeri MJ11]
 gi|197316113|gb|ACH65560.1| protein YggJ [Vibrio fischeri MJ11]
          Length = 243

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 129/246 (52%), Gaps = 30/246 (12%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QGK   S D  +++  V+RMKEG+++LLF+G   E+ + I+   K    +VE  
Sbjct: 9   PELLPSQGKVNLSDDAANHVGRVMRMKEGESVLLFDGSGAEFPAVITSASKK-SVEVEIT 67

Query: 73  SR-SQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYN 123
            R  ++ +S +      +  + +++++ IQKSVE+G+  I P+I+         +     
Sbjct: 68  ERIERSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNVITPLISERCGVKLNKERFEKK 127

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKL 181
           +D+ +   I+A EQC   T+P I P  +LE     W   C    A+E  G + +L     
Sbjct: 128 LDQWQKIAIAACEQCGRNTIPEIRPIMSLE----EW---C----AEEYDGLKLNLHPRAK 176

Query: 182 HAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           ++I  +P    NV +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  +
Sbjct: 177 YSINTLPEPVTNVRLLIGPEGGLSSDEINMTEQYQFEETL-LGPRVLRTETAALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|237798149|ref|ZP_04586610.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021001|gb|EGI01058.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 239

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 119/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQVHYISRVLRMTEGDALQLFDGSGLEFRGTLLEVGKK-R 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
            +V+   R   Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VRVQMTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+PP  L   +K  + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEIDQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|289625569|ref|ZP_06458523.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647472|ref|ZP_06478815.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298485033|ref|ZP_07003130.1| predicted methyltransferase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160443|gb|EFI01467.1| predicted methyltransferase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330865771|gb|EGH00480.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 239

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 121/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+G I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVGEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|28198087|ref|NP_778401.1| hypothetical protein PD0156 [Xylella fastidiosa Temecula1]
 gi|28056147|gb|AAO28050.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|307579179|gb|ADN63148.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 244

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 123/250 (49%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++   G+  
Sbjct: 2   RLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRRE 61

Query: 65  ----IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
               I    E  + S    + VQ I    +  ++D ++QK+ E+G+ AI PV T  +   
Sbjct: 62  AWARIEGVSEVCNESPLAITLVQAI---TRGEKMDLIVQKATELGVVAIVPVDTERS-GV 117

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
             + +RV           ISA EQC    +P +  P  L+ L +  D +   +  D    
Sbjct: 118 RLDSERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQVLPEILDPDTLRLILDPK-- 175

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           SE+ L  L  +  +  V I IGPEGG+   + E L    F+   SLGPRILR++TA + A
Sbjct: 176 SEHRLSTLSRLTPV-EVIIAIGPEGGWSPRDLEILKDAGFIG-FSLGPRILRTETAGLTA 233

Query: 234 MALVQAICGD 243
           +A++QA  GD
Sbjct: 234 IAVLQAQLGD 243


>gi|307611825|emb|CBX01538.1| hypothetical protein LPW_32251 [Legionella pneumophila 130b]
          Length = 242

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 112/230 (48%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM+ G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 21  SPEAGQHVGVVLRMEPGEQLTLFNGDNKEFTASIEMVKKKQVFVRIASVLEVNRESPLKI 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 81  HLAQAIS---KGERMEMVMQKSAELGVACITPIITERCQVKIDKEKMAKKMHQWLNIIIG 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +       H     P+VA++
Sbjct: 138 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPVQH-----PDVALI 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 193 IGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAAGGD 241


>gi|192360419|ref|YP_001980593.1| hypothetical protein CJA_0070 [Cellvibrio japonicus Ueda107]
 gi|190686584|gb|ACE84262.1| conserved hypothetical protein TIGR00046 [Cellvibrio japonicus
           Ueda107]
          Length = 241

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 120/246 (48%), Gaps = 15/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++ +  L    + +      H+L+ VLRM+ G  ++LFNG  GE+ + I  + K   
Sbjct: 3   IPRIYTNQTLLTGNKVQLEESASHHLSKVLRMQPGRELVLFNGAGGEFAATIDEISKRHV 62

Query: 67  FKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------ 118
                      ++S +Q   +    +  R ++++QK+ E+G+  I P++T  T+      
Sbjct: 63  TASIAAHNPHNRESPLQLELAIGISRGERFEWVLQKATELGVTKITPLMTERTEVKVSGE 122

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                M+R +   ISA EQC    LP +  P  +   LK  D   + V       +  + 
Sbjct: 123 RQEKIMERWQHILISACEQCQRNLLPQLSAPVPITDWLKTVDAELRFVLHHRDSQTLPAD 182

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +K H+       A+LIGPEGG   +E        F   L+LGPR+LR++TA +AA+++VQ
Sbjct: 183 KKPHS------AALLIGPEGGLSDDEIALAKQQEFAA-LTLGPRVLRTETAPIAAISVVQ 235

Query: 239 AICGDW 244
            + GD+
Sbjct: 236 YLWGDF 241


>gi|297544383|ref|YP_003676685.1| hypothetical protein Tmath_0939 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842158|gb|ADH60674.1| protein of unknown function DUF558 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 245

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 132/246 (53%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G   E+ + I  V K+ +
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDG-STEYQTSIYGVEKNRV 59

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNT 120
              +E + +S T+ S    +F  + K+++++ +IQK  E+G+    P+ITRY+    +N+
Sbjct: 60  ILFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNS 119

Query: 121 HYN--MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
           + N  ++R    +  A +Q    +LP I  P + E  LK  +     +   E   +    
Sbjct: 120 NLNKKIERWNKISREACKQSGRTSLPEICMPISFEEALKQIEEFDLCIIPYEKEKTLKLK 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPL-SLGPRILRSDTAAVAAMALV 237
           E L  + +I  VAI IGPEGG+  EE +   +L +   L SLGPRILR++TAA++  ++V
Sbjct: 180 EVLDGVKNIKKVAIFIGPEGGFSEEEVDL--ALRYSAKLVSLGPRILRTETAAISVCSIV 237

Query: 238 QAICGD 243
               GD
Sbjct: 238 MYELGD 243


>gi|58426003|gb|AAW75040.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 267

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           L R  V  PL    +     +  ++L  VLR+++GD  +LFNG   ++ ++I+  GK   
Sbjct: 26  LTRSHVALPLHCDQEVALPEESANHLLRVLRLRQGDACILFNGDGSDYHARITVAGKRDA 85

Query: 66  RFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------ 118
           R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+      
Sbjct: 86  RALVERVEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDAA 145

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
            T   +   R+  +SA EQ     LP +  P  L+   +  D +   +  D     E+ L
Sbjct: 146 RTEKRVAHWRSVVVSACEQSGRARLPSVATPLGLQDAAQASDTHALRLTLDPQ--GEHRL 203

Query: 179 EKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             L   + IP ++ + IGPEGG+   ++ TL    F + L LGPRILR++TA +AA+A +
Sbjct: 204 GTL--ASSIPQHIVVAIGPEGGWSPRDRATLAEAGF-SGLQLGPRILRTETAGLAAIAAL 260

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 261 QSRFGD 266


>gi|59711043|ref|YP_203819.1| hypothetical protein VF_0436 [Vibrio fischeri ES114]
 gi|59479144|gb|AAW84931.1| predicted protein [Vibrio fischeri ES114]
          Length = 243

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 129/246 (52%), Gaps = 30/246 (12%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QGK   S D  +++  V+RMKEG+++LLF+G   E+ + I+   K    +VE  
Sbjct: 9   PELLPSQGKVNLSDDAANHVGRVMRMKEGESVLLFDGSGSEFPAVITSASKK-SVEVEIT 67

Query: 73  SR-SQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYN 123
            R  ++ +S +      +  + +++++ IQKSVE+G+  I P+I+         +     
Sbjct: 68  ERIERSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNIITPLISERCGVKLNKERFEKK 127

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKL 181
           +D+ +   I+A EQC   T+P I P  +LE     W   C    A+E  G + +L     
Sbjct: 128 LDQWQKIAIAACEQCGRNTVPEIRPIMSLE----EW---C----AEEYDGLKLNLHPRAK 176

Query: 182 HAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           ++I  +P    NV +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  +
Sbjct: 177 YSINTLPEPVTNVRLLIGPEGGLSSDEISMTEQYQFEETL-LGPRVLRTETAALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|21232316|ref|NP_638233.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66767551|ref|YP_242313.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188990664|ref|YP_001902674.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. campestris str. B100]
 gi|21114084|gb|AAM42157.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572883|gb|AAY48293.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732424|emb|CAP50618.1| Conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 244

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 122/246 (49%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R +V  PL          +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSYVALPLHSGGDVTLPEESANHLLRVLRLREGDACVLFNGDGSDYHARITVAGKRE 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  ++ S      +  +    +  ++D ++QK+ E+G+ A+ PV    T+     
Sbjct: 62  ARAVVERVEAVSNEPPLAITLLQGIARGEKMDLILQKATELGVTAVVPVNAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 M   R+  +SA EQ     +P + PP++L+   +  D     +  D     E+ 
Sbjct: 122 ARLEKRMAHWRSVIVSACEQSGRARIPSLAPPSSLQDAARASDAQALRLTLDPH--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L A+     + + IGPEGG+   ++ TL    F T L LGPRILR++TA +AA+A +
Sbjct: 180 LGTL-AVQPGQELIVAIGPEGGWSPRDRTTLGEAGF-TGLRLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|323498678|ref|ZP_08103669.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio sinaloensis DSM
           21326]
 gi|323316278|gb|EGA69298.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio sinaloensis DSM
           21326]
          Length = 243

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 115/238 (48%), Gaps = 36/238 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKV-EYQSRSQTKQSDV 82
           S D   ++  VLRMKEG  +LLF+G   E+ + IS V  KS+  +V E   RS     D+
Sbjct: 21  SDDAAGHIGRVLRMKEGQQVLLFDGSGSEFPATISSVSKKSVEVEVTERIERSAESPLDL 80

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAAE 136
                  + +++++ IQKSVE+G+  I P+I+         +     M + +   ISA E
Sbjct: 81  HLGQVVSRGDKMEFTIQKSVELGVNTITPLISERCGVKLDQKRFEKKMAQWQKIAISACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIPN 189
           QC   T+P I P   LE    +W            CG E    KL       ++I  +P 
Sbjct: 141 QCGRNTVPEIRPIMQLE----DW------------CGEEYDGLKLNLHPRAKYSINTLPT 184

Query: 190 ----VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
               V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 185 PVERVRLLIGPEGGLSAEEISMTEKYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|84623346|ref|YP_450718.1| hypothetical protein XOO_1689 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|229558004|ref|YP_200425.2| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84367286|dbj|BAE68444.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 244

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 124/248 (50%), Gaps = 16/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR+++GD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVALPEESANHLLRVLRLRQGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERVEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSEN 176
             T   +   R+  +SA EQ     LP +  P  L+   +  D H  ++    +    E+
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVATPLGLQDAAQASDTHALRLTLDPQ---GEH 178

Query: 177 SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            L  L   + IP ++ + IGPEGG+   ++ TL    F + L LGPRILR++TA +AA+A
Sbjct: 179 RLGTL--ASSIPQHIVVAIGPEGGWSPRDRATLAEAGF-SGLQLGPRILRTETAGLAAIA 235

Query: 236 LVQAICGD 243
            +Q+  GD
Sbjct: 236 ALQSRFGD 243


>gi|90415442|ref|ZP_01223376.1| hypothetical protein GB2207_09001 [marine gamma proteobacterium
           HTCC2207]
 gi|90332765|gb|EAS47935.1| hypothetical protein GB2207_09001 [marine gamma proteobacterium
           HTCC2207]
          Length = 245

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 124/249 (49%), Gaps = 18/249 (7%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            + R+F D PL        SG    +L+  LRM  G  I LFNG  GE+ + ++   KS 
Sbjct: 2   RIPRIFTDQPLSSGANLALSGSAARHLSSALRMSAGQEITLFNGLGGEFSATLTRATKSQ 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
           +   + +++   +    ++    +  +  R+D+++QK+ E+G+  I P+ +  T+    N
Sbjct: 62  VDVSIGDFRDIDRESPLNLHLAIAVSRGERMDWIVQKATELGVSEITPLFSERTE-VKLN 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R+       +  +ISA EQC    +P I P  TL+  L     N + +       S+ 
Sbjct: 121 GERLEKKLRHWQQVSISACEQCQRNLVPSINPALTLDQWLSQDTGNAEQLKLVLHHRSDK 180

Query: 177 SLEKLHAIAHIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           SL +     H P  +  +L+GPEGG    E        F   L+LGPR++R++TA +AA+
Sbjct: 181 SLAQ-----HQPPKSACLLVGPEGGLSDNEISRAMDNGFAA-LTLGPRVMRTETAPLAAI 234

Query: 235 ALVQAICGD 243
           +++Q++ GD
Sbjct: 235 SIMQSVWGD 243


>gi|229358034|ref|YP_001914280.2| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 244

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 124/248 (50%), Gaps = 16/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR+++GD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVALPEESANHLLRVLRLRQGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERVEPLSNESPLRITLMQGIARGEKMDLILQKTTELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSEN 176
             T   +   R+  +SA EQ     LP +  P  L+   +  D H  ++    +    E+
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVATPLGLQDAAQASDTHALRLTLDPQ---GEH 178

Query: 177 SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            L  L   + IP ++ + IGPEGG+   ++ TL    F + L LGPRILR++TA +AA+A
Sbjct: 179 RLGTL--ASSIPQHIVVAIGPEGGWSPRDRATLAEAGF-SGLQLGPRILRTETAGLAAIA 235

Query: 236 LVQAICGD 243
            +Q+  GD
Sbjct: 236 ALQSRFGD 243


>gi|326389861|ref|ZP_08211425.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994129|gb|EGD52557.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 245

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/231 (32%), Positives = 121/231 (52%), Gaps = 18/231 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQSRSQTKQSDV 82
            G+ +H+L +VLR+K G+ I+  +G   E+ ++I  + K   I F +E +  S T+ +  
Sbjct: 19  EGEDFHHLVNVLRLKRGNEIVASDGLK-EYAARIEEIKKDKLILF-LERELESNTESALE 76

Query: 83  QYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
             +F  + K+++++ +IQK  E+G+    PV+TRYT       N +  + R R  +  A 
Sbjct: 77  ISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSNINKKIARWRKISEEAC 136

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHN--CQIVFADE-TCGSENSLEKLHAIAHIPNVAI 192
           +Q     +P I  P + E  +   D    C I +  E T   +  LEK   +  I    I
Sbjct: 137 KQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKEVLEKAKGVKKI---GI 193

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            IGPEGG+  EE E L     + P+SLGPRILR++TAA+A  ++V    GD
Sbjct: 194 FIGPEGGFSQEEIE-LALNKSIKPVSLGPRILRTETAAIAVCSIVMYELGD 243


>gi|182680714|ref|YP_001828874.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa M23]
 gi|182630824|gb|ACB91600.1| protein of unknown function DUF558 [Xylella fastidiosa M23]
          Length = 242

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 123/249 (49%), Gaps = 20/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-- 64
           + R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++   G+   
Sbjct: 1   MSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRREA 60

Query: 65  ---IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
              I    E  + S    + VQ I    +  ++D ++QK+ E+G+ AI PV T  +    
Sbjct: 61  WARIEGVSEVCNESPLAITLVQAI---TRGEKMDLIVQKATELGVVAIVPVDTERS-GVR 116

Query: 122 YNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
            + +RV           ISA EQC    +P +  P  L+ L +  D +   +  D    S
Sbjct: 117 LDSERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQVLPEILDPDTLRLILDPK--S 174

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           E+ L  L  +  +  V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+
Sbjct: 175 EHRLSTLSRLTPV-EVIIAIGPEGGWSPRDLEILKDAGFIG-FSLGPRILRTETAGLTAI 232

Query: 235 ALVQAICGD 243
           A++QA  GD
Sbjct: 233 AVLQAQLGD 241


>gi|148361269|ref|YP_001252476.1| hypothetical protein LPC_3243 [Legionella pneumophila str. Corby]
 gi|148283042|gb|ABQ57130.1| hypothetical protein LPC_3243 [Legionella pneumophila str. Corby]
          Length = 242

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 115/230 (50%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 21  SPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTASIERVKKKQVFVRIASVLEVNRESPLKI 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 81  HLAQAIS---KGERMEVVMQKSAELGVACITPIITERCQVKIDKEKMAKKMHQWLNIIIG 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +             P+VA++
Sbjct: 138 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYP-----VQPPDVALI 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+ S+E+ TL S     PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 193 IGPEGGF-SDEEITLTSGYGFLPLSLGPRVLRTETAAITALSVLQAAGGD 241


>gi|167040699|ref|YP_001663684.1| 16S ribosomal RNA methyltransferase RsmE [Thermoanaerobacter sp.
           X514]
 gi|300914740|ref|ZP_07132056.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X561]
 gi|307724026|ref|YP_003903777.1| hypothetical protein Thet_0859 [Thermoanaerobacter sp. X513]
 gi|166854939|gb|ABY93348.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X514]
 gi|300889675|gb|EFK84821.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X561]
 gi|307581087|gb|ADN54486.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X513]
          Length = 245

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 132/246 (53%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G   E+ + I  V K+ +
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDG-STEYQTSIYGVEKNRV 59

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNT 120
              +E + +S T+ S    +F  + K+++++ +IQK  E+G+    P+ITRY+    +N+
Sbjct: 60  ILFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNS 119

Query: 121 HYN--MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
           + N  ++R    +  A +Q    +LP I  P + E  LK  +     +   E   +    
Sbjct: 120 NLNKKIERWNKISREACKQSGRTSLPEICMPISFEEALKQIEEFDLCIIPYEKEKTLKLK 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPL-SLGPRILRSDTAAVAAMALV 237
           E L  + +I  VAI +GPEGG+  EE +   +L +   L SLGPRILR++TAA++  ++V
Sbjct: 180 EVLDGVKNIKKVAIFVGPEGGFSEEEVDL--ALRYSAKLVSLGPRILRTETAAISVCSIV 237

Query: 238 QAICGD 243
               GD
Sbjct: 238 MYELGD 243


>gi|54295775|ref|YP_128190.1| hypothetical protein lpl2865 [Legionella pneumophila str. Lens]
 gi|53755607|emb|CAH17109.1| hypothetical protein lpl2865 [Legionella pneumophila str. Lens]
          Length = 244

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 112/230 (48%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 23  SPEAGQHVGVVLRMEQGEQLTLFNGDNKEFTASIEMVKKKQVFVRIASVLEVNRESPLKI 82

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 83  HLAQAIS---KGERMEMVMQKSAELGVACITPIITERCQVKIDKEKMAKKMHQWLNIIIG 139

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +             P+VA++
Sbjct: 140 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYP-----VQPPDVALI 194

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 195 IGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAAGGD 243


>gi|209694142|ref|YP_002262070.1| 16S ribosomal RNA methyltransferase RsmE [Aliivibrio salmonicida
           LFI1238]
 gi|208008093|emb|CAQ78234.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 243

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 120/240 (50%), Gaps = 18/240 (7%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QGK   S D  +++  V+RMKEG+ +LLF+G   E+ + I+   K    +VE  
Sbjct: 9   PELLPSQGKVNLSDDAANHVGRVMRMKEGEAVLLFDGSGAEFPAVITSSSKK-SVEVEIS 67

Query: 73  SR-SQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYN 123
            R   + +S +      +  + +++++ IQKSVE+G+  I P+I+         +     
Sbjct: 68  ERIDHSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNIITPLISERCGVKLNKERFEKK 127

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
           +D+     I+A EQC   T+P I P  +LE          ++        S N+L +   
Sbjct: 128 LDQWHKIAIAACEQCGRNTIPEIRPIMSLEEWCAEEYEGLKLNLHPRAKYSINTLPE--- 184

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
              + NV +LIGPEGG  SEE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 185 --PVTNVRLLIGPEGGLSSEEITMTEQYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|164685878|ref|ZP_01945479.2| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165918716|ref|ZP_02218802.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|164601398|gb|EAX33970.2| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165917544|gb|EDR36148.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
          Length = 244

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 120/247 (48%), Gaps = 20/247 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKS 64
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ +  K 
Sbjct: 5   RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 64

Query: 65  IRFKVEYQSRSQTKQSDV----QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN- 119
           +   ++ +   +T+ S      Q IF   ++ ++DY IQK+VE+G+  I P+IT  T   
Sbjct: 65  VEITIDSKEAGRTESSLFIELGQGIF---RSEKMDYAIQKAVELGVNRIVPLITERTSTK 121

Query: 120 -THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC--GSEN 176
                +   +   IS  EQ     +P +    +L   L        +V     C   ++N
Sbjct: 122 PKTQKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLV-----CHPNAQN 176

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           SL      +    + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L
Sbjct: 177 SLADFKTTSQ--RITLLIGPEGGLSDDEVQRATQSGFQV-LFLGPRILRTETATVTALSL 233

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 234 IQAYFGD 240


>gi|212217753|ref|YP_002304540.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii
           CbuK_Q154]
 gi|212012015|gb|ACJ19395.1| hypothetical cytosolic protein [Coxiella burnetii CbuK_Q154]
          Length = 270

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 120/247 (48%), Gaps = 20/247 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKS 64
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ +  K 
Sbjct: 31  RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 90

Query: 65  IRFKVEYQSRSQTKQSDV----QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN- 119
           +   ++ +   +T+ S      Q IF   ++ ++DY IQK+VE+G+  I P+IT  T   
Sbjct: 91  VEITIDSKEAGRTESSLFIELGQGIF---RSEKMDYAIQKAVELGVNRIVPLITERTSTK 147

Query: 120 -THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC--GSEN 176
                +   +   IS  EQ     +P +    +L   L        +V     C   ++N
Sbjct: 148 PKTQKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLV-----CHPNAQN 202

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           SL      +    + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L
Sbjct: 203 SLADFKTTSQ--RITLLIGPEGGLSDDEVQRATQSGFQV-LFLGPRILRTETATVTALSL 259

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 260 IQAYFGD 266


>gi|161831038|ref|YP_001597773.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii RSA
           331]
 gi|212211957|ref|YP_002302893.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii
           CbuG_Q212]
 gi|161762905|gb|ABX78547.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
 gi|212010367|gb|ACJ17748.1| hypothetical cytosolic protein [Coxiella burnetii CbuG_Q212]
          Length = 244

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 119/244 (48%), Gaps = 14/244 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKS 64
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ +  K 
Sbjct: 5   RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 64

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQN--TH 121
           +   ++ +   +T+ S    +   I ++ ++DY IQK+VE+G+  I P+IT  T      
Sbjct: 65  VEITIDSKEAGRTESSLFIELGQGISRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 124

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC--GSENSLE 179
             +   +   IS  EQ     +P +    +L   L        +V     C   ++NSL 
Sbjct: 125 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLV-----CHPNAQNSLA 179

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                +    + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA
Sbjct: 180 DFKTTSQ--RITLLIGPEGGLSDDEVQRATQSGFQV-LFLGPRILRTETATVTALSLIQA 236

Query: 240 ICGD 243
             GD
Sbjct: 237 YFGD 240


>gi|21243796|ref|NP_643378.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21109388|gb|AAM37914.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 244

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 122/246 (49%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVTLPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R +VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARARVERAEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             T   +   R+  +SA EQ     LP +  P  L+   +  D +   +  D     E+ 
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVAAPQGLQDAAQASDAHALRLTLDPQ--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L A +   ++ + IGPEGG+   ++  L    F + L LGPRILR++TA +AA+A +
Sbjct: 180 LGTL-ASSIQQHIVVAIGPEGGWSPRDRALLAEAGF-SGLQLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|254787838|ref|YP_003075267.1| 16S rRNA m3U1498 methyltransferase [Teredinibacter turnerae T7901]
 gi|237684009|gb|ACR11273.1| 16S rRNA m3U1498 methyltransferase [Teredinibacter turnerae T7901]
          Length = 241

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 115/223 (51%), Gaps = 15/223 (6%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKVEYQSRSQTKQSDVQYIFSP 88
           H+L  VLRM+ G  ++LFNG  GE+ + I S   K+    +      + +   V  +   
Sbjct: 26  HHLLKVLRMETGRELILFNGLGGEYRATITSATKKAATVTISEHDPVERESPLVTELAVG 85

Query: 89  I-KTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTISAAEQCDIL 141
           I + +R D+++QK+ E+G+  I P+ +  ++           + + +   I A EQC   
Sbjct: 86  ISRGDRFDWVLQKATELGISRIVPLFSERSEVKLSGERLEKRLSQWQKVVIGACEQCQRN 145

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYH 201
           TLP +  P ++E  +   D  C + F         S   L  +A   +VA+L+GPEGG  
Sbjct: 146 TLPELTAPQSVENYVT--DSLCDLRFVLH----HRSTHHLSQLAAPASVALLVGPEGGLS 199

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             E +   +  F +PL+LGPR+LR++TA + A+++VQA  GD+
Sbjct: 200 DAEIQLAENAGF-SPLALGPRVLRTETAPLVALSVVQATWGDF 241


>gi|330886230|gb|EGH20131.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 239

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 120/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+G I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVGEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA   A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGFHAA-RLGPRVLRTETAPAVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|71275479|ref|ZP_00651765.1| Conserved hypothetical protein 46 [Xylella fastidiosa Dixon]
 gi|71900654|ref|ZP_00682779.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|170729396|ref|YP_001774829.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa M12]
 gi|71163779|gb|EAO13495.1| Conserved hypothetical protein 46 [Xylella fastidiosa Dixon]
 gi|71729589|gb|EAO31695.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|167964189|gb|ACA11199.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 244

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 123/250 (49%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++   G+  
Sbjct: 2   RLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRRE 61

Query: 65  ----IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
               I    E  + S    + VQ I    +  ++D ++QK+ E+G+ AI PV T  +   
Sbjct: 62  AWARIEGVSEVCNESPLAITLVQAIA---RGEKMDLIVQKATELGVVAIVPVDTERS-GV 117

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
             + +RV           +SA EQC    +P +  P  L+ L +  D +   +  D    
Sbjct: 118 RLDSERVAKRLAHWNNVVVSACEQCGRTRVPEVQMPRALQALPEILDPDTLRLILDPK-- 175

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           SE+ L  L  +  +  V I IGPEGG+   + E L    F+   SLGPRILR++TA + A
Sbjct: 176 SEHRLSTLSRLTPV-AVTIAIGPEGGWSPRDLEILKDAGFIG-FSLGPRILRTETAGLTA 233

Query: 234 MALVQAICGD 243
           +A++QA  GD
Sbjct: 234 IAVLQAQLGD 243


>gi|215919303|ref|NP_820935.2| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii RSA
           493]
 gi|206584188|gb|AAO91449.2| hypothetical cytosolic protein [Coxiella burnetii RSA 493]
          Length = 260

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 119/244 (48%), Gaps = 14/244 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKS 64
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ +  K 
Sbjct: 21  RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 80

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQN--TH 121
           +   ++ +   +T+ S    +   I ++ ++DY IQK+VE+G+  I P+IT  T      
Sbjct: 81  VEITIDSKEAGRTESSLFIELGQGISRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 140

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC--GSENSLE 179
             +   +   IS  EQ     +P +    +L   L        +V     C   ++NSL 
Sbjct: 141 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLV-----CHPNAQNSLA 195

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                +    + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA
Sbjct: 196 DFKTTSQ--RITLLIGPEGGLSDDEVQRATQSGFQV-LFLGPRILRTETATVTALSLIQA 252

Query: 240 ICGD 243
             GD
Sbjct: 253 YFGD 256


>gi|320116218|ref|YP_004186377.1| hypothetical protein Thebr_1425 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|319929309|gb|ADV79994.1| protein of unknown function DUF558 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 245

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 117/228 (51%), Gaps = 12/228 (5%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQSRSQTKQSDV 82
            G+ +H+L +VLR+K G+ I+  +G   E+ ++I  + K   I F +E +  S T+ +  
Sbjct: 19  EGEDFHHLVNVLRLKRGNEIVASDGLK-EYAARIEEIKKDKLILF-LERELESNTESALE 76

Query: 83  QYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
             +F  + K+++++ +IQK  E+G+    PV+TRYT       N +  + R R  +  A 
Sbjct: 77  ISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSNINKKIARWRKISEEAC 136

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           +Q     +P I  P + E  +   D     +   E   +    E L     +  + I IG
Sbjct: 137 KQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKEVLKKAKGVKKIGIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  EE E L     + P+SLGPRILR++TAA+A  ++V    GD
Sbjct: 197 PEGGFSQEEIE-LALNKSIKPVSLGPRILRTETAAIAVCSIVMYELGD 243


>gi|220936059|ref|YP_002514958.1| protein of unknown function DUF558 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997369|gb|ACL73971.1| protein of unknown function DUF558 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 244

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 120/244 (49%), Gaps = 15/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--SIR 66
           RL+++  L +    +     + ++  VLR++ G  ++LFNG+ GE+ + ++   K  S  
Sbjct: 5   RLYLNQSLSVGDTIELDERAHRHVVQVLRLRPGAELVLFNGQGGEYRATLTEAQKRHSSV 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
               +  R       V  +    K +R+DY +QK+ E+G+  I+PV+T+ +Q        
Sbjct: 65  SLTGFDPRDTRPALPVTLVQGISKGDRMDYSLQKATELGVSRIQPVLTQRSQAPGDPRRL 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLE 179
              ++  R   ISA EQC    LP +    + + +L    D    +V       +E  L 
Sbjct: 125 DNRLEHWRGVVISACEQCGRNELPELGGVISFQAWLGSEPDSGLGLVLDPR---AETGLS 181

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +     V++LIGPEGG    E        F TP+ LGPRILR++TA VAA+A++Q 
Sbjct: 182 GL--VPPEGEVSLLIGPEGGLDEAEILAARHRGF-TPVRLGPRILRTETAGVAALAVIQG 238

Query: 240 ICGD 243
           + GD
Sbjct: 239 LWGD 242


>gi|27364902|ref|NP_760430.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio vulnificus CMCP6]
 gi|37681051|ref|NP_935660.1| hypothetical protein VV2867 [Vibrio vulnificus YJ016]
 gi|320155285|ref|YP_004187664.1| ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           MO6-24/O]
 gi|27361047|gb|AAO09957.1| Ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           CMCP6]
 gi|37199801|dbj|BAC95631.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319930597|gb|ADV85461.1| ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           MO6-24/O]
          Length = 243

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 113/227 (49%), Gaps = 14/227 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKV-EYQSRSQTKQSDV 82
           S D   ++  VLRMKEG  +LLF+G   E+ + IS VG KS+  ++ E   RS     D+
Sbjct: 21  SDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVGKKSVMVELSERVERSSESPLDL 80

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAAE 136
                  +  ++++ IQKSVE+G+  I P+I+         +     + + +   ISA E
Sbjct: 81  HLGQVISRGEKMEFTIQKSVELGVNTITPLISDRCGVKLDEKRFEKKLAQWQKIAISACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC   T+P I P  +LE          ++        S N+L +      +  V +LIGP
Sbjct: 141 QCGRNTIPEIRPIMSLEAWCAEEYDGLKLNLHPRAKYSINTLPE-----PVTKVRLLIGP 195

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG  SEE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 196 EGGLSSEEIDMTQQYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|330951354|gb|EGH51614.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae Cit
           7]
          Length = 239

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 120/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
             V+  +S +  ++S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQQESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|54298937|ref|YP_125306.1| 16S ribosomal RNA methyltransferase RsmE [Legionella pneumophila
           str. Paris]
 gi|53752722|emb|CAH14157.1| hypothetical protein lpp3004 [Legionella pneumophila str. Paris]
          Length = 244

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 115/230 (50%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 23  SPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTAFIERVKKKQVFVRIASVLEVNRESPLKI 82

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 83  HLAQAIS---KGERMEVVMQKSAELGVACITPIITERCQVKIDKEKMAKKMHQWLNIIIG 139

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +             P+VA++
Sbjct: 140 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYP-----VQPPDVALI 194

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+ S+E+ TL S     PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 195 IGPEGGF-SDEEITLTSGYGFLPLSLGPRVLRTETAAITALSVLQAAGGD 243


>gi|52843130|ref|YP_096929.1| 16S ribosomal RNA methyltransferase RsmE [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52630241|gb|AAU28982.1| hypothetical protein lpg2936 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 244

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 112/230 (48%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 23  SPEAGQHVGVVLRMEQGEQLTLFNGDNKEFTASIERVKKKQVFVRIASVLEVNRESPLKI 82

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 83  HLAQAIS---KGERMEMVMQKSAELGVACITPLITERCQVKIDKEKMAKKMHQWLNIIIG 139

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +             P+VA++
Sbjct: 140 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYP-----VQPPDVALI 194

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 195 IGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAAGGD 243


>gi|254496687|ref|ZP_05109550.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354115|gb|EET12787.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 242

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 119/227 (52%), Gaps = 14/227 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S +   ++A VLRM+ G+ + LF G + E+ + I  V K           +  K+S +  
Sbjct: 21  SPEASQHVAVVLRMQIGEQLTLFCGDNREFTATIEAVKKKQVMVTVNAVTAINKESPLAI 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAAE 136
             +    K  R++ ++QK+VE+G+  I P+I+         +     + + +   I+A E
Sbjct: 81  HLAQAISKGERMELVMQKAVELGVTRITPIISERCVVKLDQERMGKKLHQWQAIVIAACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           Q    T+P I+PP TL   L+  + + Q+       G++N  +     +   N+A+LIGP
Sbjct: 141 QSGRNTVPVIHPPLTLARYLQ--EESAQLKLILHPGGNKNWRDYTFTQS---NIALLIGP 195

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG    E  +  +  F  PLSLGPRILR++TAA+ A++++QA+ GD
Sbjct: 196 EGGLSDAEVHSASAQGF-QPLSLGPRILRTETAAITALSVLQAVAGD 241


>gi|296108607|ref|YP_003620308.1| hypothetical protein lpa_04293 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650509|gb|ADG26356.1| hypothetical protein lpa_04293 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 242

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 115/230 (50%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-----VEYQSRSQTKQ 79
           S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F      +E    S  K 
Sbjct: 21  SPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTAFIERVKKKQVFVRIASVLEVNRESPLKI 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTIS 133
              Q I    K  R++ ++QKS E+G+  I P+IT   Q           M +     I 
Sbjct: 81  HLAQAIS---KGERMEVVMQKSAELGVACITPIITERCQVKIDKEKMAKKMHQWLNIIIG 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P +  P  L+  ++    + +++       +             P+VA++
Sbjct: 138 ACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYP-----VQPPDVALI 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+ S+E+ TL S     PLSLGPR+LR++TAA+ A++++QA  GD
Sbjct: 193 IGPEGGF-SDEEITLTSGYGFLPLSLGPRVLRTETAAITALSVLQAAGGD 241


>gi|297568502|ref|YP_003689846.1| protein of unknown function DUF558 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924417|gb|ADH85227.1| protein of unknown function DUF558 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 242

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 125/246 (50%), Gaps = 11/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           ++R F+D       +   +G   H+L HVLR+  G+ + LF+G+   + + I ++   + 
Sbjct: 1   MRRFFIDPEAIQGREASLTGSDAHHLQHVLRLTPGERVELFDGRGTVYQAAIDHIEPGLT 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           R  +   S +   +  +    + +K  ++D ++QK  E+G+ ++RP  +++T       +
Sbjct: 61  RLTLLSSSDTPPDRLAIHLGQAMLKGKKMDLVVQKCTELGVRSLRPYTSQHTTTPPPGAE 120

Query: 126 RVRTYTI---SAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGS--ENSLE 179
           ++  +      + +QC+    P  +PP T  E L    D + +++  +E       N  E
Sbjct: 121 KLARWQRIIHESCKQCNQPWPPSCHPPQTFAELLADAADFDLRLICWEEPEAPPLSNIAE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +L A A   +V +LIGPEGG+  EE +      F+  + LG RILR++TA++  +AL+Q 
Sbjct: 181 QLGAPA---SVLVLIGPEGGFSREEIDLARQAGFIV-IGLGRRILRAETASIVIIALLQY 236

Query: 240 ICGDWY 245
           I  D Y
Sbjct: 237 IFNDLY 242


>gi|289667429|ref|ZP_06488504.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 244

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 120/246 (48%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVALPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERVEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             T   +   R+  +SA EQ     +P +  P  L+   +  D +   +  D     E+ 
Sbjct: 122 ARTEKRIAHWRSVVVSACEQSGRARIPTVAAPLGLQEAAQASDAHALRLTLDPQ--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L +     ++ + IGPEGG+   ++  L    F T L LGPRILR++TA +AA+A +
Sbjct: 180 LGTLASSVQ-QHIVVAIGPEGGWSPRDRALLADAGF-TGLQLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|307543622|ref|YP_003896101.1| hypothetical protein HELO_1033 [Halomonas elongata DSM 2581]
 gi|307215646|emb|CBV40916.1| K09761 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 248

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 116/222 (52%), Gaps = 17/222 (7%)

Query: 31  YLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           ++A VLR+  G  +++F+G+  E  + ++  G K +  +VE  +  + +     ++   I
Sbjct: 34  HVARVLRLGPGAPVIIFDGQGNEAEAILTEAGRKQVVARVERVAAGRGESPLAVHLGQAI 93

Query: 90  -KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
            K +R+DY IQK+VE+G+  I P+ T +       +     +   +    SA EQC   T
Sbjct: 94  SKGDRMDYAIQKAVELGVAEITPLYTEHGDVRLKGEREAKKLAHWQAVAASACEQCGRAT 153

Query: 143 LPFIYPP-TTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYH 201
           LP +YPP + +++L +  +  C ++      G +   + + A       A+LIGPEGG  
Sbjct: 154 LPPVYPPRSVVDWLAERDEPLCLVLHPGTPGGLDRHDDPVRA-------ALLIGPEGGLS 206

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             E +      F + L+LGPRILR++TA V A++L+Q   GD
Sbjct: 207 HAEVDAAADAGFAS-LTLGPRILRTETAPVVALSLLQNRFGD 247


>gi|256752132|ref|ZP_05492998.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256748946|gb|EEU61984.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 245

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 116/228 (50%), Gaps = 12/228 (5%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQSRSQTKQSDV 82
            G+ +H+L +VLR+K G+ I+  +G   E+ ++I  + K   I F +E +  S T+    
Sbjct: 19  EGEDFHHLVNVLRLKRGNEIVASDGLK-EYAARIEEIKKDKLILF-LERELESNTESPLE 76

Query: 83  QYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
             +F  + K+++++ +IQK  E+G+    PV+TRYT       N +  + R R  +  A 
Sbjct: 77  ISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSNINKKIARWRKISEEAC 136

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           +Q     +P I  P + E  +   D     +   E   +    E L     +  + I IG
Sbjct: 137 KQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKEVLKKAKGVKKIGIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  EE E L     + P+SLGPRILR++TAA+A  ++V    GD
Sbjct: 197 PEGGFSQEEIE-LALNKSIKPVSLGPRILRTETAAIAVCSIVMYELGD 243


>gi|330984681|gb|EGH82784.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009640|gb|EGH89696.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 239

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 120/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|294627316|ref|ZP_06705902.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667456|ref|ZP_06732673.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598398|gb|EFF42549.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602789|gb|EFF46223.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 244

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 121/246 (49%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVTLPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R +VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARARVERAEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             T   +   R+  +SA EQ     LP +  P  L+   +  D +   +  D     E+ 
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVAAPQGLQDAAQASDAHALRLTLDPQ--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L A +    + + IGPEGG+   ++  L    F + L LGPRILR++TA +AA+A +
Sbjct: 180 LGTL-ASSIQQYIVVAIGPEGGWSPRDRALLAEAGF-SGLQLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|254796435|ref|YP_003081271.1| hypothetical protein NRI_0035 [Neorickettsia risticii str.
           Illinois]
 gi|254589672|gb|ACT69034.1| conserved hypothetical protein [Neorickettsia risticii str.
           Illinois]
          Length = 232

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 124/242 (51%), Gaps = 27/242 (11%)

Query: 6   HLKRLFVDFPLCIK-TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
            L RLF++     K T+      + HYL  V+R+++   +++FNG+ GEW++K+      
Sbjct: 2   RLTRLFLNVETIEKGTKICIDPKKQHYLFSVMRLQKEAQVIVFNGRSGEWIAKVDR---- 57

Query: 65  IRFKV-EYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
             F V + Q R QT     D+   F+  K   L   ++++ E+ +  +RP+ +   +N +
Sbjct: 58  -NFLVPDIQIRPQTASYPYDIHLCFAVPKHKALKETVRQATELDVTTLRPIYSSRAENKN 116

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
            +++++  + I AA+QC  +++P + PP  L   ++ +  N  +   DET          
Sbjct: 117 KDLEKLELWAIEAAQQCRRMSIPILLPPIALRE-VETYHEN--VFICDETLSDS------ 167

Query: 182 HAIAHIPNVA---ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             I  IP ++   I+IGPEGG+  EE   +        +SLG  ILR  TAA +A+A V+
Sbjct: 168 -VICDIPILSSYTIVIGPEGGFSHEELSLIDKR-----ISLGRTILRCSTAATSAIAQVR 221

Query: 239 AI 240
           ++
Sbjct: 222 SV 223


>gi|78048759|ref|YP_364934.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325925762|ref|ZP_08187135.1| hypothetical protein TIGR00046 [Xanthomonas perforans 91-118]
 gi|78037189|emb|CAJ24934.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325543819|gb|EGD15229.1| hypothetical protein TIGR00046 [Xanthomonas perforans 91-118]
          Length = 244

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 122/246 (49%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVTLPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGKRD 61

Query: 66  RFKVEYQSRSQTKQSDVQYIF--SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
              +  ++   + +S ++        +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERAEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             T   +   R+  +SA EQ     LP +  P  L+   +  D +   +  D     E+ 
Sbjct: 122 ARTEKRVAHWRSVVVSACEQSGRARLPSVAVPQGLQDAAQASDAHALRLTLDPQ--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L A +   +V + IGPEGG+   ++  L    F + L LGPRILR++TA +AA+A +
Sbjct: 180 LGTL-ASSIQQHVVVAIGPEGGWSPRDRALLAEAGF-SGLQLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|160872460|ref|ZP_02062592.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159121259|gb|EDP46597.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 241

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 118/228 (51%), Gaps = 17/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV-EYQSRSQTKQSDV 82
           S +  H+L  VLR++ GD  ++FNG+ GE+ + I   +  + R K+ E+ + ++     +
Sbjct: 21  SQEAAHHLIRVLRLQVGDECIIFNGQAGEFQATIIERIKTTARVKLGEFNAINRESPLQI 80

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTI-------SAA 135
             + + + ++++DY++QK+VE+G+  + P++T ++       DR     +        A 
Sbjct: 81  TLVQAILHSDKMDYLLQKAVELGVTHVIPLLTAHS-TLKLTPDRWEKRYVHWQGVMRGAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ     +P +  P T +  +       +I+          + + LH++     V + IG
Sbjct: 140 EQSGRTRIPILENPMTFDVAMMALKAETRIIL------QPAAKKMLHSLPFCQRVVLCIG 193

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+   E ++   + F   + +GPR+LRS+TA V AM+L+Q + GD
Sbjct: 194 PEGGWSLNELDSAQKMGF-QAMKMGPRVLRSETAGVVAMSLLQGLYGD 240


>gi|188521803|gb|ACD59748.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 227

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 117/227 (51%), Gaps = 16/227 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVE-YQSRSQTKQSDVQY 84
           +  ++L  VLR+++GD  +LFNG   ++ ++I+  GK   R  VE  +  S      +  
Sbjct: 6   ESANHLLRVLRLRQGDACILFNGDGSDYHARITVAGKRDARALVERVEPLSNESPLRITL 65

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTISAAEQC 138
           +    +  ++D ++QK+ E+G+ AI PVI   T+       T   +   R+  +SA EQ 
Sbjct: 66  MQGIARGEKMDLILQKTTELGVAAIVPVIAERTEVKLDAARTEKRVAHWRSVVVSACEQS 125

Query: 139 DILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSENSLEKLHAIAHIPN-VAILIGP 196
               LP +  P  L+   +  D H  ++    +    E+ L  L   + IP  + + IGP
Sbjct: 126 GRARLPSVATPLGLQDAAQASDTHALRLTLDPQ---GEHRLGTL--ASSIPQHIVVAIGP 180

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG+   ++ TL    F + L LGPRILR++TA +AA+A +Q+  GD
Sbjct: 181 EGGWSPRDRATLAEAGF-SGLQLGPRILRTETAGLAAIAALQSRFGD 226


>gi|289664251|ref|ZP_06485832.1| 16S ribosomal RNA methyltransferase RsmE [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 244

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 120/246 (48%), Gaps = 12/246 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLIRSHVALPLHCDQEVALPEESANHLLRVLRLREGDACILFNGDGSDYHARITVAGKRD 61

Query: 65  IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ----- 118
            R  VE  +  S      +  +    +  ++D ++QK+ E+G+ AI PVI   T+     
Sbjct: 62  ARALVERVEPLSNESPLRITLMQGIARGEKMDLILQKATELGVAAIVPVIAERTEVKLDA 121

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             T   +   R+  +SA EQ     +P +  P  L+   +  D +   +  D     E+ 
Sbjct: 122 ARTEKRIAHWRSVVVSACEQSGRARIPTVAAPLGLQEAAQASDAHALRLTLDPQ--GEHR 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L  L +     ++ + IGPEGG+   ++  L    F T L LGPRILR++TA +AA+A +
Sbjct: 180 LGTLASSVQ-QHIVVAIGPEGGWSPRDRALLADAGF-TGLQLGPRILRTETAGLAAIAAL 237

Query: 238 QAICGD 243
           Q+  GD
Sbjct: 238 QSRFGD 243


>gi|320322008|gb|EFW78104.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330886|gb|EFW86860.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330872110|gb|EGH06259.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 239

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 119/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|71737741|ref|YP_272747.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558294|gb|AAZ37505.1| uncharacterized conserved protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 239

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 119/247 (48%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTEAPLSLGEH-ELPEAQTHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|149191952|ref|ZP_01870183.1| hypothetical protein VSAK1_07844 [Vibrio shilonii AK1]
 gi|148834219|gb|EDL51225.1| hypothetical protein VSAK1_07844 [Vibrio shilonii AK1]
          Length = 243

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 114/234 (48%), Gaps = 28/234 (11%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D   ++  VLRMKEG  +LLF+G   E+ + I+ +GK     V+ Q +  T       
Sbjct: 21  SEDAAGHVGRVLRMKEGQEVLLFDGSGHEFPATITQIGKK-NVDVDIQEKVSTS------ 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRT 129
           I SP+         + +++++ IQKSVE+G+  I P+I+         +     + + + 
Sbjct: 74  IESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLDAKRFEKKLQQWQK 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             ISA EQC   T+P I P  +LE          ++        S N+L +      +  
Sbjct: 134 IAISACEQCGRNTIPEIRPIMSLEQWCAEPSEALKLNLHPRAKYSINTLPE-----PVTK 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E E      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 189 VRLLIGPEGGLSAQEIEMTEQYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|119773713|ref|YP_926453.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella amazonensis
           SB2B]
 gi|119766213|gb|ABL98783.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 243

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 120/257 (46%), Gaps = 36/257 (14%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
            + R+F    L    +     D + ++  VLRM EG+ I +FNG   ++L+ I   G KS
Sbjct: 2   RIPRIFQPLDLSPSAEFALDEDGFAHVGRVLRMGEGEQIRVFNGDGKDYLADIVSAGKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           +  KV     +Q++     ++   I + +R+D+ +QKSVE+G+  I P+ +         
Sbjct: 62  LTVKVVAVEDNQSESPLHLHLGQVISRGDRMDFTLQKSVELGVNTITPLFSERCGVKLSG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + + +   ISA EQC   T+P + P   L                 E C  + S
Sbjct: 122 ERLDKKIAQWQKIVISACEQCGRATVPVVRPVMDLA----------------EWCAEQTS 165

Query: 178 LEKL-------HAIAHI----PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRS 226
             KL       H I  +    P V +LIGPEGG  +EE     +  F T + LGPR+LR+
Sbjct: 166 ALKLNLHPRADHGINGLVLDNPRVRLLIGPEGGLSAEEIAMTETHKF-TEVLLGPRVLRT 224

Query: 227 DTAAVAAMALVQAICGD 243
           +TAA+ A+  +Q   GD
Sbjct: 225 ETAALTAITALQMKFGD 241


>gi|302188983|ref|ZP_07265656.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           syringae 642]
          Length = 239

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 113/247 (45%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEYQSRSQTKQSDVQYIF---SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+       +   V  I       +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLNESFAGQVESVLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K  + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLTEWIKQTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|119358138|ref|YP_912782.1| 16S ribosomal RNA methyltransferase RsmE [Chlorobium
           phaeobacteroides DSM 266]
 gi|119355487|gb|ABL66358.1| protein of unknown function DUF558 [Chlorobium phaeobacteroides DSM
           266]
          Length = 248

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 120/230 (52%), Gaps = 17/230 (7%)

Query: 19  KTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRS--Q 76
           +T+    GD++H+L  V+R K GD +LL +G    +  +I  +GK  R   +  +RS   
Sbjct: 15  RTEIALEGDEFHHLVRVVRKKPGDEVLLTDGNGSRFHVRIREIGKQ-RLTADILTRSIYP 73

Query: 77  TKQSDVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRT 129
              + V    S +KT +R D  ++K+ E+G+ AI P+IT  T      +     +DR + 
Sbjct: 74  PSPTAVTVAMSLLKTPHRFDLFLEKATELGVTAIIPMITARTIALPPKERIQGKLDRWQG 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             +SA+ Q   L LP I+ P +   +L   +++ +I+ A E+   +N L          N
Sbjct: 134 IVLSASRQSKRLFLPRIHEPLSFAKVLDRDEYDLRIL-AHESS-EQNPLIDFAE----KN 187

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           V  +IGPEGG+ SEE     S   V   SLG  ILR++TA V A+A+V+A
Sbjct: 188 VLFMIGPEGGFTSEEVSRARSCG-VLESSLGHTILRAETAGVFAVAMVRA 236


>gi|262368644|ref|ZP_06061973.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316322|gb|EEY97360.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 238

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 127/242 (52%), Gaps = 21/242 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           + R F++  L +    + +   +H+   VLR + G+   LFNG+ GE+   +S V  KS 
Sbjct: 1   MPRFFMEAELNVDHTVELTETVFHHWVKVLRAQVGETATLFNGQGGEYEVTLSDVAKKSA 60

Query: 66  RFKVEY---QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTH 121
             +V      +R+   ++ +  + S  K +R+DY+IQK+VE+G+  I+ + + R      
Sbjct: 61  SVQVTAFNPTNRTPAFKALLGQVMS--KGDRMDYVIQKAVELGVSEIQLLTSERCEMRLK 118

Query: 122 YNMDRVRT-----YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           Y+ D+ +        I+A EQC +  +P I  P +LE  L +     ++V A        
Sbjct: 119 YDRDQKKIDHWQGIAIAACEQCGMNLVPKILAPVSLEKWLASELPATRLVLAPNK----- 173

Query: 177 SLEKLHAIAH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
             EKL  +AH  PN+A+LIGPEGG    E  T +   F++   +G R+LR++TA V A++
Sbjct: 174 --EKLDVLAHATPNIALLIGPEGGLSEAEIITANEHGFIS-WCIGERVLRTETAPVVALS 230

Query: 236 LV 237
           ++
Sbjct: 231 IL 232


>gi|78486164|ref|YP_392089.1| hypothetical protein Tcr_1823 [Thiomicrospira crunogena XCL-2]
 gi|78364450|gb|ABB42415.1| Conserved hypothetical protein with DUF 558 [Thiomicrospira
           crunogena XCL-2]
          Length = 245

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 117/227 (51%), Gaps = 16/227 (7%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF- 86
           Q HY   VLR+K+   I +F+GK  +  + +   G+        +  S   +S +Q +  
Sbjct: 24  QAHYALTVLRLKDQRPIEVFDGKGHQAHATLQVTGRKTADVFIERCESVNTESPLQTVLL 83

Query: 87  -SPIKTNRLDYMIQKSVEMGMGAIRPVITRY--TQNTHYNMDRVRT----YTISAAEQCD 139
               K +R+DY IQKSVE+G+ AI+P+ T     + T   +D+ RT      I+A EQ +
Sbjct: 84  QGISKGDRMDYTIQKSVELGVTAIQPLFTERCDVKLTGDRLDKKRTQWQDIAINACEQSN 143

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
              +P + PP +    L        +V +     +E++L+ L +     +V +LIGPEGG
Sbjct: 144 RNVVPAVLPPLSYSDWLSTQTLVSGLVLSPT---AEHTLQTLPSSLSEQSVHLLIGPEGG 200

Query: 200 YHSEE--KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              EE  + T   L   TP+ LGPRILR++TA V  ++ +Q + GD+
Sbjct: 201 LTDEEVLQGTQKGL---TPIQLGPRILRTETAGVVVLSALQTLWGDF 244


>gi|282891340|ref|ZP_06299842.1| hypothetical protein pah_c050o135 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498837|gb|EFB41154.1| hypothetical protein pah_c050o135 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 241

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 123/238 (51%), Gaps = 15/238 (6%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR- 66
           +R ++  P    ++    G ++H+L HV+R + G+++ + NG+ G   + + ++ K    
Sbjct: 4   ERYYIPQPFQKGSELIIEGQEFHHLVHVMRTQVGESVEVVNGEGGFGHAVLEHLEKKRAI 63

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITR---YTQNTHYN 123
           F+VE   +      +V    +  K NRLD++++K  E+GM       ++     Q T + 
Sbjct: 64  FRVEETVQHPKPAFEVILAQAIPKINRLDFILEKGTELGMTQFWLFPSQRGERKQLTEHQ 123

Query: 124 MDRVRTYTISAAEQCDILTLPFIY--PPTTLEFLLKNWDHNCQI--VFADETCGSENSLE 179
           ++R+R  +I+A +QC    LP I   PP      L+ W+ N  +  +F +    + + +E
Sbjct: 124 IERMRALSIAAMKQCGSFYLPTILMKPP------LEKWERNLPLPALFGNVQPDAPSCVE 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           KL        V   +GPE G+  EE++TL +L  V  + L P ILR+DTAA+AA+  +
Sbjct: 178 KLKQERFQNGVIFFVGPESGFSYEEEKTLQALD-VEGVKLHPHILRTDTAAIAALCAI 234


>gi|241668207|ref|ZP_04755785.1| 16S rRNA m3U1498 methyltransferase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876742|ref|ZP_05249452.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842763|gb|EET21177.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 241

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 120/231 (51%), Gaps = 16/231 (6%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQT 77
           T+   SG+ Y+Y  +VLR+K+ D I LFN  DG ++ ++I  +  KSI  +V  +     
Sbjct: 16  TELSISGEYYNYFKNVLRLKKSDFIELFNNNDGFQYKTQIIDINNKSILLEVIEKKEIHN 75

Query: 78  KQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQN------THYNMDRVRTY 130
           +   +  I+   IK    ++++QK+ E+G+  I P+IT YT +          ++R    
Sbjct: 76  ENKYIVNIYQAIIKNENFEFIVQKATELGVNNIYPIITEYTNHKFDKKGFDKKLERWNKI 135

Query: 131 TISAAEQCDILTLPFIYPPTTLEFL-LKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
            I+AAEQC  + +P I+ P  +  + L N   N  +     T  +  +L K H       
Sbjct: 136 AIAAAEQCGRVFIPKIHYPIEINSIHLSNSHINIALCPYSNTPENFENLIKTH-----DK 190

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
             I IGPEGG+ ++E E   +  F T ++LG RIL+++TA +  +A++  +
Sbjct: 191 FNIFIGPEGGFSNKEMELFKTKDFNT-INLGKRILKAETAPINILAIINFV 240


>gi|254230223|ref|ZP_04923615.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393236|ref|YP_003285090.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. Ex25]
 gi|151937255|gb|EDN56121.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262336830|gb|ACY50625.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. Ex25]
          Length = 243

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 113/233 (48%), Gaps = 26/233 (11%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRMKEG ++LLF+G   E+ + IS V K     +I  +VE    S    
Sbjct: 21  SDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISEVSKKTVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TY 130
              Q I    + +++++ IQKSVE+G+  I P+I   ++     +D+ R           
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKI 134

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
            ISA EQC    +P I P  +LE   K      ++        S N+L        +  V
Sbjct: 135 AISACEQCGRNVVPEIRPIMSLEEWCKEEYDGLKLNLHPRANYSINTLP-----TPVEKV 189

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 190 RLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|82701513|ref|YP_411079.1| hypothetical protein Nmul_A0379 [Nitrosospira multiformis ATCC
           25196]
 gi|82409578|gb|ABB73687.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 255

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 124/236 (52%), Gaps = 27/236 (11%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSP 88
           H+ A VLR++ GD ++LFNG  GE+   I    K  +   VE   + + ++S +  + + 
Sbjct: 26  HHAARVLRLEAGDEVVLFNGDGGEFTCVILRASKQGVDVVVERHVQVE-RESPLTILLAQ 84

Query: 89  --IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDI 140
                 ++D+++QK+VE+G+  I+P+IT+ +      +     +  ++   ISA EQC  
Sbjct: 85  AVCMGEKMDWIVQKAVELGVTRIQPLITKQSVVRLGGERGEKRVSHLQKVVISACEQCGR 144

Query: 141 LTLPFIYPPTTLEFLLKNW---DHNCQIVFAD----ETCG-----SENSLEKLHAIAHIP 188
             +P + P  TL    +NW       + + +D    + C      +   L      ++I 
Sbjct: 145 NHVPEVLPLATL----RNWLGRQTEARRMSSDSLSPDACFMLSPFATKGLRDFKHSSNIG 200

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           ++ +L+GPEGG+  +E+       F+ PL LG RILR+++AA+AA+  +QA+ GD+
Sbjct: 201 SIILLVGPEGGFTQDEEAAAMVAGFI-PLRLGHRILRTESAALAAVGAMQALWGDY 255


>gi|261250170|ref|ZP_05942746.1| ribosomal RNA small subunit methyltransferase E [Vibrio orientalis
           CIP 102891]
 gi|260939286|gb|EEX95272.1| ribosomal RNA small subunit methyltransferase E [Vibrio orientalis
           CIP 102891]
          Length = 258

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 117/244 (47%), Gaps = 48/244 (19%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRMKEG  +LLF+G   E+ ++I+ V K     SI  +VE  S S    
Sbjct: 36  SDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAEIASVSKKNVEVSIIQRVERSSESPLDL 95

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TY 130
              Q +    + +++++ IQKSVE+G+  I P+I   ++     +D+ R           
Sbjct: 96  HLGQVVS---RGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKI 149

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HA 183
            ISA EQC   T+P I P   LE                E CG E    KL       ++
Sbjct: 150 AISACEQCGRNTVPEIRPIMQLE----------------EWCGEEYDGLKLNLHPRAKYS 193

Query: 184 IAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           I  +P     V +LIGPEGG  +EE     +  F   L LGPR+LR++TAA+ A+  +Q 
Sbjct: 194 INTLPTPVEKVRLLIGPEGGLSAEEIGMTENYKFEETL-LGPRVLRTETAALTAITALQV 252

Query: 240 ICGD 243
             GD
Sbjct: 253 RFGD 256


>gi|289578110|ref|YP_003476737.1| hypothetical protein Thit_0897 [Thermoanaerobacter italicus Ab9]
 gi|289527823|gb|ADD02175.1| protein of unknown function DUF558 [Thermoanaerobacter italicus
           Ab9]
          Length = 245

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 131/246 (53%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G   E+ + I  V K+ +
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDG-STEYQTSIYGVEKNRV 59

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNT 120
              +E + +S T+ S    +F  + K+++++ +IQK  E+G+    P+ITRY+    +N+
Sbjct: 60  ILFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNS 119

Query: 121 HYN--MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
           + N  ++R    +  A +Q    +LP I  P +    LK  +     +   E   +    
Sbjct: 120 NLNKKIERWNKISREACKQSGRTSLPEICMPISFGEALKRIEEFDLCIIPYEKEKTLKLK 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPL-SLGPRILRSDTAAVAAMALV 237
           E L  + +I  VAI +GPEGG+  EE +   +L +   L SLGPRILR++TAA++  ++V
Sbjct: 180 EVLDGVKNIKKVAIFVGPEGGFSEEEVDL--ALRYSAKLVSLGPRILRTETAAISVCSIV 237

Query: 238 QAICGD 243
               GD
Sbjct: 238 MYELGD 243


>gi|330899324|gb|EGH30743.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 239

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 118/247 (47%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPIPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|330942525|gb|EGH45109.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 239

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 118/247 (47%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|66043720|ref|YP_233561.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           syringae B728a]
 gi|63254427|gb|AAY35523.1| Conserved hypothetical protein 46 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330971683|gb|EGH71749.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 239

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 118/247 (47%), Gaps = 19/247 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEY-QSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V+  +S +   +S ++        +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+ P  L   +K+ + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++ 
Sbjct: 174 AEPLTSHDKPASLAFLIGPEGGLNDAEVTQAQDAGFHAA-RLGPRVLRTETAPVVALSVA 232

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 233 QQLWGDF 239


>gi|71280059|ref|YP_267997.1| 16S ribosomal RNA methyltransferase RsmE [Colwellia psychrerythraea
           34H]
 gi|71145799|gb|AAZ26272.1| conserved hypothetical protein TIGR00046 [Colwellia psychrerythraea
           34H]
          Length = 244

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 123/253 (48%), Gaps = 29/253 (11%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYVG-KSIR 66
           R+F      +      S D + ++  VLR+KEGD I LFNG++  ++ + +  V  KS  
Sbjct: 5   RIFQQSQFALNETVPLSDDAFGHVVRVLRLKEGDTITLFNGEEAFQYTATLCNVSKKSAD 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
            KV  Q  + ++     ++   I + +R+D+ +QKSVE+G+  I P+ T        N +
Sbjct: 65  VKVTSQEENNSESPLNIHLGQGISRGDRMDFTLQKSVELGVNTITPLFTERC-GVKLNAE 123

Query: 126 RV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
           R+       +   ISA EQ    ++P +  P     LL +W          ET   + +L
Sbjct: 124 RLEKKRQQWQKIVISACEQSGRASVPIVAEP----MLLADW-------LKQETSALKINL 172

Query: 179 --EKLHAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
             +  H+I  +P     V +LIGPEGG   EE    +   F   L LGPR+LR++TAA+ 
Sbjct: 173 HPKAQHSIMSLPMENTRVRLLIGPEGGLSDEEITQANDSDFHDVL-LGPRVLRTETAALT 231

Query: 233 AMALVQAICGDWY 245
           A+  +Q   GD +
Sbjct: 232 AITALQCRFGDLH 244


>gi|330721278|gb|EGG99366.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC2047]
          Length = 241

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 122/248 (49%), Gaps = 22/248 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R+F+D PL    Q +   +  HYL  VLR+     + +FNG+ GE+ ++I    K ++
Sbjct: 3   IPRIFIDLPLNEHQQVELPRETSHYLNRVLRLPVDAQLRVFNGQGGEYQAQICAANKNAV 62

Query: 66  RFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
              +  + +   +    +    +  K +R+D+++QK+ E+G   I+ +   Y++ T   +
Sbjct: 63  SLAIGAFSAEDNSSPLHIHLGIALSKGDRMDFVVQKATELG---IKEISLLYSERTEVKL 119

Query: 125 DRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
              R            ISA EQC    +P I+ PT L   L+      +++      G++
Sbjct: 120 KGEREEKRLQHWQKVAISACEQCASNHVPTIHAPTPLNQWLEERHETVKLIMQP---GTD 176

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
              ++     +   VA+L+GPEGG+   E    +   F   LSLGPRILR++TA + A++
Sbjct: 177 QPFKQ----DNPGKVALLVGPEGGFSESEVNAANQAGF-NNLSLGPRILRTETAPLVAIS 231

Query: 236 LVQAICGD 243
           ++Q   GD
Sbjct: 232 ILQHHWGD 239


>gi|330446905|ref|ZP_08310556.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491096|dbj|GAA05053.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 243

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 126/246 (51%), Gaps = 30/246 (12%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QGK   S D  +++  V+RM+ G  +L+F+G D E+ + I+   K    +VE Q
Sbjct: 9   PESLPSQGKVMLSDDAANHVGRVMRMQAGQELLMFDGSDAEFPAVITSASKK-SVEVEIQ 67

Query: 73  SRSQ-TKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYN 123
           SR + + +S +      +  + +++++ IQKSVE+G+  I P+I+         +     
Sbjct: 68  SRVEHSVESPLNIHLGQVISRGDKMEFTIQKSVELGVSTITPLISERCGVKLNAERFEKK 127

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKL 181
           +D+ +   I+A EQC    +P I P   LE     W   C    A+E  G + +L     
Sbjct: 128 LDQWQKIAIAACEQCGRNVVPTIRPVMKLE----QW---C----AEEYDGLKLNLHPRAK 176

Query: 182 HAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           ++I  +P    NV +LIGPEGG  +EE        F   L LGPR+LR++T A+ A+  +
Sbjct: 177 YSINTLPTPVTNVRLLIGPEGGLSAEEIGMTEEYKFDEIL-LGPRVLRTETTAMTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|254482677|ref|ZP_05095915.1| conserved hypothetical protein TIGR00046 [marine gamma
           proteobacterium HTCC2148]
 gi|214037036|gb|EEB77705.1| conserved hypothetical protein TIGR00046 [marine gamma
           proteobacterium HTCC2148]
          Length = 243

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 114/229 (49%), Gaps = 29/229 (12%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSD--VQYIFS 87
            +LA  LRM+E   ++LF+G+ GE+ + I+ VGK     +  Q      +S   +    S
Sbjct: 26  QHLARALRMQEAGQLILFDGRGGEYPATITSVGKKCVSVLTGQRHDIEVESPLAIHLGIS 85

Query: 88  PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAAEQCDI 140
             +  R+D++IQK+ E+G+  + P++T  T+      DR        +   ISA EQC  
Sbjct: 86  ISRGERMDWVIQKATELGVTHVSPLLTERTE-VKLKADRAEKKRQHWQQIAISACEQCGR 144

Query: 141 LTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP-NVAILIGPEGG 199
             LP I P T L   L +     ++V         +  E L A +  P ++ +LIGPEGG
Sbjct: 145 NRLPVINPLTLLPKWLNDSQAELKLVL-------HHRAENLSAQSTPPRSIDLLIGPEGG 197

Query: 200 Y-----HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
                 H  E+   H+      L LG R+LR++TA +AA++++QA  GD
Sbjct: 198 LSPDEIHLAEQRAFHA------LRLGDRVLRTETAPLAALSILQARWGD 240


>gi|208779920|ref|ZP_03247264.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|208744375|gb|EDZ90675.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 242

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 121/225 (53%), Gaps = 14/225 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNNDSLQYKTKIIAIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IKT   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKTENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ + A   N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSSA---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++  +
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIINFV 240


>gi|304313284|ref|YP_003812882.1| Protein of unknown function (DUF558) [gamma proteobacterium HdN1]
 gi|301799017|emb|CBL47260.1| Protein of unknown function (DUF558) [gamma proteobacterium HdN1]
          Length = 248

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 113/245 (46%), Gaps = 14/245 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R+F + PL   T+   +    H++  VLRMK GD +LLFNG  GE+  +I   GK  +
Sbjct: 3   IPRIFQEIPLLEGTKVTLTESGSHHVTQVLRMKPGDQVLLFNGTGGEYFGEIEATGKRGV 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQ------ 118
              + Y +          ++   I K  R DY IQK+VE+G+  I P+ +R  +      
Sbjct: 63  EVLLTYFNEVDRASPLSVHLGQVIGKGERFDYAIQKAVELGVTEITPLFSRRCEVKLNGP 122

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + + +   ++A EQ  +  +P I+ P      L  W    Q   A     +E   
Sbjct: 123 RLDKKLQQWKHLAVAACEQSGLNIIPQIHAPVA----LAEWAETVQ-ADARWILHTEGEP 177

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                     ++A  +GPEGG+   E  ++    F   +S+GPRI R++TA V  ++L+Q
Sbjct: 178 HNPFTQQAPQSLAFAVGPEGGFEDTEVSSVRERGFDC-VSMGPRIWRTETAPVVMLSLLQ 236

Query: 239 AICGD 243
              GD
Sbjct: 237 YHWGD 241


>gi|56750741|ref|YP_171442.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus elongatus
           PCC 6301]
 gi|81299617|ref|YP_399825.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus elongatus
           PCC 7942]
 gi|56685700|dbj|BAD78922.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168498|gb|ABB56838.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 243

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 117/246 (47%), Gaps = 20/246 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L+RL++        +   + DQ HYL  VLR+K GD   + +G+ G W +++    +  
Sbjct: 4   ELRRLWLPPEQLQGDRWSLTADQRHYLQRVLRLKPGDRCAVIDGQGGLWTAELG--DRDQ 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ--NTHYN 123
            F V         Q  +  I S +     D +I+++ E+G+  I+PVI+  +Q       
Sbjct: 62  LFPVGAVPVLPPAQPRLTLIQS-LPKQGFDEVIRQATELGVTTIQPVISDRSQVRPEAQK 120

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE---TCGSENSLEK 180
            DR R   I A+EQ + L LP + P       ++ W      + AD     C +  SL  
Sbjct: 121 TDRWRKIAIEASEQSERLYLPQLEP-------IRLWSEAIAQIPADSLRCICLARRSLPN 173

Query: 181 ----LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L A     ++AI IGPEGG+   E E   ++ + TP+SLG  ILR+ TA + A++L
Sbjct: 174 LLPWLQAQPAWTDLAIAIGPEGGWSDAEIEQAIAVGW-TPVSLGSSILRAVTAPIVALSL 232

Query: 237 VQAICG 242
            QA+  
Sbjct: 233 AQAVAA 238


>gi|319787981|ref|YP_004147456.1| hypothetical protein Psesu_2392 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466493|gb|ADV28225.1| protein of unknown function DUF558 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 243

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 121/247 (48%), Gaps = 15/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L R  V+ PL   +         ++L  VLR++EG++ +LFNG   ++ ++++ V K  
Sbjct: 2   RLTRCHVELPLQPGSTITLPEHAANHLVRVLRLREGESCVLFNGDGHDYAARLASVTKRE 61

Query: 66  RFKVEYQSRSQTKQSDVQYIF--SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                  + +   +S ++ +      +  ++D ++QK+ E+G+ AI PV    T+    +
Sbjct: 62  VSAEVLSATAVDNESPLRIVLLQGIARGEKMDLILQKATELGVAAIVPVNGERTE-VRLD 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R        R+   SA EQ     +P + PP +LE        +   +  D     E+
Sbjct: 121 AERAQKRLAHWRSVVESACEQSGRARVPEVQPPASLETAAATLPGDALRLLLDPQ--GEH 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +   A    V + IGPEGG+   +++ L +  F + L LGPR+LR++TA +AA+A 
Sbjct: 179 RLASMQPDAS--TVVVAIGPEGGWSPRDRQALQAAGF-SGLRLGPRVLRTETAGLAAIAA 235

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 236 LQARFGD 242


>gi|167627639|ref|YP_001678139.1| 16S ribosomal RNA methyltransferase RsmE [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597640|gb|ABZ87638.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 241

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 118/231 (51%), Gaps = 16/231 (6%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQT 77
           T+   +G+ Y+Y  +VLR+K+ D I LFN  DG ++ ++I  +  K+I  +V  +     
Sbjct: 16  TKLSITGEYYNYFKNVLRLKKSDFIELFNNNDGFQYKAQIIDINNKNILLEVIEKKEIHN 75

Query: 78  KQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQN------THYNMDRVRTY 130
           +   +  I+   IK    +++IQK+ E+G+  I P+IT YT +          ++R    
Sbjct: 76  ENKYIVNIYQAIIKNENFEFIIQKATELGVNNIYPIITEYTNHKFDKKGFDKKLERWNKI 135

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN- 189
            I+AAEQC  + +P I+ P  +     N  H          C   N+ E    +    + 
Sbjct: 136 AIAAAEQCGRVFIPKIHNPIEI-----NSIHLSDSYMNIALCPYSNTPENFENLIKTHDK 190

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
             I IGPEGG+ ++E E   +  F T ++LG RIL+++TA V+ +A++  +
Sbjct: 191 FNIFIGPEGGFSNKEMELFKTKDFNT-INLGKRILKAETAPVSILAIINFV 240


>gi|288939950|ref|YP_003442190.1| hypothetical protein Alvin_0191 [Allochromatium vinosum DSM 180]
 gi|288895322|gb|ADC61158.1| protein of unknown function DUF558 [Allochromatium vinosum DSM 180]
          Length = 248

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 120/250 (48%), Gaps = 17/250 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L RL VD  L    +      Q  +   VLR++    ++LFNG   ++ + +   G+  
Sbjct: 2   RLTRLHVDLDLRPGAEIDLPSAQARHAVQVLRLERDAPLVLFNGDGHDYSACLVEPGRD- 60

Query: 66  RFKVEYQSRSQTK---QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
           R +V  +SR   +   + D+       K  R+D+ IQK+VE+G+  I P+ TR  Q    
Sbjct: 61  RVRVLVESRGDPELESRLDIHLALGISKGERMDFAIQKAVELGVTRITPLFTRRAQVRLD 120

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK--NWDHNCQIVFADETCGS 174
                  ++  +   ++A EQ     LP + P   LE  L+  + D     +  D    +
Sbjct: 121 GARLDKRLEHWQGVVVAACEQSGRRRLPTLEPAGGLEAWLETAHGDGFAGGLLLDPL--A 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           E +L  L A      + +LIGPEGG    E+E      F   + LGPRILR++TA +AA+
Sbjct: 179 ERALPALPAPES--GLTLLIGPEGGLDPREREAARRHGFQG-VRLGPRILRTETAPLAAI 235

Query: 235 ALVQAICGDW 244
           A++QA+ GD+
Sbjct: 236 AVIQALWGDF 245


>gi|205374146|ref|ZP_03226946.1| 16S rRNA m3U1498 methyltransferase [Bacillus coahuilensis m4-4]
          Length = 248

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 111/227 (48%), Gaps = 13/227 (5%)

Query: 23  KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQSRSQTKQS 80
           +  GD +H++  V+RMKEGD+ L     +   + KI  +         VE++  S     
Sbjct: 15  RVKGDDFHHMIRVMRMKEGDSFLSVFQDNKSAICKIEEISNDSLTASVVEWELNSTEMPV 74

Query: 81  DVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPVITRYTQNTHYNMDRVRTYTISA 134
            +  +    K ++L+ +IQK  E+G        A R ++    +  H  ++R       A
Sbjct: 75  RITIVSGLPKGDKLESIIQKGTELGATEFIPFKATRSIVKWDDKKAHKKIERFEKIAKEA 134

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQ--IVFADETCGSENSL--EKLHAIAHIPNV 190
           AEQ    T+PFI  P TL+ +L+    N    + F +E    E+S   E+L  + +  ++
Sbjct: 135 AEQSHRRTIPFISEPKTLKQILQTVPSNAVKLVAFEEEAKQGESSQFKEELQKVQNGDHI 194

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            ++ GPEGG   EE   L +  F++   LGPRILR++TA + A+A +
Sbjct: 195 MMIFGPEGGLTEEEVHELKNHDFIS-CGLGPRILRTETAPLYALAAI 240


>gi|108760347|ref|YP_629393.1| hypothetical protein MXAN_1133 [Myxococcus xanthus DK 1622]
 gi|108464227|gb|ABF89412.1| conserved hypothetical protein TIGR00046 [Myxococcus xanthus DK
           1622]
          Length = 244

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 107/226 (47%), Gaps = 7/226 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF   P     + + +G++ HYL HVLR++EGD + +F+GK   + +++++V   +   
Sbjct: 3   RLFAPLPEPAPAEVELTGERRHYLLHVLRLEEGDALEVFDGKGRAFEARVAHVTPDVVRV 62

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHY 122
               +R    + +V  +    K ++L+ ++QK  E+G  A  PV T  +      +    
Sbjct: 63  TLGTARVAPPRREVSILQGLPKGDKLELVLQKGTELGATAFHPVATARSVVKLEPKRAEE 122

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
              R       AA QC    +P +  P  L    ++      ++  DE   +    E   
Sbjct: 123 RTSRWTKIVEEAARQCRRDDVPRVATPAPLLDAARSLTAGTVLLVLDEEESAVPLGEAFR 182

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           A      VA++IGPEGG   EE + L +L    P++LG RILR++T
Sbjct: 183 AAGAGTAVALVIGPEGGLAREEVDALMAL-GARPVTLGKRILRTET 227


>gi|15836795|ref|NP_297483.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa 9a5c]
 gi|9104989|gb|AAF83003.1|AE003872_14 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 244

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 121/250 (48%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++   G+  
Sbjct: 2   RLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRRE 61

Query: 65  ----IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
               I    E  + S    + VQ I    +  ++D + QK+ E+G+ AI PV T  +   
Sbjct: 62  AWARIEGVSEVCNESPLAITLVQAIA---RGEKMDLIAQKATELGVVAIVPVDTERS-GV 117

Query: 121 HYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
             + +RV           ISA EQC    +P +  P  L+ L +    +   +  D    
Sbjct: 118 RLDSERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQALPEILHPDTLRLILDPK-- 175

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           SE+ L  L  +  +  V I IGPEGG+   + E L    F+   SLGPRILR++TA + A
Sbjct: 176 SEHRLSTLSRLTPV-AVTIAIGPEGGWSPRDLEILKDAGFIG-FSLGPRILRTETAGLTA 233

Query: 234 MALVQAICGD 243
           +A++QA  GD
Sbjct: 234 IAVLQAQLGD 243


>gi|269965751|ref|ZP_06179848.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269829619|gb|EEZ83856.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 243

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 113/233 (48%), Gaps = 26/233 (11%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRMKEG ++LLF+G   E+ + IS V K     +I  +VE    S    
Sbjct: 21  SDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISDVSKKSVLVNITERVESSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TY 130
              Q I    + +++++ IQKSVE+G+  I P+I   ++     +D+ R           
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKI 134

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
            ISA EQC    +P I P  +LE   +      ++        S N+L        +  V
Sbjct: 135 AISACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSINTLP-----TPVEKV 189

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 190 RLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|315127638|ref|YP_004069641.1| hypothetical protein PSM_A2576 [Pseudoalteromonas sp. SM9913]
 gi|315016152|gb|ADT69490.1| hypothetical protein PSM_A2576 [Pseudoalteromonas sp. SM9913]
          Length = 244

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 119/240 (49%), Gaps = 20/240 (8%)

Query: 15  PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQ 72
           P+ + T      D   ++  VLRMK G+ + +FNG+ GE+LS+I  V K   +   +E+ 
Sbjct: 11  PIALNTPLNLDDDAAGHVGRVLRMKVGEQVSMFNGEGGEFLSEIIEVSKKTVVVMPLEFN 70

Query: 73  SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV----- 127
                    +       + +++D+ IQKSVE+G+  I P+ ++       + DR+     
Sbjct: 71  PHDVESPLKIHLGQCVSRGDKMDFTIQKSVELGITEITPIFSQRC-GVKLSGDRLEKKHQ 129

Query: 128 --RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
             +   I+AAEQ     +P I PP  L+  L+      ++        +E+S++ +    
Sbjct: 130 QWQKIAIAAAEQSGRNFVPIINPPVDLKHWLEQQTDAIKLTLHPR---AEHSIKTI---- 182

Query: 186 HIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +P+  V  L+GPEGG+  +E        FV  + LGPR+LR++TAA+  ++ +Q   GD
Sbjct: 183 TVPDGGVRFLVGPEGGFTDDEMAQTKQQEFVD-IRLGPRVLRTETAALTVLSALQLQFGD 241


>gi|91228680|ref|ZP_01262594.1| hypothetical protein V12G01_13994 [Vibrio alginolyticus 12G01]
 gi|91187751|gb|EAS74069.1| hypothetical protein V12G01_13994 [Vibrio alginolyticus 12G01]
          Length = 243

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 113/233 (48%), Gaps = 26/233 (11%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRMKEG ++LLF+G   E+ + IS V K     +I  ++E    S    
Sbjct: 21  SDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISDVSKKSVLVNITERLENNIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TY 130
              Q I    + +++++ IQKSVE+G+  I P+I   ++     +D+ R           
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKI 134

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
            ISA EQC    +P I P  +LE   K      ++        S N+L        +  V
Sbjct: 135 AISACEQCGRNVVPEIRPIMSLEEWCKEEYDGLKLNLHPRAKYSINTLP-----TPVEKV 189

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 190 RLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|325922372|ref|ZP_08184146.1| hypothetical protein TIGR00046 [Xanthomonas gardneri ATCC 19865]
 gi|325547154|gb|EGD18234.1| hypothetical protein TIGR00046 [Xanthomonas gardneri ATCC 19865]
          Length = 244

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 122/249 (48%), Gaps = 18/249 (7%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            L R  V  PL    +     +  ++L  VLR++EGD  +LFNG   ++ ++I+  GK  
Sbjct: 2   RLTRSHVALPLHCDQEVTLPEESANHLLRVLRLREGDACILFNGDGSDYHARITLAGKRE 61

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
              +  +++    +S   +  I    +  ++D ++QK+ E+G+ AI PV     + T   
Sbjct: 62  ARAMLERAQPLCNESPLSITLIQGIARGEKMDLILQKATELGVAAIVPV---NAERTEVK 118

Query: 124 MD------RV---RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D      RV   R+  ISA EQ     +P +  P  L+   +  D +   +  D     
Sbjct: 119 LDPARMEKRVTHWRSVVISACEQSGRARVPTVAAPLGLQDAAQASDPHALRLTLDPH--G 176

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           E+ L  L  +A    V + IGPEGG+   ++  L    F + L LGPRILR++TA +AA+
Sbjct: 177 EHRLATL-PVAAQQRVIVAIGPEGGWSPRDRAILGEAGF-SGLQLGPRILRTETAGLAAI 234

Query: 235 ALVQAICGD 243
           A +Q+  GD
Sbjct: 235 AALQSRFGD 243


>gi|326797241|ref|YP_004315061.1| ribosomal RNA small subunit methyltransferase E [Marinomonas
           mediterranea MMB-1]
 gi|326548005|gb|ADZ93225.1| Ribosomal RNA small subunit methyltransferase E [Marinomonas
           mediterranea MMB-1]
          Length = 243

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 118/248 (47%), Gaps = 19/248 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++VD  L   T+       + +   VLR+KEG  I+LFNG  GE+ + +  V K   
Sbjct: 3   IPRIYVDIDLTEHTEIILPDSAFQHCCKVLRLKEGHAIILFNGDGGEYDATLYNVQKRAA 62

Query: 67  FKVEYQSRSQTKQSDVQYIF--SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
                  R    +S ++     S  +  R+DY IQK+VE G+  I+P+ +   +      
Sbjct: 63  SAQLTTYRVLENESPLKVTIGQSLSRGERMDYAIQKAVESGVFRIQPLFSERCE-VKLQE 121

Query: 125 DRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           DR+       +   ISAAEQC    +P I  P      L +W   C  +   +     +S
Sbjct: 122 DRMEKRLKHWQQVAISAAEQCGRGVVPKILEPIN----LLDWVEKCNEML--KITLHHHS 175

Query: 178 LEKLHAIAHIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            + +H     P  ++A+LIGPEGG    E E      F + ++LGPR+LR++TA V A+ 
Sbjct: 176 AKPIHDFERPPENSIALLIGPEGGLTDIEVEKASLFGFQS-IALGPRVLRTETAPVVALT 234

Query: 236 LVQAICGD 243
            +  + GD
Sbjct: 235 TLNLMWGD 242


>gi|118594425|ref|ZP_01551772.1| hypothetical protein MB2181_02115 [Methylophilales bacterium
           HTCC2181]
 gi|118440203|gb|EAV46830.1| hypothetical protein MB2181_02115 [Methylophilales bacterium
           HTCC2181]
          Length = 246

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 122/230 (53%), Gaps = 25/230 (10%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSR-SQTKQSD--VQYIF 86
           H+  +V+R+K  D I+LFN    ++ ++I  + K+ R +V  QS+ +  K SD  ++ I 
Sbjct: 24  HHATNVMRLKLSDKIILFNNDVYDFGAEIIRISKN-RVEVVIQSKIANRKDSDLKIRLIQ 82

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAAEQCD 139
           S   T ++D++IQKSVE+G+  I P+ ++ +     N DR        +    SA EQC 
Sbjct: 83  SISSTEKMDWIIQKSVELGVHTIVPIFSQRSI-IKLNNDRAEKKLSHWKQIIQSACEQCG 141

Query: 140 ILTLPFIYPPTTLEFL-----LKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN-VAIL 193
              +P I+ P   +       + N DH   I+    +  ++NS   +  I   P+ + I+
Sbjct: 142 RSKVPEIFIPKKFDAFWSNETISNKDHLKLIL----SPLAKNSFRTISTIK--PSAIDIM 195

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  EE        F+ P  +GPRILR++TA +A +AL+Q   GD
Sbjct: 196 IGPEGGFSEEEVVNAEKNGFI-PFEIGPRILRTETAPLAMLALLQYKYGD 244


>gi|88705487|ref|ZP_01103198.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700577|gb|EAQ97685.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 245

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 113/228 (49%), Gaps = 25/228 (10%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS--DVQYIFS 87
            ++A  LRM+ GD++ LF+G   E   +IS + KS    +    +  T++S  D   I +
Sbjct: 26  RHIAKALRMRAGDSLCLFDGSGIEAHGEISDLDKSQVSVIVKSIQQPTRESPLDTVLIIA 85

Query: 88  PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TYTISAAEQC 138
             + +R+D ++QK+ E+G+  I P+I+   + T   +D  R            ISA EQC
Sbjct: 86  LSRGDRMDTVVQKATELGVTEIWPMIS---ERTGVRLDETRLARKRQHWERIAISACEQC 142

Query: 139 DILTLPFIYPPTTLEFLLK---NWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
               LP +  PT+ E  L+     D + +++    T    + L       H  ++ +L+G
Sbjct: 143 GRNRLPTVETPTSFEETLQRAAKGDDSLRLIL--HTSAHPSPLP-----THCKSLTLLVG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  EE        F   L +GPRILR++TA +  +AL QA  GD
Sbjct: 196 PEGGFSDEEVTAALDQGFCA-LQMGPRILRTETAPLVGLALAQARWGD 242


>gi|303238634|ref|ZP_07325167.1| protein of unknown function DUF558 [Acetivibrio cellulolyticus CD2]
 gi|302593753|gb|EFL63468.1| protein of unknown function DUF558 [Acetivibrio cellulolyticus CD2]
          Length = 247

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 127/248 (51%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++           +G+ Y+++  VLR+K  + + L +G   E++++I   G    
Sbjct: 1   MPRFFINSKDVFDDNINITGEDYNHIKKVLRLKCEEIVTLSDGIGNEYVAEIKDFGDGFV 60

Query: 67  FKVEYQSRSQTKQSDVQ---YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                +S   T +  ++   Y   P K++++D++IQKSVE+G+  I PV+T  T      
Sbjct: 61  HTKVIESYKNTTEPPIKVTLYQGLP-KSDKMDFIIQKSVELGISRIVPVLTERTVVRLDS 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            ++     +R    +  AA+QC+   +P I  P + +  +K   H+  +        S+N
Sbjct: 120 EKDAAKKCERWNRISQEAAKQCNRGIIPKIEVPISFKEAIKKV-HDVPLSLIPYEKESKN 178

Query: 177 SLEK-LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           SL++ L ++  I  V++ IGPEGG+  +E E   +    + ++LGPRILR++TA +  + 
Sbjct: 179 SLKQILKSVGDISEVSVFIGPEGGFTEQEIEEAVNCGL-SSVTLGPRILRTETAGITVLT 237

Query: 236 LVQAICGD 243
           ++    GD
Sbjct: 238 ILMYELGD 245


>gi|254373211|ref|ZP_04988700.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570938|gb|EDN36592.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 242

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 120/225 (53%), Gaps = 14/225 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNNDSLQYKTKIIAIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IKT   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKTENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++  I
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIINFI 240


>gi|148266299|ref|YP_001233005.1| 16S ribosomal RNA methyltransferase RsmE [Geobacter uraniireducens
           Rf4]
 gi|146399799|gb|ABQ28432.1| protein of unknown function DUF558 [Geobacter uraniireducens Rf4]
          Length = 246

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 124/230 (53%), Gaps = 15/230 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQ 83
           SGD + ++A VLR+K G +++L +G   E    I+ VG KS+  +VE    + T  +  +
Sbjct: 19  SGDLFRHMAKVLRLKAGTSVILADGAGRECTGVITAVGAKSLEIRVEEGPAAPTGDNGPR 78

Query: 84  ---YIFSPIKTNRLDYMIQKSVEMGMGAIRPV-----ITRYT-QNTHYNMDRVRTYTISA 134
              Y   P K ++L++++QK  E+G+  I P      I + T Q     ++R R     A
Sbjct: 79  ITLYQGMP-KGDKLEFIVQKCTELGVAEIVPFTAARSIAKVTHQRGMERIERWRRIATEA 137

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP-NVAIL 193
           A Q    T+P +     L  +L+   H+ +++  +E  G  N L++  +   IP ++A+L
Sbjct: 138 ARQSKRRTVPQVTLAENLSEVLQAAQHSVKLLLWEEEQG--NRLKETLSGLPIPESIAVL 195

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +GPEGG  +EE     +  F+ PLSLG RI+R++TA +  ++++Q   GD
Sbjct: 196 VGPEGGLTAEEAAAASACGFI-PLSLGKRIVRTETAGIIILSILQFYWGD 244


>gi|320450557|ref|YP_004202653.1| RNA methyltransferase, RsmE family [Thermus scotoductus SA-01]
 gi|320150726|gb|ADW22104.1| RNA methyltransferase, RsmE family [Thermus scotoductus SA-01]
          Length = 228

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 112/217 (51%), Gaps = 16/217 (7%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFS 87
           +  +L  VLR K GD   +F+  D E L+++  +G  +R+++  + R   ++  V+    
Sbjct: 19  ESRHLLEVLRAKVGDRFTVFD-VDREALAEVVELGPPVRYRI-LEERRPEREVGVEVALY 76

Query: 88  P--IKTNRLDYMIQKSVEMGMGAIRPVITRYT---QNTHYNMDRVRTYTISAAEQCDILT 142
           P  +K ++L  +++ + E+G   I+P++TR++   +     + R++   + AA+Q   L 
Sbjct: 77  PALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEMGEGKLKRLQAIAVEAAKQSGRLR 136

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           +P + PP  L  L K        V A         L K        ++A+ +GPEGG+  
Sbjct: 137 VPEVLPPIPLNALPKVEQGMVAHVGARSLVREVLDLGK--------SLALAVGPEGGFAE 188

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           EE E L    F TP+ LG RILR++TAA+A +AL  A
Sbjct: 189 EEVELLQEKGF-TPVFLGRRILRAETAAIALLALCTA 224


>gi|332991913|gb|AEF01968.1| hypothetical protein ambt_02070 [Alteromonas sp. SN2]
          Length = 242

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 124/250 (49%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   P+ ++ + + + +  H++A VLR+K    I+LFNG   E+ ++I    +  
Sbjct: 2   RIPRIYYPNPIPLEEEFQLTEEAGHHIASVLRLKANHPIVLFNGDGNEYSAQIINAQRKK 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            F       + +K+S +         K +R+D ++QKSVE+G+  I P+++   +     
Sbjct: 62  VFVEADACLTLSKESSLNIHLGQGVSKGDRMDTVLQKSVELGVTEITPILS---ERCTVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I A EQ    TLP + PP  L   L     + ++V A    G+
Sbjct: 119 LDEARWEKKLLQWQKIIIGACEQSGRNTLPSLNPPIALNKWLSESTSSSRLVLAP---GA 175

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           E  L +    +      +LIGPEGG    E    +   F T  SLGPRILR++TAA++++
Sbjct: 176 EKPLARQPYNSQ--GFRLLIGPEGGLSEGEIHQANESGF-TSCSLGPRILRTETAAISSI 232

Query: 235 ALVQAICGDW 244
           +++QA  GD+
Sbjct: 233 SILQAQHGDF 242


>gi|254492173|ref|ZP_05105347.1| conserved hypothetical protein TIGR00046 [Methylophaga thiooxidans
           DMS010]
 gi|224462498|gb|EEF78773.1| conserved hypothetical protein TIGR00046 [Methylophaga thiooxydans
           DMS010]
          Length = 242

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 115/225 (51%), Gaps = 19/225 (8%)

Query: 29  YHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEY-QSRSQTKQS--DVQYI 85
           + +   VLR+K+G  I LFNGK  E+ + +++V +  R + E  +  +Q  +S  ++  +
Sbjct: 25  HRHAIQVLRLKQGARIQLFNGKGLEYQATLTHVERK-RSEAELGEQLTQASESPLNITLL 83

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAAEQC 138
               +  R+D+ IQK+VE+G+  I PV+T    N     DR+       +   +SA EQ 
Sbjct: 84  QGISRGERMDFAIQKAVELGVNQIIPVMTERC-NVQLKHDRIEKRLAHWQGVIVSACEQS 142

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
               LP +     ++  L +     ++V   +     N L+          + +LIGPEG
Sbjct: 143 GRAVLPTLSEVVDMQNALNSTADTMKLVLDPQAQTRFNDLQA------ATQLTLLIGPEG 196

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           G   +E +   S  F T +  GPRILR++TA+ AA+A+VQ++ GD
Sbjct: 197 GLTDDEVKMATSSGF-TAVQFGPRILRTETASTAALAVVQSLWGD 240


>gi|285018976|ref|YP_003376687.1| hypothetical protein XALc_2213 [Xanthomonas albilineans GPE PC73]
 gi|283474194|emb|CBA16695.1| hypothetical protein XALc_2213 [Xanthomonas albilineans]
          Length = 243

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 121/248 (48%), Gaps = 17/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-- 63
            L R  VD PL    +     +   +L  VLR++EGD  +LFNG   ++ +++   GK  
Sbjct: 2   RLTRCHVDLPLHTGAEVALPEEVAGHLLRVLRLREGDRCVLFNGNGCDYDAELLPTGKRG 61

Query: 64  -SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
            S R  V     +++  + +  +    +  ++D ++QK+ E+G+ AI P+    T     
Sbjct: 62  ASARIGVARPVDNESSLA-ITLLQGVARGEKMDLILQKATELGVSAIVPIWAERTEVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLP-FIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
            Q T   +   R+  +SA EQ     +P    P    +      D  C+++   +    E
Sbjct: 121 AQRTDKRVAHWRSVVVSACEQSGRARVPSLSAPLALADAARAAADSPCRLILDPQ---GE 177

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
             L  L  I +   + I IGPEGG+   ++ TL S  F+  L LGPRILR++TA++AA+A
Sbjct: 178 QRLRTLDFIGN--AITIAIGPEGGWSPRDRTTLESAGFLG-LRLGPRILRTETASLAAIA 234

Query: 236 LVQAICGD 243
            +QA  GD
Sbjct: 235 ALQAHGGD 242


>gi|152998316|ref|YP_001343151.1| hypothetical protein Mmwyl1_4321 [Marinomonas sp. MWYL1]
 gi|150839240|gb|ABR73216.1| protein of unknown function DUF558 [Marinomonas sp. MWYL1]
          Length = 248

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 120/258 (46%), Gaps = 34/258 (13%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R+F+D  L   T        + +L  VLR+K    I +FNG++        + GKS +
Sbjct: 3   IPRIFIDSELNENTTIPLPDSAFQHLCKVLRLKSDHPIRVFNGQE--------FNGKSGQ 54

Query: 67  FKV---EYQSRSQTKQ-SDVQYIFS--PIKTN---------RLDYMIQKSVEMGMGAIRP 111
           F     + + RS     +D + + +  PI+           R+DY IQKSVE G+ AI+P
Sbjct: 55  FNATLCDVEKRSANIHVADFEALNNEPPIQVTIGQTLSRGERMDYAIQKSVEAGVFAIQP 114

Query: 112 VITRYTQ------NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQI 165
           + +   +               +   ISAAEQC    +P +YPP  L   + N +   ++
Sbjct: 115 LFSERCEVKLQDGRAEKRQQHWQQIAISAAEQCGRGVVPIVYPPMGLSEWVANCNEMLKL 174

Query: 166 VFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
                +       EK         VA+LIGPEGG   +E +      F   ++LGPR+LR
Sbjct: 175 TLHHHSAKPIRQYEK----PANNQVALLIGPEGGLTEKEVQLSEKSGF-NAITLGPRVLR 229

Query: 226 SDTAAVAAMALVQAICGD 243
           ++TA + A++++ A+ GD
Sbjct: 230 TETAPIVALSVINALWGD 247


>gi|302877374|ref|YP_003845938.1| hypothetical protein Galf_0129 [Gallionella capsiferriformans ES-2]
 gi|302580163|gb|ADL54174.1| protein of unknown function DUF558 [Gallionella capsiferriformans
           ES-2]
          Length = 243

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 121/250 (48%), Gaps = 20/250 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS-YVGKSI 65
           + R +   P+  +       D  H+ + VLR++EGD++ LF+G   E+   I+   GK +
Sbjct: 1   MPRFYCPPPIPAQGAFNLPADAAHHASRVLRLREGDSVQLFDGTGHEYHGAITDMTGKQV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
               +       ++S +Q + +     + ++D++IQK+ E+G   I+P+ T  +     +
Sbjct: 61  VVG-DIVHIEADRESPLQIVLAQALCSSEKMDWVIQKATELGATEIQPLATGRS-VAKLS 118

Query: 124 MDRVRTYT-------ISAAEQCDILTLPFIYPPTTLEFLLKNW--DHNCQIVFADETCGS 174
            DR    T       ISA EQC    LP I+PP  +   L++       + +   +   S
Sbjct: 119 ADRAAKRTEHWQQVAISACEQCGRNVLPVIHPPVEIGTWLQHMLDSDMSKYILLPQGAKS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               EK  +        +LIG EGG+   E +      F TP+ LG R++R++TAAVA +
Sbjct: 179 LQEQEKPQS-----GAVLLIGAEGGFTEAESDNALRCGF-TPVRLGARVMRTETAAVAGL 232

Query: 235 ALVQAICGDW 244
           A++Q + GD+
Sbjct: 233 AVLQTLWGDF 242


>gi|153835274|ref|ZP_01987941.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156975827|ref|YP_001446734.1| hypothetical protein VIBHAR_03572 [Vibrio harveyi ATCC BAA-1116]
 gi|148868249|gb|EDL67389.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156527421|gb|ABU72507.1| hypothetical protein VIBHAR_03572 [Vibrio harveyi ATCC BAA-1116]
          Length = 243

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 113/237 (47%), Gaps = 34/237 (14%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D   ++  VLRMKEG  +LLF+G   E+ + IS V K     VE   R ++       
Sbjct: 21  SDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK-NVMVEISERVESS------ 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR------- 128
           I SP+         + +++++ IQKSVE+G+  I P+I   ++     +D+ R       
Sbjct: 74  IESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQ 130

Query: 129 --TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
                ISA EQC    +P I P  +LE   +      ++        S N+L        
Sbjct: 131 WQKIAISACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSINTLP-----TP 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  V +LIGPEGG  S+E +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 186 VEKVRLLIGPEGGLSSDEIDMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|262273734|ref|ZP_06051547.1| ribosomal RNA small subunit methyltransferase E [Grimontia hollisae
           CIP 101886]
 gi|262222149|gb|EEY73461.1| ribosomal RNA small subunit methyltransferase E [Grimontia hollisae
           CIP 101886]
          Length = 243

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 119/247 (48%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
            + R+F   PL    +   S D  +++  VLRM+ G  +LLF+G   E+ + I+  G KS
Sbjct: 2   RIPRIFHPEPLPDTGRVALSDDAANHVGRVLRMQAGQEVLLFDGSGAEFPAVIAESGKKS 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
           +   V E   RS     D+       + +++++ IQKSVE+G+  I P+I+        N
Sbjct: 62  VTVDVAERVERSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNVITPLISERC-GVKLN 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            DR        +   I+A EQC    +P + P  +L+  ++      ++        S N
Sbjct: 121 ADRFDKKWQQWQKIAIAACEQCGRNIVPEVRPVMSLDAWMQEPFDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  + +LIGPEGG  SEE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVSRLRLLIGPEGGLSSEEIARTRKFGFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|118497856|ref|YP_898906.1| hypothetical protein FTN_1271 [Francisella tularensis subsp.
           novicida U112]
 gi|194323829|ref|ZP_03057605.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|118423762|gb|ABK90152.1| conserved protein of unknown function [Francisella novicida U112]
 gi|194322193|gb|EDX19675.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|332678571|gb|AEE87700.1| Ribosomal RNA small subunit methyltransferase E [Francisella cf.
           novicida Fx1]
          Length = 242

 Score = 94.7 bits (234), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 120/225 (53%), Gaps = 14/225 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNNDSLQYKTKIIAIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++  I
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIINFI 240


>gi|254508609|ref|ZP_05120725.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219548460|gb|EED25469.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 225

 Score = 94.7 bits (234), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 76/231 (32%), Positives = 115/231 (49%), Gaps = 22/231 (9%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKV-EYQSRSQTKQSDV 82
           S D   ++  VLRMKEG ++LLF+G   E+ + IS V K  +   V E   RS     D+
Sbjct: 3   SDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPATISSVTKKHVEVDVTERIERSAESPLDL 62

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TYTIS 133
                  + +++++ IQKSVE+G+  I P+I   ++     +D+ R            IS
Sbjct: 63  HLGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKIAIS 119

Query: 134 AAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           A EQC   T+P I P   L E+  +++D   ++        S N+L        +  V +
Sbjct: 120 ACEQCGRNTVPEIRPIMQLEEWCAEDYD-GLKLNLHPRAKYSINTLP-----TPVEKVRL 173

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 174 LIGPEGGLSAEEIGMTEEYKFEETL-LGPRVLRTETAALTAITALQVRFGD 223


>gi|163803743|ref|ZP_02197601.1| hypothetical protein 1103602000580_AND4_13698 [Vibrio sp. AND4]
 gi|159172462|gb|EDP57330.1| hypothetical protein AND4_13698 [Vibrio sp. AND4]
          Length = 243

 Score = 94.7 bits (234), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 112/229 (48%), Gaps = 22/229 (9%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTK-QSDVQYI 85
           D   ++  VLRMKEG ++LLF+G   E+ + IS V K     VE   R++   +S +   
Sbjct: 23  DAASHIGRVLRMKEGQDVLLFDGSGAEFPAVISEVSKK-NVLVELSERTENSIESPLDLH 81

Query: 86  FSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TYTISA 134
           F  +  + +++++ IQKSVE+G+  I P+I   ++     +D+ R            ISA
Sbjct: 82  FGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQWQKIAISA 138

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
            EQC    +P I P  +LE   +      ++        S N+L        +  V +LI
Sbjct: 139 CEQCGRNIVPEIRPIMSLEAWCQEEYDGLKLNLHPRAKYSINTLP-----TPVKKVRLLI 193

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG    E +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 194 GPEGGLSCSEIDMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|21672668|ref|NP_660735.1| hypothetical protein BUsg395 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25009589|sp|Q8K9E4|RSME_BUCAP RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|21623305|gb|AAM67946.1| hypothetical 26.9 kDa protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 246

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 125/251 (49%), Gaps = 17/251 (6%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R+++ + L I      S    HY+  VLRMK+ D + +FN  +  + S+I  + 
Sbjct: 1   MKKRIPRIYIKYFLQINQVISLSKSYTHYIKKVLRMKKKDKLEIFNNTNYIFFSEILEIN 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT--Q 118
                 +  + + +  +S +      +  K  ++++ IQKSVE+G+  I P+ + Y   Q
Sbjct: 61  NHTIEIIILKKQIKNLESPLLIHLGQVISKNEKMNFSIQKSVELGVNTITPLFSEYCNFQ 120

Query: 119 NTHYNMDRVRTY----TISAAEQCDILTLPFIYPPT-TLEFLLKNWDHNCQIVFADETCG 173
           N      + + +     IS+ EQC    +P I  P   L +  + +++  +IVF+     
Sbjct: 121 NKLICFPKKKIHWENIVISSCEQCHRNNIPEIKNPEYILPWCKRTYENETKIVFSPSATF 180

Query: 174 SENSL-EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           + N L EK++       V +LIG EGG+   E E +    F+ P+ LGPRILR++TA +A
Sbjct: 181 TINELPEKINC------VRLLIGSEGGFSFLEIEKIIQYGFI-PIKLGPRILRTETAVIA 233

Query: 233 AMALVQAICGD 243
           A+  +Q   GD
Sbjct: 234 AITALQIKFGD 244


>gi|260888226|ref|ZP_05899489.1| RNA methyltransferase, RsmE family [Selenomonas sputigena ATCC
           35185]
 gi|330838435|ref|YP_004413015.1| Ribosomal RNA small subunit methyltransferase E [Selenomonas
           sputigena ATCC 35185]
 gi|260862060|gb|EEX76560.1| RNA methyltransferase, RsmE family [Selenomonas sputigena ATCC
           35185]
 gi|329746199|gb|AEB99555.1| Ribosomal RNA small subunit methyltransferase E [Selenomonas
           sputigena ATCC 35185]
          Length = 261

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 126/249 (50%), Gaps = 18/249 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-- 64
           ++R+F++  +    +    G   H+L  V+R K G+ +L+ +G  G   ++++       
Sbjct: 1   MRRVFLEGEIADTME--VRGADAHHLQRVMRAKLGEKLLVADGAGGSAEAEVAGFADGRV 58

Query: 65  -IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVIT-----RYTQ 118
            +RF V   S +   Q++++      K +R+D+++QK+ E+G+  IRPV++     RY +
Sbjct: 59  QLRF-VRRLSEAAESQAEIELFQCLPKGDRMDFIVQKTTELGVACIRPVLSQNVVVRYDE 117

Query: 119 -NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNW---DHNCQIVFADETCGS 174
                 ++R +     AA+QC    +P + P   L   ++     ++  ++ F +     
Sbjct: 118 KKARARVERWQKIAAEAAKQCGRTRIPEVMPIVPLRAAMEGQGAAEYALRLFFYEME--E 175

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              L  + + +    + +L+GPEGG+   E +   +  F + ++LG RILR DTAA+ A+
Sbjct: 176 RRELRTVLSDSEARRIFMLVGPEGGFDEAEAQLAVAHGF-SAVTLGRRILRVDTAAIVAL 234

Query: 235 ALVQAICGD 243
           ALVQ   GD
Sbjct: 235 ALVQYEKGD 243


>gi|269960438|ref|ZP_06174811.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834865|gb|EEZ88951.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 243

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 113/237 (47%), Gaps = 34/237 (14%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D   ++  VLRMKEG  +LLF+G   E+ + IS V K     VE   R ++       
Sbjct: 21  SDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK-NVMVEISERVESS------ 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR------- 128
           I SP+         + +++++ IQKSVE+G+  I P+I   ++     +D+ R       
Sbjct: 74  IESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQ 130

Query: 129 --TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
                +SA EQC    +P I P  +LE   +      ++        S N+L        
Sbjct: 131 WQKIAVSACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSINTLP-----TP 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  V +LIGPEGG  S+E +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 186 VEKVRLLIGPEGGLSSDEIDMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|254374666|ref|ZP_04990147.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151572385|gb|EDN38039.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 242

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 120/225 (53%), Gaps = 14/225 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNTDSLQYKTKIIAIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++  I
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIINFI 240


>gi|226952621|ref|ZP_03823085.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226836610|gb|EEH68993.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 239

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 117/242 (48%), Gaps = 21/242 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L      + +   +H+   VLR KE +  + FNGK GE+L  ++ + K   
Sbjct: 1   MNRFYIETELNTGNTIELTESVFHHWVRVLRAKEQEQAIFFNGKGGEYLVTLTVINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
                Q     + +    +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  LVSIDQFNKLDRTAPFNVVLGQVMSKGDRMDYAIQKATELGVTTIQLLTSDRCEMRLKYD 120

Query: 124 -----MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DETCGSE 175
                +D  R+  I+A EQC +  +P I  P +L   +K+     + V A   D+T    
Sbjct: 121 RDQKKLDHWRSVAIAACEQCGMNRVPEILAPISLNDWVKSELPTSRFVLAPNKDQTNILL 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           NS          P++A+LIGPEGG    E ET +   F     +G R+LR++TA V A++
Sbjct: 181 NS---------TPDIALLIGPEGGLSETEIETANQYQFKN-WCIGDRVLRTETAPVVALS 230

Query: 236 LV 237
           ++
Sbjct: 231 IL 232


>gi|148980482|ref|ZP_01816079.1| hypothetical protein VSWAT3_21045 [Vibrionales bacterium SWAT-3]
 gi|145961207|gb|EDK26521.1| hypothetical protein VSWAT3_21045 [Vibrionales bacterium SWAT-3]
          Length = 243

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 110/228 (48%), Gaps = 20/228 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSD 81
           D   ++  VLRMKEG  +LLF+G   E+ + I+ V K     ++  ++E  S S      
Sbjct: 23  DAAGHVGRVLRMKEGQEVLLFDGSGTEFPATIAEVSKKNVTVNVTERIERSSESPLDLHL 82

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
            Q I    + +++++ IQKSVE+G+  I P+I+         +     + + +   I+A 
Sbjct: 83  GQVIS---RGDKMEFTIQKSVELGVNTITPLISERCGVKLDAKRFEKKLAQWQKIAIAAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC   T+P I P   LE          ++        S N+L +      I  V +LIG
Sbjct: 140 EQCGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSINTLPE-----PISKVRLLIG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 195 PEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|78044093|ref|YP_359279.1| hypothetical protein CHY_0418 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996208|gb|ABB15107.1| conserved hypothetical protein TIGR00046 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 248

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 128/237 (54%), Gaps = 16/237 (6%)

Query: 19  KTQGK---ASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSR 74
           +TQG     +GD   ++A VLR+K G+ + L + ++  +L ++  V K  ++ K+  + +
Sbjct: 10  QTQGDYAYLTGDDAKHVAKVLRIKPGEKLTLQDDQEFRYLCQVIAVRKDLVQLKILEKKK 69

Query: 75  SQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRV 127
             T+   +V  +    K +++D+++QK+ E+G+  I PV T  T      +      +R 
Sbjct: 70  VVTRPPVNVTLVQGVPKGDKMDFIVQKATELGVYRIIPVETIRTVVVFDERKKKDRCERW 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN-SLEKLHAIAH 186
           +     AA+Q  +  +P I+P   L+  L  +  +  I+   E  G E  SL++L     
Sbjct: 130 QKIAYEAAKQAGVSRVPEIFPVIDLK-ALPEFISDALILVPYE--GEEQTSLKQLLNKEA 186

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           + NV ++IGPEGG+   E E L S   VT +SLGPRILR++TAA+A +++V    GD
Sbjct: 187 VKNVTVIIGPEGGFDPGEIEYLKSFGAVT-VSLGPRILRTETAALAVLSMVLYQWGD 242


>gi|86146407|ref|ZP_01064731.1| hypothetical protein MED222_22541 [Vibrio sp. MED222]
 gi|85835886|gb|EAQ54020.1| hypothetical protein MED222_22541 [Vibrio sp. MED222]
          Length = 243

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 111/228 (48%), Gaps = 20/228 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSD 81
           D   ++  VLRMKEG +ILLF+G   E+ + I+ V K     ++  ++E  S S      
Sbjct: 23  DAAGHVGRVLRMKEGQDILLFDGSGAEFPATIAEVSKKNVTVNVTERIERSSESPLDLHL 82

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
            Q I    + +++++ IQKSVE+G+  I P+I+        T+     + + +   I+A 
Sbjct: 83  GQVIS---RGDKMEFTIQKSVELGVNTITPLISERCGVKLDTKRFEKKLAQWQKIAIAAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ    T+P I P   LE          ++        S N+L +      I  V +LIG
Sbjct: 140 EQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSINTLPE-----PISKVRLLIG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 195 PEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|323493586|ref|ZP_08098707.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio brasiliensis LMG
           20546]
 gi|323312109|gb|EGA65252.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio brasiliensis LMG
           20546]
          Length = 243

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 113/238 (47%), Gaps = 36/238 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKV-EYQSRSQTKQSDV 82
           S +   ++  VLRMKE   +LLF+G   E+ + IS V  KS+   V E   RS     D+
Sbjct: 21  SEEAAGHVGRVLRMKEEQQVLLFDGSGAEFPATISEVSKKSVEVNVIERIERSSESPLDL 80

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
                  + +++++ IQKSVE+G+  I P+I+         +     + + +   ISA E
Sbjct: 81  HLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLDHKRFEKKLAQWQKIAISACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIP- 188
           QC   T+P I P   LE                E CG E    KL       ++I  +P 
Sbjct: 141 QCGRNTVPEIRPIMQLE----------------EWCGEEYDGLKLNLHPRAKYSINTLPT 184

Query: 189 ---NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
               V +LIGPEGG  +EE     +  F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 185 PVEKVRLLIGPEGGLSAEEISMTENYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|28899384|ref|NP_798989.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153839188|ref|ZP_01991855.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260366255|ref|ZP_05778714.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus K5030]
 gi|260878928|ref|ZP_05891283.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AN-5034]
 gi|260898271|ref|ZP_05906767.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus Peru-466]
 gi|260903375|ref|ZP_05911770.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AQ4037]
 gi|28807620|dbj|BAC60873.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747290|gb|EDM58274.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308085866|gb|EFO35561.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus Peru-466]
 gi|308090439|gb|EFO40134.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AN-5034]
 gi|308107481|gb|EFO45021.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AQ4037]
 gi|308113508|gb|EFO51048.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus K5030]
          Length = 243

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 113/237 (47%), Gaps = 34/237 (14%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D   ++  VLRMKEG  +LLF+G   E+ + IS V K     V+   R ++       
Sbjct: 21  SEDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK-NVLVDVTERVESN------ 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR------- 128
           I SP+         + +++++ IQKSVE+G+  I P+I   ++     +D+ R       
Sbjct: 74  IESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQ 130

Query: 129 --TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
                ISA EQC    +P I P  +LE   +      ++        S N+L        
Sbjct: 131 WQKIAISACEQCGRNVVPEIRPIMSLEQWCQEEYDGLKLNLHPRAKYSINTLP-----TP 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  V +LIGPEGG  SEE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 186 VEKVRLLIGPEGGLSSEEIDMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|238897814|ref|YP_002923493.1| 16S rRNA methyltransferase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465571|gb|ACQ67345.1| 16S rRNA methyltransferase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 243

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 123/248 (49%), Gaps = 20/248 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++  +P    TQ + S +  H++  VLRMK G ++ LF+  +    + I  + K   
Sbjct: 3   IPRIYHPYPFFAHTQIELSEEAAHHVIRVLRMKPGQSLYLFHDSNDIIQANIIRIDKK-- 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI-----KTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
            KV  Q +    +++   ++  +     ++ +++Y +QKSVE+G+ ++ P+ +       
Sbjct: 61  -KVYVQLKEAILKNNESPLYLHLGQVICRSEKMEYTLQKSVELGVHSVTPLFSERCGVKI 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   ISA EQC    +P IY    L     + D++ ++ F  +     
Sbjct: 120 DGERLQKKIQQWKKIAISACEQCGRNKIPKIYNALPLHNWCAHQDNSLKLNFVPKANNRI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L     I  +  V ILIGPEGG  ++E        F+ P+SLGPR+LR++T A+ A+ 
Sbjct: 180 NTL-----IPPVSRVRILIGPEGGLSNDEIAMAADYEFL-PISLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|282896925|ref|ZP_06304931.1| conserved hypothetical protein [Raphidiopsis brookii D9]
 gi|281198334|gb|EFA73224.1| conserved hypothetical protein [Raphidiopsis brookii D9]
          Length = 262

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 113/244 (46%), Gaps = 16/244 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + L+RL +      + Q   +  Q HYL  VLR+++GD  +  +G    WL+K++     
Sbjct: 2   AQLQRLTIQISQLQQNQVLLTPKQKHYLLRVLRLQDGDQFISMDGMGKWWLTKLTADTAQ 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
           I   ++  +        +  I +  K N  D +++ S E+G+ +I PV++  T    +  
Sbjct: 62  I---LQTLTPKTELPLSITLILALPKGNAFDDVVRYSTELGVSSILPVLSDRTLLNPSPQ 118

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
            ++R R     AAEQ +   +P I  P      L  + +     F    C +  S   L 
Sbjct: 119 KLERWRRIAKEAAEQSERAFVPTILEPVAFSTALSEYSN-----FKCYICEARGSYPHLI 173

Query: 183 AIAHIP-----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            I +IP      V I IGPEGG+   E  T     F  P+SLG RILR+ TA + A++L+
Sbjct: 174 NIINIPLKDIKEVVIAIGPEGGWTETEIATAILAKF-QPVSLGDRILRAATAPIVALSLI 232

Query: 238 QAIC 241
            A C
Sbjct: 233 AAAC 236


>gi|332535117|ref|ZP_08410927.1| ribosomal RNA small subunit methyltransferase E [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035435|gb|EGI71933.1| ribosomal RNA small subunit methyltransferase E [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 244

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 117/234 (50%), Gaps = 32/234 (13%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K     +  +      +S ++   
Sbjct: 23  DAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVTKKTVVVMPLELNPHDVESPLKIHL 82

Query: 87  SPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM--DRV-------RTYTISAA 135
                + +++D+ IQKSVE+G+  I P+   ++Q     +  DR+       +   I+AA
Sbjct: 83  GQCVSRGDKMDFTIQKSVELGITEITPI---FSQRCGVKLMGDRLEKKHQQWQKIAIAAA 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKLHAIAHIP----N 189
           EQ     +P I+PP      LK W        A +T   + +L     H+I  I      
Sbjct: 140 EQSGRNFVPIIHPPID----LKQW-------LAQQTDAIKLTLHPRAEHSIKTITVPKDG 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V  L+GPEGG+  +E      L FV  + LGPR+LR++TAA+  ++ +Q   GD
Sbjct: 189 VRFLVGPEGGFTDDEMALTKQLEFVD-IRLGPRVLRTETAALTVLSALQLQFGD 241


>gi|312795128|ref|YP_004028050.1| surface protein [Burkholderia rhizoxinica HKI 454]
 gi|312166903|emb|CBW73906.1| surface protein [Burkholderia rhizoxinica HKI 454]
          Length = 271

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 124/256 (48%), Gaps = 32/256 (12%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R FV  PL          D   ++ HVLR++ GD  +LFNG+ G++ +++  + K     
Sbjct: 28  RFFVPMPLHSGHSMPLPDDVVRHM-HVLRLQAGDKAILFNGEGGQFDAELLQLDK----- 81

Query: 69  VEYQSRSQTKQSDVQYIFSPIKT---------NRLDYMIQKSVEMGMGAIRPVIT----- 114
               +  Q  + D + +  P +          +++D++++K++E+G+ ++ P++T     
Sbjct: 82  --RSATVQVGRFDAREVEPPYRVVLAQGIAGGDKMDWLLEKAIELGVASVIPLVTARSVV 139

Query: 115 RYT-QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKN-----WDHNCQIVFA 168
           R T +         +    +A EQC    LP + PPT +   L++      D+  +++ +
Sbjct: 140 RLTGERAARRHAHWQALVRAACEQCGRNQLPDVAPPTDVMAWLESSVALPRDNALRLLLS 199

Query: 169 DETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
                +E     L   A    V ++IGPEGG  + E+    S  F+ PL LGPR+LR++T
Sbjct: 200 PR---AERPFAALPDTAPAAPVIVMIGPEGGLSATEEAAAISHGFM-PLGLGPRVLRTET 255

Query: 229 AAVAAMALVQAICGDW 244
           A +A +A + A  G W
Sbjct: 256 AGIAVLAALAARWGGW 271


>gi|319789344|ref|YP_004150977.1| protein of unknown function DUF558 [Thermovibrio ammonificans HB-1]
 gi|317113846|gb|ADU96336.1| protein of unknown function DUF558 [Thermovibrio ammonificans HB-1]
          Length = 239

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 113/227 (49%), Gaps = 16/227 (7%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKV--EYQSRSQTKQSDV 82
           G +  +   VLR+K+GD I++F+G+  E+ + I      S++ K+  E      +  +  
Sbjct: 18  GQEARHALKVLRLKKGDEIIVFDGEGKEYSAVIEAASPTSVKLKIVEEINVNRDSPLNST 77

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVI------TRYTQNTHYNMDRVRTYTISAAE 136
            Y+    K  + +  +QK  E+G+  I PV+       +  +N    M R +   ++AA+
Sbjct: 78  LYMGLTNKLQKFELALQKVTELGVTRIVPVVCARSSTAQLVKNWSGKMRRWQEIVVNAAK 137

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC    LP +  P  L  +    D + + V  ++   S  + +   A     +V++L+GP
Sbjct: 138 QCGRSVLPELLEPVPLPEVED--DSDLKFVLWEKGGKSLKNYQDYVA----SSVSLLVGP 191

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG    E E L S  F  P+ LG RILR++TAA+A + LVQ I GD
Sbjct: 192 EGGLEKGEIELLESKGF-KPIYLGKRILRAETAAIAGVTLVQFIWGD 237


>gi|293607138|ref|ZP_06689480.1| 16S rRNA methyltransferase RsmE [Achromobacter piechaudii ATCC
           43553]
 gi|292814472|gb|EFF73611.1| 16S rRNA methyltransferase RsmE [Achromobacter piechaudii ATCC
           43553]
          Length = 243

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 119/239 (49%), Gaps = 10/239 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R F D PL    +        H+   VLR+K G++++LFNG+ GE+ + +   GK+   +
Sbjct: 5   RFFCDIPLSAGARIALPDALAHHALRVLRLKAGESVVLFNGQGGEYPAVLDVDGKAGYAQ 64

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMD 125
           + ++ +R       +  +      +++D++++K+VE+G   + P+  + +  Q +   +D
Sbjct: 65  LGDFSAREAELAGRITLVQGLPSGDKMDWVVEKAVELGASRVSPIAAQRSVLQLSGPRLD 124

Query: 126 RVRTY----TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
           +   +      SAAEQC    L  +  P +L   L       +++   E    E+   KL
Sbjct: 125 KRVAHWQRIAQSAAEQCGRNRLMAVDAPRSLADWLAEPAEGLRLLCHPEA--GEDLAGKL 182

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
            A   +  + +L+GPEGG+  +E E L     V  +  GPR+LR++TA +A ++ V A+
Sbjct: 183 RAAPGLTALTLLVGPEGGWSDKELE-LARQAGVQAVRFGPRVLRTETAGLALVSAVSAL 240


>gi|169832194|ref|YP_001718176.1| hypothetical protein Daud_2054 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169639038|gb|ACA60544.1| protein of unknown function DUF558 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 249

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 107/227 (47%), Gaps = 9/227 (3%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQS-DV 82
           +GD   +L  VLR+  G  +LL +G    + ++I  V +  +R  +   +         V
Sbjct: 22  TGDDARHLTRVLRLAAGSELLLLDGSGRAYAAEIREVDRDGVRAVITGPAELPADPGLRV 81

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
             + S  K +R++ ++QK+ E+G+ AI PVI+  T      +     ++R R     AAE
Sbjct: 82  TLVPSLAKGDRMEDLVQKATEVGVAAIVPVISERTVVRLTPEKAGRRVERWRRIATEAAE 141

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC    +P ++     E  LK         F  E        + L + A +  V +  GP
Sbjct: 142 QCRRPLVPDVHGVCRFEDALKRLPAGGAAFFLWEEERGTGLKQALRSRAPVREVFLFTGP 201

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG+  EE     +   V+ +SLGPR+LR+DTA V A+ALV    GD
Sbjct: 202 EGGFTPEEAAAATARGAVS-VSLGPRLLRTDTAGVVAVALVLYEWGD 247


>gi|163749088|ref|ZP_02156338.1| hypothetical protein KT99_19644 [Shewanella benthica KT99]
 gi|161331158|gb|EDQ02047.1| hypothetical protein KT99_19644 [Shewanella benthica KT99]
          Length = 242

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 119/259 (45%), Gaps = 40/259 (15%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKS 64
            + R++ D PL I        +   ++  VLRM  G+ I LFNG D ++L++ IS   K+
Sbjct: 2   RIPRIYQDSPLVIGDSLALHDEAASHIGRVLRMTPGEQISLFNGSDHDYLAEIISASKKN 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           I  KV   S +   +S +      +  + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 62  ISVKV-LSSNTNASESPLHIHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERC-GVKL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           + DR+       +   ++A EQ     +P I P  +LE     W            CG  
Sbjct: 120 SGDRLEKKRQQWQKIVVAACEQSGRSRVPEIRPAMSLE----AW------------CGEP 163

Query: 176 NSLEKL-------HAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
               KL       H I  +P     V +LIGPEGG    E        F T + LGPR+L
Sbjct: 164 TDSLKLNLHPRAAHGIGGLPLEVAKVRLLIGPEGGLSDTEILQTEQDEF-TDILLGPRVL 222

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TAA+ A++ +Q   GD
Sbjct: 223 RTETAALTAISALQLKFGD 241


>gi|294787701|ref|ZP_06752945.1| RNA methyltransferase, RsmE family [Simonsiella muelleri ATCC
           29453]
 gi|294483994|gb|EFG31677.1| RNA methyltransferase, RsmE family [Simonsiella muelleri ATCC
           29453]
          Length = 239

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 112/225 (49%), Gaps = 27/225 (12%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKS-----IRFKVEYQSRSQTKQSDVQYIFSP 88
           HVLR++ G+ I LFNG    + +++  + K      + F+    + S      VQ I S 
Sbjct: 27  HVLRLRVGEQITLFNGDGAAYSAQLLQLEKRHATCRVLFRQPENTESPLSIKLVQAISS- 85

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
               R+D+ IQKSVE+G+ AI+PV++  +      +     + R +   ISA EQC   T
Sbjct: 86  --GERMDFTIQKSVELGVVAIQPVMSERSVVRLSGERADKRVQRWQEIAISACEQCGRNT 143

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN---VAILIGPEGG 199
           +P I P  + E  L+       I+          SL +  ++  +P    V ++IG EGG
Sbjct: 144 IPDILPIVSFEQYLRQKSDELHILM---------SLRQARSLKDLPTPTRVTLMIGAEGG 194

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +   E+    S      + LG R+LR++TA++AA+A +Q + GD+
Sbjct: 195 WTQAEENAAFS-ANCQAVVLGKRVLRTETASLAAIAAMQTLWGDF 238


>gi|86608181|ref|YP_476943.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556723|gb|ABD01680.1| conserved hypothetical protein TIGR00046 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 289

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 114/249 (45%), Gaps = 22/249 (8%)

Query: 5   SHLKRLFVDFPLCIKTQG--KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           S L RL +D P      G  + +G Q HYL  V R++ GD  L+ +G    W ++    G
Sbjct: 22  SALPRLAID-PAQRDPSGVLRLTGPQQHYLQRVRRLRPGDLFLVLDGSGKLWAARWQAQG 80

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNT 120
             I  +VE   R       +    + +K    D ++++  E+G+  I P++T  T  +  
Sbjct: 81  SQIVGEVETLPRELP--VFLHLGLAVVKGQGFDEVLRQVTELGVARITPLLTERTVLEPG 138

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET--------C 172
               +R +     AAEQC+ L  P + PPT       +W    Q V A  T         
Sbjct: 139 SGRQERWQKIVREAAEQCERLRWPQVDPPTP----WTSWLAELQAVRATRTESFWWGIAV 194

Query: 173 GSENSLEKLHAIA--HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
             EN+   + A+    IP +AI IGPEGG+   E+        V+ +SLGP ILR+ TAA
Sbjct: 195 ARENAPLLVQALPKLQIPALAIAIGPEGGWTVAERRQAEEYGGVS-VSLGPTILRATTAA 253

Query: 231 VAAMALVQA 239
           V A + + A
Sbjct: 254 VVATSQIAA 262


>gi|300723910|ref|YP_003713221.1| hypothetical protein XNC1_3049 [Xenorhabdus nematophila ATCC 19061]
 gi|297630438|emb|CBJ91103.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 243

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 121/244 (49%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           R++   PL I+T+   S D  +++  VLRM  G  + LF+G +  + ++I+    K+++ 
Sbjct: 5   RIYHPEPLSIETEIYLSDDAANHVGRVLRMSLGQELQLFDGSNQIFNAEITETSKKTVKI 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
           ++    +    +S +      +  +  ++++ IQKSVE+G+  I P+++         + 
Sbjct: 65  RI-LNGKFSDHESPLNLHLGQVMSRGEKMEFTIQKSVELGVSTITPLLSERCGVKLDAER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   ISA EQC    +P I P  +LE   K  D + ++        S N+L 
Sbjct: 124 LEKKLQQWKKIAISACEQCGRNRIPEIRPVMSLEAWCKENDDSLKLNLHPRASQSINTL- 182

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                  +  V +LIGPEGG  +EE +      F T + LGPR+LR++T A+ A+  +Q 
Sbjct: 183 ----TLPVKKVRLLIGPEGGLSAEEIDMTAKYQF-TDILLGPRVLRTETTALTAITALQV 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|294649934|ref|ZP_06727326.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292824163|gb|EFF82974.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 239

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 117/242 (48%), Gaps = 21/242 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L      + +   +H+   VLR KE +  + FNGK GE+L  ++ + K   
Sbjct: 1   MNRFYIETELNTGNTIELTESVFHHWVRVLRAKEQEQAIFFNGKGGEYLVTLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
                Q     + +    +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  LVSIDQFNKLDRTAPFNVVLGQVMSKGDRMDYAIQKATELGVTTIQLLTSDRCEMRLKYD 120

Query: 124 -----MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DETCGSE 175
                +D  R+  I+A EQC +  +P I  P +L   +K+     + V A   D+T    
Sbjct: 121 RDQKKLDHWRSVAIAACEQCGMNRVPEILAPISLNDWVKSELPTSRFVLAPNKDQTNILL 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           NS          P++A+L+GPEGG    E ET +   F     +G R+LR++TA V A++
Sbjct: 181 NS---------TPDIALLVGPEGGLSETEIETANQYQFKN-WCIGDRVLRTETAPVVALS 230

Query: 236 LV 237
           ++
Sbjct: 231 IL 232


>gi|56708314|ref|YP_170210.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670785|ref|YP_667342.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134301732|ref|YP_001121700.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|187931804|ref|YP_001891789.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|224457434|ref|ZP_03665907.1| 16S rRNA m3U1498 methyltransferase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370797|ref|ZP_04986802.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254875134|ref|ZP_05247844.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56604806|emb|CAG45885.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110321118|emb|CAL09268.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049509|gb|ABO46580.1| hypothetical protein FTW_0692 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151569040|gb|EDN34694.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712713|gb|ACD31010.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254841133|gb|EET19569.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159545|gb|ADA78936.1| hypothetical protein NE061598_07235 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 242

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNTDSLQYKTKIITIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++ 
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIIN 238


>gi|15604043|ref|NP_220558.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia prowazekii
           str. Madrid E]
 gi|6226337|sp|Q9ZDZ5|RSME_RICPR RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|3860734|emb|CAA14635.1| unknown [Rickettsia prowazekii]
          Length = 198

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 111/198 (56%), Gaps = 16/198 (8%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++++  L   ++ + + D  HY+  VLR+K  D++ +FNG DGE+L++I+ +GK ++  
Sbjct: 5   RIYINSNLAENSKLELARDYVHYVKTVLRLKIHDSLRIFNGSDGEFLAQITQIGKNNLSV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            ++ Q +    +S +    + IK+++L   I  + ++G+  I P+ITR  Q    N++R+
Sbjct: 65  VLKEQLKKAYIESALTLAVAIIKSDKLMLTINMATQLGITKIIPLITRRCQFRTVNIERL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-HAIAH 186
               I A EQ + L  P I    TL+  LK   +N  I++A+E        EK+ H+I H
Sbjct: 125 MKCVIEATEQSERLNPPIIEQAITLKDYLK--KNNNLILYANEH-------EKVKHSILH 175

Query: 187 IP-----NVAILIGPEGG 199
           I      ++AI+IGPE G
Sbjct: 176 ISSLLSKDIAIIIGPEEG 193


>gi|170728459|ref|YP_001762485.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella woodyi ATCC
           51908]
 gi|169813806|gb|ACA88390.1| protein of unknown function DUF558 [Shewanella woodyi ATCC 51908]
          Length = 243

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 123/252 (48%), Gaps = 26/252 (10%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKS 64
            + R++   PL I  Q +   +   ++  VLRM  G+ I LFNG   E+LS+ IS   K+
Sbjct: 2   RIPRIYQASPLQIGNQVELDDEPASHIGRVLRMNAGEQISLFNGDGHEYLSEIISASKKN 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
           +  KV   + ++++     ++   I + +R+D+ IQKSVE+G+  I P+ +         
Sbjct: 62  VSVKVLSSTLNESESPLHLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLSG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + + +   I A EQ     +P I P  T+E     W        A++T  ++ +
Sbjct: 122 ERLEKKIQQWQKIVIGACEQSGRSQVPEIRPAMTIEA----WS-------AEQTDATKLN 170

Query: 178 L--EKLHAIAHI----PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
           L     H I  +    P V +LIGPEGG    E        F T + LGPR+LR++TAA+
Sbjct: 171 LHPRAAHGIGGLSLTSPKVRLLIGPEGGLSEAEIMMTEQYQF-TDVLLGPRVLRTETAAL 229

Query: 232 AAMALVQAICGD 243
            A++ +Q   GD
Sbjct: 230 TAISALQLRFGD 241


>gi|77361513|ref|YP_341088.1| hypothetical protein PSHAa2598 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876424|emb|CAI87646.1| putative RNA methyltransferase with a deep trefoil knot, RrmA and
           YibK are structural paralogs [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 244

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 116/228 (50%), Gaps = 20/228 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K     +  Q  +   +S ++   
Sbjct: 23  DAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVTKKNVVVMPQQLNTHDVESPLKIHL 82

Query: 87  SPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAAEQ 137
                + +++D+ IQKSVE+G+  I P+ ++         DR+       +   I+AAEQ
Sbjct: 83  GQCVSRGDKMDFTIQKSVELGITEITPIFSQRC-GVKLMGDRLDKKHQQWQKIAIAAAEQ 141

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP--NVAILIG 195
                +P ++PP  L+  L       ++        +E+S++ +     +P   V  L+G
Sbjct: 142 SGRNFVPVVHPPVDLKQWLAQQSAAIKLTLHPR---AEHSIKTI----TVPKDGVRFLVG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  EE        FV  + LGPR+LR++TAA+  ++ +Q   GD
Sbjct: 195 PEGGFTDEEMAQTKQQNFVD-IRLGPRVLRTETAALTVLSALQLQFGD 241


>gi|254429679|ref|ZP_05043386.1| conserved hypothetical protein TIGR00046 [Alcanivorax sp. DG881]
 gi|196195848|gb|EDX90807.1| conserved hypothetical protein TIGR00046 [Alcanivorax sp. DG881]
          Length = 239

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 103/212 (48%), Gaps = 18/212 (8%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQS---RSQTKQSDVQYIF 86
           H++  VLRM  GD +++FNG+ GEWL+ I+ + K     +E Q+     +T    V    
Sbjct: 25  HHIGKVLRMAVGDELVVFNGRGGEWLASIAAISKKA-VTIEPQAFTDEDRTAPLAVTVAL 83

Query: 87  SPIKTNRLDYMIQKSVEMGMGAI------RPVITRYTQNTHYNMDRVRTYTISAAEQCDI 140
             IK  R+DY IQK+ E+G G +      R  +    +     +   +   ISA EQC +
Sbjct: 84  PMIKGERMDYAIQKATELGAGELVILDTERCEVRLKGERQDKKLAHWQQVAISACEQCGM 143

Query: 141 LTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
             +P +    +L ++L  +      I    E   S  +L+        P +A+L GPEGG
Sbjct: 144 NRVPAVRGVLSLRDWLASDLPALKLIAHPGEKPFSPAALQTQ------PALALLTGPEGG 197

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
           +  +E +      F TP +LG R+LR++TA V
Sbjct: 198 FSDDELQRAADAGF-TPFALGNRVLRAETAPV 228


>gi|109899639|ref|YP_662894.1| hypothetical protein Patl_3334 [Pseudoalteromonas atlantica T6c]
 gi|109701920|gb|ABG41840.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudoalteromonas atlantica
           T6c]
          Length = 242

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 112/228 (49%), Gaps = 20/228 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQ-SRSQTKQSDVQY 84
           D  +++A+VLR K G  ++LFNG   E+  +   V K  +R +++ + S S      +  
Sbjct: 23  DASNHVANVLRSKVGQPVVLFNGDGNEYSGEFIDVSKRKVRVQIDAKLSMSLESPLSIHL 82

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---------QNTHYNMDRVRTYTISAA 135
                + +R+D+++QKSVE+G+  I P+IT            Q  H    ++    I+A 
Sbjct: 83  GQGVSRGDRMDWVLQKSVELGVTEITPLITERCGVKLDEQRWQKKHAQWQKI---IIAAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    LP ++ P   +  +       ++        +E S    H       V +LIG
Sbjct: 140 EQCGRNVLPVLHMPMDFQSWVNQSTQALRLALHPR---AEKSFR--HTSVGKDGVRLLIG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  +E        F T + LGPR+LR++TAA+ A++ +QAI GD
Sbjct: 195 PEGGFSDQELYQTEQGGFQT-VQLGPRVLRTETAAITAISALQAIYGD 241


>gi|256821459|ref|YP_003145422.1| hypothetical protein Kkor_0233 [Kangiella koreensis DSM 16069]
 gi|256794998|gb|ACV25654.1| protein of unknown function DUF558 [Kangiella koreensis DSM 16069]
          Length = 242

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 121/245 (49%), Gaps = 16/245 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SI 65
           R+F    L + T+     +   +++ VLRM  G  I LFNG    + ++I  + +   S+
Sbjct: 5   RIFTSEALSLSTEMALDKEASTHISRVLRMNTGQQIELFNGDGFSYFAQIQAIERNQVSV 64

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
           R  VE    +     ++       + ++++  +QK VE+G+    P+IT         + 
Sbjct: 65  RV-VEAIEVNNESPLNIHLFQGISRGDKMELTLQKGVELGVKQFTPLITERCGVKLDAKR 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               +   +    SA EQC   ++P +YP   L+  L   ++    +  D    S++S +
Sbjct: 124 WQKKLQHWQKVIESACEQCGRNSIPSLYPAVKLQDALSQLNNTSFFMHPD----SKHSFK 179

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            + A A    + + +GPEGG+  EE E + S     P+ LGPRILR++TAA+AA++++ +
Sbjct: 180 TIIADAQ-SELQLWVGPEGGFSDEEVEWVESHG-CKPVQLGPRILRTETAALAAVSVMNS 237

Query: 240 ICGDW 244
           + GD+
Sbjct: 238 LWGDF 242


>gi|299769311|ref|YP_003731337.1| ribosomal RNA small subunit methyltransferase E [Acinetobacter sp.
           DR1]
 gi|298699399|gb|ADI89964.1| ribosomal RNA small subunit methyltransferase E [Acinetobacter sp.
           DR1]
          Length = 240

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 119/241 (49%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ +S + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLSEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTLENFNPNNRNAPFKAVLGQVMSKGDRMDYAIQKATELGVSKIQLLTSDRCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L E+L  +     + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLNEWLSSSELPQSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|149911573|ref|ZP_01900186.1| hypothetical protein PE36_05278 [Moritella sp. PE36]
 gi|149805352|gb|EDM65364.1| hypothetical protein PE36_05278 [Moritella sp. PE36]
          Length = 243

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 121/249 (48%), Gaps = 26/249 (10%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY-VGKSIRF 67
           R+F    L + +  + S D   ++  VLRM  GD + LFNGK G++ + I     KS+  
Sbjct: 5   RIFESGELIVGSSFELSPDGAGHVGRVLRMTTGDTLTLFNGKGGQYQATIEQTTKKSVTV 64

Query: 68  KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
            + E+Q  +      +    +  + +++D+ IQKSVE+G+ AI P+ +         +  
Sbjct: 65  HIDEFQDINSESPLKIHLGQAISRGDKMDFTIQKSVELGVTAITPLFSERCGVKLSGERL 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL-- 178
              + + +   I+A EQ     +P + PP      LK+W        A+ET   + +L  
Sbjct: 125 EKKIQQWQKIVIAACEQSGRNFVPQVLPPKQ----LKDWA-------AEETTELKLNLHP 173

Query: 179 EKLHAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              ++I  +P     V +LIGPEGG  ++E        F   L LGPR+LR++TAA+ A+
Sbjct: 174 RAKYSINTLPEPKHGVRLLIGPEGGLSADEINMTEQFNFEETL-LGPRVLRTETAALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQCRFGD 241


>gi|125973834|ref|YP_001037744.1| hypothetical protein Cthe_1319 [Clostridium thermocellum ATCC
           27405]
 gi|281417994|ref|ZP_06249014.1| protein of unknown function DUF558 [Clostridium thermocellum JW20]
 gi|125714059|gb|ABN52551.1| protein of unknown function DUF558 [Clostridium thermocellum ATCC
           27405]
 gi|281409396|gb|EFB39654.1| protein of unknown function DUF558 [Clostridium thermocellum JW20]
 gi|316939970|gb|ADU74004.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           1313]
          Length = 247

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 124/227 (54%), Gaps = 9/227 (3%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQ 83
           SG+ ++++  VLR+ +GD + + +G+  ++L +I  +  + I  ++    ++ T+     
Sbjct: 19  SGEDFNHIKKVLRLGKGDKVTVCDGEGTDYLVEIEKIEDAVINTRIVEAMKNATEPPLKV 78

Query: 84  YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
            +F  + K++++DY+IQK+VE+G+  I PVIT  T      ++     +R    ++ AA+
Sbjct: 79  TLFQGLPKSDKMDYIIQKAVELGINEIVPVITERTVVKMDEKSGSKKYERWNRISMEAAK 138

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC+   +P +  P + +  L N   +   +   E        E L + + +  V++ IGP
Sbjct: 139 QCNRGIIPKVGIPLSFKEALDNAKGSSLALIPYEKETGIKLKEVLSSSSSVEKVSVFIGP 198

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG+   E ET  S   + P++LGPRILR++TA +A ++++    GD
Sbjct: 199 EGGFTETEIETAVSCG-ICPVTLGPRILRTETAGIAVLSILMYELGD 244


>gi|110832950|ref|YP_691810.1| hypothetical protein ABO_0090 [Alcanivorax borkumensis SK2]
 gi|110646061|emb|CAL15537.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 240

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 113/244 (46%), Gaps = 16/244 (6%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
           +R F D    +    +      H++  VLRM   D +++FNG+ GEWL++IS + K    
Sbjct: 3   RRFFDDQNFHVGQLVELGASASHHIGKVLRMAVADELVVFNGRGGEWLARISAINKKAVC 62

Query: 68  --KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAI------RPVITRYTQN 119
              + +    +     V      IK  R+DY IQK+ E+G  A+      R  +    + 
Sbjct: 63  IEPLTFTDEDRCAPLAVTVALPMIKGERMDYAIQKATELGATALVILDTERCEVRLKGER 122

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSL 178
               +   +   ISA EQC +  +P ++   +L ++L  +      I    E   S  +L
Sbjct: 123 QEKKLGHWQQVAISACEQCGLNRVPVVHGVLSLRDWLTSDLPALKLIAHPGEKSFSAAAL 182

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +          +A+L GPEGG+ ++E +      F +P +LG R+LR++TA VA +A + 
Sbjct: 183 QGQ------TELALLTGPEGGFSNDELQQAADAGF-SPFALGNRVLRAETAPVALLAALW 235

Query: 239 AICG 242
           A  G
Sbjct: 236 AWHG 239


>gi|256004286|ref|ZP_05429268.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           2360]
 gi|255991720|gb|EEU01820.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           2360]
          Length = 254

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 124/227 (54%), Gaps = 9/227 (3%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQ 83
           SG+ ++++  VLR+ +GD + + +G+  ++L +I  +  + I  ++    ++ T+     
Sbjct: 26  SGEDFNHIKKVLRLGKGDKVTVCDGEGTDYLVEIEKIEDAVINTRIVEAMKNATEPPLKV 85

Query: 84  YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
            +F  + K++++DY+IQK+VE+G+  I PVIT  T      ++     +R    ++ AA+
Sbjct: 86  TLFQGLPKSDKMDYIIQKAVELGINEIVPVITERTVVKMDEKSGSKKYERWNRISMEAAK 145

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC+   +P +  P + +  L N   +   +   E        E L + + +  V++ IGP
Sbjct: 146 QCNRGIIPKVGIPLSFKEALDNAKGSSLALIPYEKETGIKLKEVLSSSSSVEKVSVFIGP 205

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG+   E ET  S   + P++LGPRILR++TA +A ++++    GD
Sbjct: 206 EGGFTETEIETAVSCG-ICPVTLGPRILRTETAGIAVLSILMYELGD 251


>gi|254281685|ref|ZP_04956653.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR51-B]
 gi|219677888|gb|EED34237.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR51-B]
          Length = 242

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 117/243 (48%), Gaps = 16/243 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R+F D PL    +     +   ++  VLR+  G  + +FNG   ++ + I+ V K S+  
Sbjct: 5   RIFADLPLAQGAEFTLPDNASLHIGRVLRLDSGQPLTVFNGDGEDYHATITTVTKRSVSI 64

Query: 68  KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN--THYNM 124
           +V    +   T   +V+   +  K +R D+ +QK+ E+G+  I P+++   +        
Sbjct: 65  EVHSVATNGTTSPLEVELGLALSKGDRFDWAVQKATELGVAHITPLVSERVEVRLNPQRE 124

Query: 125 DRVRTY----TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
           ++ RT+     ISA EQC   TL  +  PT L   L+  +   ++V  D    +    EK
Sbjct: 125 EKKRTHWHNIVISACEQCGRSTLAGVSSPTQLRPWLERVEAPLKLVL-DHRSATALPEEK 183

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                    VA+LIGPEGG    E E   +  F   L LGPR+LR++TA V A++++   
Sbjct: 184 PD------RVALLIGPEGGLTESELELAEASGFQR-LQLGPRVLRTETAPVVALSVLGNR 236

Query: 241 CGD 243
            GD
Sbjct: 237 WGD 239


>gi|332184390|gb|AEE26644.1| Ribosomal RNA small subunit methyltransferase E [Francisella cf.
           novicida 3523]
          Length = 242

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 119/225 (52%), Gaps = 14/225 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNSDSLQYKTKIIAIDNKNITLEVIDKKHINNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ E+G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATELGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   ++   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DIQIPQNDLNLVLCPYTQTKQDFVQKIKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           PEGG+   E    HS  F T ++LG RIL+++TA +  ++++  I
Sbjct: 197 PEGGFSDREMSKFHSNNFYT-INLGKRILKAETAPINILSIINFI 240


>gi|260767459|ref|ZP_05876396.1| ribosomal RNA small subunit methyltransferase E [Vibrio furnissii
           CIP 102972]
 gi|260617571|gb|EEX42753.1| ribosomal RNA small subunit methyltransferase E [Vibrio furnissii
           CIP 102972]
 gi|315181239|gb|ADT88153.1| hypothetical protein vfu_A03045 [Vibrio furnissii NCTC 11218]
          Length = 243

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 112/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTK-QSDVQ 83
           S D   ++A VLRM+EG  +L+F+G   E+ + I   GK  +  V+   R  T  +S + 
Sbjct: 21  SDDAAGHIARVLRMQEGQEVLVFDGSGAEFPAIIHEAGKK-QVVVDLAERIDTNLESPLN 79

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
                +  + +++++ IQKSVE+G+  I P+++         +     + + +   ISA 
Sbjct: 80  LHLGQVISRGDKMEFTIQKSVELGVNTITPLLSERCGVKLDAKRFEKKLQQWQKIAISAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    +P I P  TLE          ++        S N+L +      +  V +LIG
Sbjct: 140 EQCGRNVVPDIRPIMTLEAWCAEQTDALKLNLHPRAKYSINTLPE-----PVTKVRLLIG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 195 PEGGLSAEEIDMTQQYHFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|10945822|gb|AAG24651.1| unknown [Alcanivorax borkumensis]
          Length = 240

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 16/241 (6%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
           +R F D    +    +      H++  VLRM   D +++FNG+ GEWL++IS + K    
Sbjct: 3   RRFFDDQNFHVGQLVELGASASHHIGKVLRMAVADELVVFNGRGGEWLARISAISKKAVC 62

Query: 68  --KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAI------RPVITRYTQN 119
              + +    +     V      IK  R+DY IQK+ E+G  A+      R  +    + 
Sbjct: 63  IEPLTFTDEDRCAPLAVTVALPMIKGERMDYAIQKATELGATALVILDTERCEVRLKGER 122

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSL 178
               +   +   ISA EQC +  +P ++   +L ++L  +      I    E   S  +L
Sbjct: 123 QEKKLGHWQQVAISACEQCGLNRVPVVHGVLSLRDWLTSDLPALKLIAHPGEKSFSAAAL 182

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +          +A+L GPEGG+ ++E +      F +P +LG R+LR++TA VA +A + 
Sbjct: 183 QGQ------TELALLTGPEGGFSNDELQQAADAGF-SPFALGNRVLRAETAPVALLAALW 235

Query: 239 A 239
           A
Sbjct: 236 A 236


>gi|254519874|ref|ZP_05131930.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
 gi|226913623|gb|EEH98824.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
          Length = 250

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 115/242 (47%), Gaps = 21/242 (8%)

Query: 18  IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQ- 76
           I  + K  GD   +L  VLR+ EGD I+L N    E+L+ IS + K     VE + + Q 
Sbjct: 12  IDNEAKILGDDVKHLYKVLRLNEGDKIVLNNCDGEEFLASISTITKQ-EVIVEIEEKLQI 70

Query: 77  TKQSDVQ-YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTY 130
             +S V+ Y+F  + K  ++D ++QK  E+G+    P +T       +     +DR+   
Sbjct: 71  NNESSVKIYLFQGLPKAQKMDLIVQKGTELGITEFIPTLTDRVDIKLKGDFKKLDRLNRI 130

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIV--------FADETCGSENSLEKLH 182
            + AA+Q     +P +  P + +  L   ++   ++        F  +T  +   L++  
Sbjct: 131 ALEAAKQSKRSIIPNVVDPISFDEALDKMNNLDMVIVPYENAENFGIKTLFNHTDLDR-- 188

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
               I  V IL+GPEGG+  +E   L        ++LG RILR++TA   A +LVQ   G
Sbjct: 189 --TKIKTVGILVGPEGGFEEDEINRLKE-NGAYIVTLGSRILRTETAGFVATSLVQYELG 245

Query: 243 DW 244
           D 
Sbjct: 246 DL 247


>gi|90409107|ref|ZP_01217229.1| hypothetical protein PCNPT3_05034 [Psychromonas sp. CNPT3]
 gi|90309781|gb|EAS37944.1| hypothetical protein PCNPT3_05034 [Psychromonas sp. CNPT3]
          Length = 275

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 112/220 (50%), Gaps = 18/220 (8%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQT-KQSDVQYIFSPI--K 90
           HVLR+KEG NI+LFNG  G++ + +  V K     V+  + +QT  +S +      +  +
Sbjct: 62  HVLRLKEGLNIILFNGLGGQFTATLINVKKR-SCTVKITAFTQTDNESPLHLHLGQVISR 120

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAAEQCDILTL 143
             R++++IQKSVE+G+  I P+++        N++R+       +   I+A EQ     +
Sbjct: 121 GERMEFIIQKSVELGVNEITPLLSERC-GVKVNVERMAKKHQQWQKIAIAACEQSGRNIV 179

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSE 203
           P ++PP  ++          Q+        S  +L       +I N+ +LIGPEGG    
Sbjct: 180 PIVHPPQQMQQWCTQSTDALQLTLHPRALLSIKTLPD-----NISNIRLLIGPEGGLSDG 234

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           E     +L F   L LGPR+LR++TA + A++ +Q   GD
Sbjct: 235 EINLTKTLNFTETL-LGPRVLRTETATLTAISALQFRFGD 273


>gi|84394071|ref|ZP_00992807.1| hypothetical protein V12B01_07800 [Vibrio splendidus 12B01]
 gi|84375313|gb|EAP92224.1| hypothetical protein V12B01_07800 [Vibrio splendidus 12B01]
          Length = 243

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 110/228 (48%), Gaps = 20/228 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSD 81
           D   ++  VLRMKEG ++LLF+G   E+ + I+ V K     ++  ++E  S S      
Sbjct: 23  DAAGHVGRVLRMKEGQDVLLFDGSGAEFPATIAEVSKKNVTVNVTERIERSSESPLDLHL 82

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
            Q I    + +++++ IQKSVE+G   I P+I+        T+     + + +   I+A 
Sbjct: 83  GQVIS---RGDKMEFTIQKSVELGANTITPLISERCGVKLDTKRFEKKLAQWQKIAIAAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ    T+P I P   LE          ++        S N+L +      +  V +LIG
Sbjct: 140 EQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSINTLPE-----PVSKVRLLIG 194

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 195 PEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|119470540|ref|ZP_01613243.1| hypothetical protein ATW7_12016 [Alteromonadales bacterium TW-7]
 gi|119446241|gb|EAW27518.1| hypothetical protein ATW7_12016 [Alteromonadales bacterium TW-7]
          Length = 244

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 119/230 (51%), Gaps = 24/230 (10%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K     +  Q      +S ++   
Sbjct: 23  DAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVSKKNVVVMPQQFNPHDVESPLKIHL 82

Query: 87  SPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM--DRV-------RTYTISAA 135
                + +++D+ IQKSVE+G+  I P+   ++Q     +  DR+       +   I+AA
Sbjct: 83  GQCVSRGDKMDFTIQKSVELGITEITPI---FSQRCGVKLIGDRLDKKHQQWQKIAIAAA 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP--NVAIL 193
           EQ     +P ++PP  ++  L+   +  ++        +E+S++ +     +P   V  L
Sbjct: 140 EQSGRNYVPVVHPPIDIKQWLEQSTNAIKLTLHPR---AEHSIKTI----TVPEDGVRFL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +GPEGG+  EE        FV  + LGPR+LR++TAA+  ++ +Q   GD
Sbjct: 193 VGPEGGFTDEEMAQTKQQEFVD-IRLGPRVLRTETAALTVLSALQLQFGD 241


>gi|328474086|gb|EGF44891.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio parahaemolyticus
           10329]
          Length = 243

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 112/237 (47%), Gaps = 34/237 (14%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D   ++  VLRMKEG  +LLF+G   E+ + I  V K     V+   R ++       
Sbjct: 21  SEDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVIREVSKK-NVLVDVTERVESN------ 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR------- 128
           I SP+         + +++++ IQKSVE+G+  I P+I   ++     +D+ R       
Sbjct: 74  IESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLI---SERCGVKLDQKRFEKKLAQ 130

Query: 129 --TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
                ISA EQC    +P I P  +LE   +      ++        S N+L        
Sbjct: 131 WQKIAISACEQCGRNVVPEIRPIMSLEQWCQEEYDGLKLNLHPRAKYSINTLP-----TP 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  V +LIGPEGG  SEE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 186 VEKVRLLIGPEGGLSSEEIDMTREYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|239995591|ref|ZP_04716115.1| hypothetical protein AmacA2_14079 [Alteromonas macleodii ATCC
           27126]
          Length = 242

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 127/251 (50%), Gaps = 22/251 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   P+ ++ + + +    H++A VLR+K    I+LFNG   E+ ++I  V +  
Sbjct: 2   RIPRVYYPNPIPLEQEFELTEGAGHHIATVLRIKPNRPIVLFNGDGNEYSAQIISVQRK- 60

Query: 66  RFKVEYQS-RSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +  VE  +  S  K+S +         K +R+D ++QKSVE+G+  I PVIT   +    
Sbjct: 61  KVTVEADACLSLAKESPLHLHLGQGVSKGDRMDTVLQKSVELGVSEITPVIT---ERCTV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I A EQ     +P +  P +L   L +  +  ++V A    G
Sbjct: 118 KLDESRWEKKIQQWQKIIIGACEQSGRNIIPALNAPVSLNQWLSSSTNTTRLVLAP---G 174

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           +E SL +    A      +LIGPEGG    E    +   + + +SLGPRILR++TAA+ +
Sbjct: 175 AEQSLARQPYNAQ--GFRLLIGPEGGLSETEVHQANENGYQS-VSLGPRILRTETAAITS 231

Query: 234 MALVQAICGDW 244
           ++++QA  GD+
Sbjct: 232 LSILQAQHGDF 242


>gi|313897356|ref|ZP_07830899.1| RNA methyltransferase, RsmE family [Clostridium sp. HGF2]
 gi|312957726|gb|EFR39351.1| RNA methyltransferase, RsmE family [Clostridium sp. HGF2]
          Length = 252

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 110/217 (50%), Gaps = 12/217 (5%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           +Q H++  V+RM++GD I + +      L+++ Y  +    +V  + R    Q+ V+ I 
Sbjct: 21  EQTHHIRRVMRMQQGDVIRVADNSGRVLLAEVEYHQEEAAARVVREVRD-CSQTSVELIL 79

Query: 87  SP--IKTNRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQC 138
           +   IK  + DY++QKS E+G+  I P      V+    + +   + R       A EQC
Sbjct: 80  AQGMIKGEKWDYLLQKSAELGVAEIIPFVSSRCVVKIKDEKSEKKIVRWNKILCEACEQC 139

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIV-FADETCGSENSLEKLHAIAHIPNVAILIGPE 197
              TL  + PP T    L   D + +++ + D  C SE   E L A      V +++G E
Sbjct: 140 KRSTLVRLQPPCTFS-QLSQIDADLRLIAYEDADCKSERLCEVLRAHPSPKRVLMVVGSE 198

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           GG+ ++E E L +  F   +SLG RILR++TAA++ +
Sbjct: 199 GGFSADEVEALTATGF-HRVSLGGRILRAETAAISLL 234


>gi|310818984|ref|YP_003951342.1| hypothetical protein STAUR_1711 [Stigmatella aurantiaca DW4/3-1]
 gi|309392056|gb|ADO69515.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 244

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 109/227 (48%), Gaps = 9/227 (3%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           RLFV  P    T+   SGD++HYL HVLR+ EG ++ +F+G    + ++++ V  +  R 
Sbjct: 3   RLFVPLPEHPPTEVLLSGDRHHYLLHVLRLSEGASLEVFDGTGRAFEARVAAVDAREARL 62

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTH 121
            +   +RS   +  +  +    K ++L++++QK  E+G  A  PV T  +      +   
Sbjct: 63  TL-GAARSTPPRRALSVLQGLPKGDKLEWVLQKGTELGAAAFYPVDTARSVVKLEPKRAG 121

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
               R       AA QC    +P ++PP  L    +      Q++  DE   +    E  
Sbjct: 122 ERTLRWEKIVEEAARQCRRNDVPQVHPPAALLDRARALPPGTQLLVLDEEETAVPLGEAF 181

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
            A A    VA+++GPEGG   EE   L +L     ++LG  ILR++T
Sbjct: 182 RACAPGAPVALVVGPEGGLTREEVAALRAL-GARGVTLGALILRTET 227


>gi|320106034|ref|YP_004181624.1| hypothetical protein AciPR4_0797 [Terriglobus saanensis SP1PR4]
 gi|319924555|gb|ADV81630.1| protein of unknown function DUF558 [Terriglobus saanensis SP1PR4]
          Length = 237

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 114/229 (49%), Gaps = 14/229 (6%)

Query: 19  KTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL--SKISYVGKSIRFKVEYQSRSQ 76
           +T    +GDQ  +LA VLR + G    +F+   G +L  +++  VG+       ++    
Sbjct: 15  RTSASLTGDQASHLARVLRAEPGQ---IFDVVAGGFLHRAEVVNVGEDAVIFTLHEEMES 71

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT-----QNTHYNMDRVRTYT 131
                V    +  K + L++ I+K+ E+G+  I PV+ R T     Q +   ++R R   
Sbjct: 72  DAALPVHLYLAVYKFDHLEWAIEKATELGVARITPVLARRTEKHLAQASTKRVERWRRIV 131

Query: 132 ISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA 191
           + +++Q     +P +  P TL   LK      +I+ A+     EN+L       H  ++A
Sbjct: 132 LESSKQSRRTEIPVVDDPATLASTLKTCTAGTRILLAE--TEQENTLAAALK-GHAGDIA 188

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           + +GPEGG+  EE   L S    T  +LGPRILR++TA +AA+A+  +I
Sbjct: 189 LAVGPEGGWTPEEM-ALFSTQQWTHATLGPRILRAETACIAALAITSSI 236


>gi|218710623|ref|YP_002418244.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio splendidus LGP32]
 gi|218323642|emb|CAV19930.1| Hypothetical protein VS_2677 [Vibrio splendidus LGP32]
          Length = 243

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 111/230 (48%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRMKEG ++LLF+G   E+ + I+ V K     ++  ++E  S S    
Sbjct: 21  SEDAAGHVGRVLRMKEGQDVLLFDGSGAEFPATIAEVSKKNVTVNVTERIERSSESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+I+         +     + + +   I+
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVNTITPLISERCGVKLDAKRFEKKLAQWQKIAIA 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQ    T+P I P   LE          ++        S N+L +      I  V +L
Sbjct: 138 ACEQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSINTLPE-----PISKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|319765029|ref|YP_004128966.1| hypothetical protein Alide_4381 [Alicycliphilus denitrificans BC]
 gi|330827224|ref|YP_004390527.1| ribosomal RNA small subunit methyltransferase E [Alicycliphilus
           denitrificans K601]
 gi|317119590|gb|ADV02079.1| protein of unknown function DUF558 [Alicycliphilus denitrificans
           BC]
 gi|329312596|gb|AEB87011.1| Ribosomal RNA small subunit methyltransferase E [Alicycliphilus
           denitrificans K601]
          Length = 237

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 107/213 (50%), Gaps = 14/213 (6%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTN 92
            VLR++ GD + LFNG+ GEW + ++ +G+S +  +V   +  + + +   ++   +  N
Sbjct: 27  QVLRLQPGDALTLFNGEGGEWTATVARMGRSDVEVEVGAHAPVEREAARAVHLVVGMPAN 86

Query: 93  -RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
            R+D++++K+ E+G  +I+P+    +      +         +   ++A EQC    +P 
Sbjct: 87  ERMDWLVEKATELGAASIQPIAAARSVLKLAGERAAKRQQHWQAIAVAACEQCGRNRVPP 146

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH-AIAHIPNVAILIGPEGGYHSEE 204
           +  P     LL +W        A       +    L  A      V +L GPEGG  ++E
Sbjct: 147 VAAP----LLLSDWLRQSAPEGARLVLSLRDGARALREAAGGAGAVWVLHGPEGGLTAQE 202

Query: 205 KETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           ++   +  F  P SLG R+LR++TA+VAA+A++
Sbjct: 203 EDAALAQGF-EPASLGARVLRAETASVAALAVL 234


>gi|325122892|gb|ADY82415.1| hypothetical protein BDGL_001829 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 240

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 119/241 (49%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ +S + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLSEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPANRDAPFKAVLGQVMSKGDRMDYAIQKATELGVSQIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L E+L  +     + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLSSSELPQSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|332142455|ref|YP_004428193.1| hypothetical protein MADE_1015315 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552477|gb|AEA99195.1| hypothetical protein MADE_1015315 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 242

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 123/250 (49%), Gaps = 20/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   P+ ++ + + + D  H++A VLR+K    I+LFNG   E+ +++  V +  
Sbjct: 2   RIPRVYYPNPIPLEQEFELTEDAGHHIATVLRIKPNRPIVLFNGDGNEYSAQVISVQRKK 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                    S  K+S +         K +R+D ++QKSVE+G+  I PVIT   +     
Sbjct: 62  VIVEADACLSLAKESPLHLHLGQGVSKGDRMDTVLQKSVELGVSEITPVIT---ERCTVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I A EQ     +P +  P +L   L +  +  ++V A    G+
Sbjct: 119 LDESRWEKKIQQWQKIVIGACEQSGRNIIPKLNAPVSLNTWLSSSTNTTRLVLAP---GA 175

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           E  L +    A      +LIGPEGG    E    +   + + +SLGPRILR++TAA+ ++
Sbjct: 176 EQPLARQPYNAQ--GFRLLIGPEGGLSDTEIHQANENGYQS-VSLGPRILRTETAAITSL 232

Query: 235 ALVQAICGDW 244
           +++QA  GD+
Sbjct: 233 SILQAQHGDF 242


>gi|282898816|ref|ZP_06306803.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196343|gb|EFA71253.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 250

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 115/245 (46%), Gaps = 18/245 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + L+RL +      + Q   +  Q HYL  VLR+++GD  +  +G    WL++++    +
Sbjct: 2   AQLQRLTIQASQLQQNQVLLTPQQKHYLLRVLRLQDGDEFISMDGMGKWWLTRLT--ADT 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
            +       +++   S    +  P K N  D +++ S E+G+ +I PV++  T    +  
Sbjct: 60  AQILQPLTPKTELPLSITLMLALP-KGNAFDDVVRYSTELGVSSILPVLSDRTLLNPSPQ 118

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNW-DHNCQIVFADETCGSENSLEKL 181
            ++R R     AAEQ +   +P I  P      L  + +  C I      C +  S   L
Sbjct: 119 RLERWRRIAAEAAEQSERAFVPTILEPVVFNAALSEYINSQCYI------CEARGSYPHL 172

Query: 182 HAIAHIP-----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             I +IP      V + IGPEGG+   E  T     F  P+SLG RILR+ TA + A++L
Sbjct: 173 INIINIPLKNIKEVVVAIGPEGGWTETEIATAILAKF-QPVSLGDRILRAATAPIVALSL 231

Query: 237 VQAIC 241
           + A C
Sbjct: 232 IAAAC 236


>gi|254369089|ref|ZP_04985101.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122039|gb|EDO66179.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 242

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  +VLR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNVLRLKKSDLIELFNNTDSLQYKTKIITIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ ++G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATKLGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++ 
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIIN 238


>gi|88798495|ref|ZP_01114079.1| hypothetical protein MED297_05539 [Reinekea sp. MED297]
 gi|88778595|gb|EAR09786.1| hypothetical protein MED297_05539 [Reinekea sp. MED297]
          Length = 245

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 115/233 (49%), Gaps = 35/233 (15%)

Query: 29  YHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQTK-QSDVQY 84
           + +L  VLR+K+G +I +FNG+   + ++++ VGK   S R   +  +  + +  + +  
Sbjct: 27  FQHLIKVLRLKDGADIQVFNGRGDRFRAELTEVGKKQASARLLEQLDATPEPQLHTHLGL 86

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAAEQC 138
           + S  K +R DY +QK+ E+G+ +I P+ + +       +     M   +    SA EQC
Sbjct: 87  VMS--KGDRFDYALQKATELGVTSITPLTSEHCDLRLNAERQTKKMAHWQGVIESACEQC 144

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN--------V 190
              T+P +YP   L   ++  D + Q++              LH  A  P+        V
Sbjct: 145 YRDTVPILYPVRALRDWVEIQDSDVQLI--------------LHTAAQAPDWPEESPQSV 190

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           + LIGPEGG   +E +      F++   LGPRILR++TA V  ++L+Q   GD
Sbjct: 191 SFLIGPEGGLSDDEVQWSLKNDFMS-WQLGPRILRTETAPVVMLSLLQNKWGD 242


>gi|331015976|gb|EGH96032.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 275

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 109/230 (47%), Gaps = 19/230 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK  R
Sbjct: 3   LSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK-R 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            +V+   R   Q +     ++   + +  R+D+ IQK+ E+G+  I P+++         
Sbjct: 61  VRVQLTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLKD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +         +   ISA EQC    +P I+PP  L   +K  + + ++V           
Sbjct: 121 ERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVL-------HPV 173

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
            E L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++
Sbjct: 174 AEPLTSHAKPASLAFLIGPEGGLNDAEVDQAQNAGFHA-ARLGPRVLRTE 222


>gi|77163661|ref|YP_342186.1| hypothetical protein Noc_0123 [Nitrosococcus oceani ATCC 19707]
 gi|254435009|ref|ZP_05048516.1| conserved hypothetical protein TIGR00046 [Nitrosococcus oceani
           AFC27]
 gi|76881975|gb|ABA56656.1| 16S rRNA m(3)U-1498 methyltransferase [Nitrosococcus oceani ATCC
           19707]
 gi|207088120|gb|EDZ65392.1| conserved hypothetical protein TIGR00046 [Nitrosococcus oceani
           AFC27]
          Length = 243

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 120/249 (48%), Gaps = 29/249 (11%)

Query: 12  VDFPLCIKTQGKASGDQ--YHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV 69
           V FPL +      S D+    Y+  VLR++ G  + LF+G+  E+ + +  + K    KV
Sbjct: 6   VYFPLSLSIGSSVSLDERALQYVIRVLRLRLGAQLRLFDGRGAEYQAVLETIEKRA-VKV 64

Query: 70  EYQSRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQ-- 118
               R +       ++ SP+         +  R+DY +QK+VE+G+  I P++T  +   
Sbjct: 65  RILERIE------HHVESPLHIILGQGISRGERMDYALQKAVELGVSRIIPLLTERSAVN 118

Query: 119 -NTHYNMDRVRTY---TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
            +      R+R +    ISA EQC    +P +  P  L   L++ DH    V  D    S
Sbjct: 119 LSAERAEKRLRHWQGVIISACEQCGRNYIPPVDTPRPLADFLRD-DHRGLAVLLDPR--S 175

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              L+ L  +     + +LIGPEGG +  E +      F+  + LGPRILR++TA VAA+
Sbjct: 176 RRPLKAL-PLPLDNRLIVLIGPEGGLNKGEAKQAQQADFIG-VCLGPRILRTETATVAAL 233

Query: 235 ALVQAICGD 243
             +Q + GD
Sbjct: 234 TALQLLWGD 242


>gi|291615399|ref|YP_003525556.1| hypothetical protein Slit_2944 [Sideroxydans lithotrophicus ES-1]
 gi|291585511|gb|ADE13169.1| protein of unknown function DUF558 [Sideroxydans lithotrophicus
           ES-1]
          Length = 245

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 114/244 (46%), Gaps = 12/244 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R +   PL + T  +   +  H+ + VLR++ GD + +F+G      + I+ +       
Sbjct: 5   RFYCPPPLPLATNFELPPEAAHHASRVLRLRVGDAVQIFDGLGNALDATINAINGKHVLL 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPV-----ITRYTQ-NT 120
              Q+    ++S +    +     + ++D+++QK+ E+G   I PV     + R +    
Sbjct: 65  GNLQTFMGQQESGLHIALAQAMCTSEKMDWVVQKATELGAAEIIPVQTLRSVARLSSPRA 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
               +  R   +SA EQC   TLP +  P  L   L++  H     F     G+ N   +
Sbjct: 125 EKRAEHWRNVAVSACEQCGRNTLPQLQTPQELGTWLEDVRHTAGGKFILLPGGAINLQSQ 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                      +LIGPEGG+ ++E        F+ P+ LGPR+LR++TAA+A +A +Q +
Sbjct: 185 PRPQGR---ATLLIGPEGGFTADEANIAQQAGFI-PILLGPRVLRTETAALAGIAALQTL 240

Query: 241 CGDW 244
            GD+
Sbjct: 241 WGDF 244


>gi|182626905|ref|ZP_02954639.1| RNA methyltransferase, RsmE family [Clostridium perfringens D str.
           JGS1721]
 gi|177907755|gb|EDT70367.1| RNA methyltransferase, RsmE family [Clostridium perfringens D str.
           JGS1721]
          Length = 250

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THAKITGEDVKHIYKVLRVKAGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPQVLEPMDFKEVLEKIDQLDLMVIPYENATGYGIRAMVNSIEDKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIITLGPRILRTETAGFTCISLIQYELGDL 246


>gi|260773596|ref|ZP_05882512.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           metschnikovii CIP 69.14]
 gi|260612735|gb|EEX37938.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           metschnikovii CIP 69.14]
          Length = 243

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 112/234 (47%), Gaps = 28/234 (11%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM+ G ++ LF+G D E+ + IS + K  +  V+ Q R +      + 
Sbjct: 21  SDDAANHIGKVLRMQPGQSVTLFDGSDAEFPAVISEISKK-QLTVDIQQRIE------KS 73

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRT 129
           I SP+         + +++++ IQKSVE+G+  I P+++         +     + + + 
Sbjct: 74  IESPLNLHLGQVISRGDKMEFTIQKSVELGVNTITPLLSERCGVKLDPKRFEKKLQQWQK 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I P   LE          ++        S N+L +      +  
Sbjct: 134 IAIAACEQCGRNIVPVIRPVMELEAWCAEPSQALKLNLHPRASYSINTLPE-----PVNK 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG   +E        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 189 VRLLIGPEGGLSEQEIAMTEQYHFAETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|182418451|ref|ZP_02949745.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237666873|ref|ZP_04526858.1| conserved surface protein [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377833|gb|EDT75377.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237658072|gb|EEP55627.1| conserved surface protein [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 253

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 118/238 (49%), Gaps = 18/238 (7%)

Query: 22  GKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSD 81
           G   G+   ++  VLR+ EG+ I+L N +  E+L KI+ + KS       Q      +SD
Sbjct: 16  GIIVGEDVKHIYKVLRLSEGEEIILNNCEGIEYLGKINSINKSEVIVDIIQKLDTNNESD 75

Query: 82  VQ-YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTISAA 135
           ++ Y+F  + K  ++D ++QK  E+G+    P IT       +     +DR+    + A+
Sbjct: 76  IKIYLFQGLPKGQKMDLIVQKGTELGINEFIPTITDRVDVKLKGEFKKLDRLNRIALEAS 135

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA----DETCGSENSLEKLHA----IAHI 187
           +Q     +P +      E  + N + N  +V       E  G +  ++KL      +++I
Sbjct: 136 KQSKRSIIPKVKEVINFEEAMLNLE-NMDLVIVPYENAENFGVKTLMKKLREEKEDLSYI 194

Query: 188 PNVAILIGPEGGYHSEE-KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            NV I+IGPEGG+  +E KE  +   ++  ++LG RILR++TA   A AL+Q    D 
Sbjct: 195 HNVGIVIGPEGGFEEDEIKELSNRGAYI--VTLGRRILRTETAGFTATALIQYELSDL 250


>gi|56476009|ref|YP_157598.1| 16S ribosomal RNA methyltransferase RsmE [Aromatoleum aromaticum
           EbN1]
 gi|56312052|emb|CAI06697.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 241

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 122/245 (49%), Gaps = 13/245 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R F   PL    + +      H+   VLR+++GD ++LF+G+ GE  +++   G+ ++
Sbjct: 3   ISRFFFPCPLPDSGEIELPDALAHHALRVLRLRDGDPLVLFDGRGGELAARLQVRGRDAL 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYTQN 119
             + EY +  +     +  + +     ++D+++QK+VE+G  A+ P      V+    + 
Sbjct: 63  AVRDEYHALERESPLSLVLVQALASGEKMDWIVQKAVELGTSALVPLQAERCVLKLSGER 122

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            H  +   R   ISA EQ     +P I P T L   L +     ++V          SL 
Sbjct: 123 AHKRVAHWRQVAISACEQSGRNRVPEIEPITGLREYLASAAVGSRLVLTPVEGRRLASLA 182

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +  A  H+     L+GPEGG+  EE     +   V P+ LGPR+LR++TA +AA+A +QA
Sbjct: 183 RPDAALHL-----LVGPEGGWSDEELAMCRAAGCV-PVGLGPRVLRTETAGLAAVAALQA 236

Query: 240 ICGDW 244
           + GD+
Sbjct: 237 LWGDF 241


>gi|161936292|ref|YP_131254.2| 16S ribosomal RNA methyltransferase RsmE [Photobacterium profundum
           SS9]
          Length = 243

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/253 (30%), Positives = 123/253 (48%), Gaps = 44/253 (17%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QGK   S D  +++  V+RM+ G  +LLF+G D E+ + IS   K    +V+ Q
Sbjct: 9   PELLPSQGKVMLSDDAANHVGRVMRMQVGQEVLLFDGSDAEFPAVISTASKK-NVEVDIQ 67

Query: 73  SRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            R++        I SP+         +  ++++ IQKSVE+G+  I P+I+        N
Sbjct: 68  CRNENS------IESPLNIHLGQVISRGEKMEFTIQKSVELGVMTITPLISERC-GVKLN 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R        +   ++A EQC    +P I P   LE    +W   C    A+E  G + 
Sbjct: 121 AERFEKKLSQWQKIVVAACEQCGRNVIPEIRPVMKLE----DW---C----AEEYDGLKL 169

Query: 177 SLEKL--HAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           +L     ++I  +P     V +LIGPEGG  +EE        F   L LGPR+LR++T A
Sbjct: 170 NLHPRANYSINTLPEPVTKVRLLIGPEGGLSAEEISMTEQYKFDEIL-LGPRVLRTETTA 228

Query: 231 VAAMALVQAICGD 243
           + A+  +Q   GD
Sbjct: 229 MTAITALQVRFGD 241


>gi|121590723|ref|ZP_01678055.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153819149|ref|ZP_01971816.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227080679|ref|YP_002809230.1| hypothetical protein VCM66_0454 [Vibrio cholerae M66-2]
 gi|229507107|ref|ZP_04396613.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae BX
           330286]
 gi|298501000|ref|ZP_07010801.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121547454|gb|EAX57563.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|126510294|gb|EAZ72888.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227008567|gb|ACP04779.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229355852|gb|EEO20772.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae BX
           330286]
 gi|297540248|gb|EFH76308.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 243

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSLNTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|153826558|ref|ZP_01979225.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|149739650|gb|EDM53864.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
          Length = 243

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKKQVLANITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|168204735|ref|ZP_02630740.1| RNA methyltransferase, RsmE family [Clostridium perfringens E str.
           JGS1987]
 gi|169343763|ref|ZP_02864762.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|169298323|gb|EDS80413.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|170663617|gb|EDT16300.1| RNA methyltransferase, RsmE family [Clostridium perfringens E str.
           JGS1987]
          Length = 250

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPQVLEPMDFKGVLEKIDQLDLMVIPYENATGYGIRAMVNSIEDKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIVTLGPRILRTETAGFTCISLIQYELGDL 246


>gi|18311008|ref|NP_562942.1| hypothetical protein CPE2026 [Clostridium perfringens str. 13]
 gi|168208728|ref|ZP_02634353.1| RNA methyltransferase, RsmE family [Clostridium perfringens B str.
           ATCC 3626]
 gi|168212937|ref|ZP_02638562.1| RNA methyltransferase, RsmE family [Clostridium perfringens CPE
           str. F4969]
 gi|18145690|dbj|BAB81732.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|170712974|gb|EDT25156.1| RNA methyltransferase, RsmE family [Clostridium perfringens B str.
           ATCC 3626]
 gi|170715557|gb|EDT27739.1| RNA methyltransferase, RsmE family [Clostridium perfringens CPE
           str. F4969]
          Length = 250

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPEVLEPMDFKGVLEKIDELDLMVIPYENATGYGIRAMVNSIENKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIVTLGPRILRTETAGFTCISLIQYELGDL 246


>gi|153802600|ref|ZP_01957186.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124121863|gb|EAY40606.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 243

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKKKVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|293609672|ref|ZP_06691974.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828124|gb|EFF86487.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 240

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 119/241 (49%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPANRDAPFKAVLGQVMSKGDRMDYAIQKATELGVSQIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L E+L  +     + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLSSSELPQSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|169632941|ref|YP_001706677.1| hypothetical protein ABSDF1185 [Acinetobacter baumannii SDF]
 gi|169151733|emb|CAP00535.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 240

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 119/241 (49%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +  +LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQAILFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + I   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPVDRNAPFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC-QIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L   L + D    + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLNSSDLPVSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSDNEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|262403905|ref|ZP_06080462.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC586]
 gi|262349867|gb|EEY99003.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC586]
          Length = 243

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITARVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|270158328|ref|ZP_06186985.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289163426|ref|YP_003453564.1| Ribosomal RNA small subunit methyltransferase E (16S rRNA m3U1498
           methyltransferase) [Legionella longbeachae NSW150]
 gi|269990353|gb|EEZ96607.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288856599|emb|CBJ10406.1| Ribosomal RNA small subunit methyltransferase E (16S rRNA m3U1498
           methyltransferase) [Legionella longbeachae NSW150]
          Length = 242

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 121/231 (52%), Gaps = 22/231 (9%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S +   ++  VLRM+EG+++ LF G + E+ + I  V K     V    +  +++S +  
Sbjct: 21  SPEASQHVGVVLRMQEGEHLTLFCGDNREFDAIIETVKKKQVIVVVGSIKKVSRESPLTI 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT----------RYTQNTHYNMDRVRTYTI 132
             +    K  R+++++QK+VE+G+ +I P++T          R T+  H    + +   I
Sbjct: 81  HLAQAISKGERMEWVMQKAVELGVASITPILTERCVVKLDQERMTKKLH----QWQAIVI 136

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           +A EQ    ++P ++ P TL   L+      + +        +N   + +    + ++ +
Sbjct: 137 AACEQSGRNSVPQVHAPVTLSRYLEEIQAELKFILHP----GQNKTWRDYTF-KVADIVL 191

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           LIGPEGG   +E +      F  PLSLGPRILR++TAA+ A++++QA+ GD
Sbjct: 192 LIGPEGGLSEQEVQYTSKHGF-QPLSLGPRILRTETAAITALSVLQAVGGD 241


>gi|114048821|ref|YP_739371.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. MR-7]
 gi|113890263|gb|ABI44314.1| protein of unknown function DUF558 [Shewanella sp. MR-7]
          Length = 243

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   G KS+  
Sbjct: 5   RIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGNGNDYLAEIVDAGKKSVTV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQN 119
           KV     +   +S +      +  + +R+++ IQKSVE+G+  I P+      +    + 
Sbjct: 65  KV-LSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLTGER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   ISA EQ     +P + P   L+          ++          N L+
Sbjct: 124 LEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQEWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LSHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|260556741|ref|ZP_05828959.1| RNA methyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|260410000|gb|EEX03300.1| RNA methyltransferase [Acinetobacter baumannii ATCC 19606]
          Length = 240

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 118/241 (48%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + I   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPVNRNAPFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L   L + D    + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLNSSDLPASKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSDNEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|90580291|ref|ZP_01236098.1| hypothetical protein VAS14_20206 [Vibrio angustum S14]
 gi|90438593|gb|EAS63777.1| hypothetical protein VAS14_20206 [Vibrio angustum S14]
          Length = 225

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 119/240 (49%), Gaps = 40/240 (16%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  V+RM+ G  +L+F+G + E+ + I+   K    +VE QSR +        
Sbjct: 3   SDDAANHVGRVMRMQVGQELLMFDGSNAEFPAVITNASKK-SVEVEIQSRVE------HS 55

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRT 129
           I SP+         + +++++ IQKSVE+G+  I P+I+         +     +D+ + 
Sbjct: 56  IESPLDIHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLNAERFEKKLDQWQK 115

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKLHAIAHI 187
             I+A EQC    +P I P   LE     W   C    A+E  G + +L     ++I  +
Sbjct: 116 IAIAACEQCGRNVVPTIRPVMKLE----QW---C----AEEYDGLKLNLHPRANYSINTL 164

Query: 188 P----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           P    NV +LIGPEGG  ++E        F   L LGPR+LR++T A+ A+  +Q   GD
Sbjct: 165 PTPVTNVRLLIGPEGGLSADEISMTEQYKFDEIL-LGPRVLRTETTAMTAITALQVRFGD 223


>gi|153216268|ref|ZP_01950361.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124114357|gb|EAY33177.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 243

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQTGQEVLLFDGLGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|330830726|ref|YP_004393678.1| hypothetical protein B565_3026 [Aeromonas veronii B565]
 gi|328805862|gb|AEB51061.1| hypothetical protein B565_3026 [Aeromonas veronii B565]
          Length = 243

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 112/236 (47%), Gaps = 32/236 (13%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQ 83
           S D  +++  VLRM+ G  + LFNG   ++ + I+ VG KS+   ++          DVQ
Sbjct: 21  SEDGANHIGRVLRMQPGQQLELFNGDGNQYPATIANVGKKSVEVTID--------SCDVQ 72

Query: 84  YIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV------- 127
            + SP+         + +++D+ IQKSVE+G+  I P+ +          DR+       
Sbjct: 73  SVESPLAIHLGQVISRGDKMDFTIQKSVELGVTCITPLFSERC-GVKLPADRLEKKREQW 131

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   ISA EQC    +P +  P  L+  L       ++        +E S+  L    H 
Sbjct: 132 QKVVISACEQCGRNVVPEVRMPIELDAWLAEETKELKLNLHPR---AEYSINTLPVPEH- 187

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             V +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 188 -GVRLLIGPEGGLSSDEIARTVQEDFKEML-LGPRVLRTETAALTAITALQCRFGD 241


>gi|258620733|ref|ZP_05715768.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586931|gb|EEW11645.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 243

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPSEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|229828427|ref|ZP_04454496.1| hypothetical protein GCWU000342_00488 [Shuttleworthia satelles DSM
           14600]
 gi|229793021|gb|EEP29135.1| hypothetical protein GCWU000342_00488 [Shuttleworthia satelles DSM
           14600]
          Length = 246

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 118/243 (48%), Gaps = 8/243 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++++FVD            G+   +L  V+R++ G+ + +      ++   +  V +   
Sbjct: 1   MQQVFVDARQVNDEIVTIQGEDARHLGRVVRIRPGEEVRVSVRGGRDYYGHVLMVDREEM 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
                +  + T+ +    +F  I K +R++ +I+K+VE+G+  I PV TRY       + 
Sbjct: 61  TVKLVEEAASTELAQKICLFQAIPKGDRMETVIEKAVELGVYEIVPVETRYCVVRLDEKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKN-WDHNCQIVFADETCGSENSL 178
                +R +    +AA Q     +P I P T  +  L +  D +  ++  +   G + + 
Sbjct: 121 KARKRERWQAIAANAARQSKRSIIPRIAPVTPYQKALDDAGDADLVLLPYENARGMQATG 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L A+AH   + I IGPEGG+ ++E +       +  +SLG RILR+DTAA+AAM +V 
Sbjct: 181 EALTAVAHAGGIGIFIGPEGGFAADEIKAAQGKDNIRVISLGRRILRTDTAAIAAMTMVM 240

Query: 239 AIC 241
             C
Sbjct: 241 MAC 243


>gi|121635582|ref|YP_975827.1| hypothetical protein NMC1899 [Neisseria meningitidis FAM18]
 gi|120867288|emb|CAM11059.1| hypothetical protein NMC1899 [Neisseria meningitidis FAM18]
          Length = 241

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 117/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     +++S++ K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAARLSFLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|262376600|ref|ZP_06069828.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308310|gb|EEY89445.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 236

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 123/244 (50%), Gaps = 25/244 (10%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSI 65
           + R ++D  L I    + +   +H+   VLR + G++  LFNG+ GE+   ++ V  KS 
Sbjct: 1   MPRFYIDADLTIDVSLELTETVFHHWVKVLRAQVGESATLFNGQGGEYDVTLTEVAKKSA 60

Query: 66  RFKVEY---QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
              V      +R+   Q+ +  + S  K +R+DY IQK+VE+G+  I+ + + + +    
Sbjct: 61  TVSVNAFNPANRTPKFQALLGQVMS--KGDRMDYAIQKAVELGVSEIQLLTSDHCEMRLK 118

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DETCG 173
                  +D  +   I+A EQC +  +P I  P +LE  L     N ++V A   DET  
Sbjct: 119 YDRDQKKLDHWQGIAIAACEQCGLNIVPEILAPMSLEKWLNTELPNTKLVLAPNKDET-- 176

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
                  + A A + ++A+LIGPEGG    E    +   F+    +G R+LR++TA V A
Sbjct: 177 ------DVLADATL-DLALLIGPEGGLSEAEISAANQKGFLN-WCIGERVLRTETAPVVA 228

Query: 234 MALV 237
           ++++
Sbjct: 229 LSIL 232


>gi|254226308|ref|ZP_04919899.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125621170|gb|EAZ49513.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 243

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGITTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|113969034|ref|YP_732827.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. MR-4]
 gi|113883718|gb|ABI37770.1| protein of unknown function DUF558 [Shewanella sp. MR-4]
          Length = 243

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   G KS+  
Sbjct: 5   RIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGDGNDYLAEIVDAGKKSVTV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQN 119
           KV     +   +S +      +  + +R+++ IQKSVE+G+  I P+      +    + 
Sbjct: 65  KV-LSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLTGER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   ISA EQ     +P + P   L+          ++          N L+
Sbjct: 124 LEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQEWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LSHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|117921881|ref|YP_871073.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. ANA-3]
 gi|117614213|gb|ABK49667.1| protein of unknown function DUF558 [Shewanella sp. ANA-3]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRF 67
           R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   G KS+  
Sbjct: 5   RIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGDGNDYLAEIVDAGKKSVTV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQN 119
           KV     +   +S +      +  + +R+++ IQKSVE+G+  I P+      +    + 
Sbjct: 65  KV-LSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLTGER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   ISA EQ     +P + P   L+          ++          N L+
Sbjct: 124 LEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQQWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LSHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|332305394|ref|YP_004433245.1| hypothetical protein Glaag_1016 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172723|gb|AEE21977.1| protein of unknown function DUF558 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 242

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 113/230 (49%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQ-SRSQTKQSDV 82
           + D  +++A+VLR K G  ++LFNG   E+  +   V K  +R +++ + S S      +
Sbjct: 21  TSDASNHVANVLRSKVGQPVVLFNGDGNEYSGEFIDVSKRKVRVQIDAKLSISLESPLSI 80

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---------QNTHYNMDRVRTYTIS 133
                  + +R+D ++QKSVE+G+  I P+IT            Q  H    ++    I+
Sbjct: 81  HLGQGISRGDRMDLVLQKSVELGVTEITPLITERCGVKLDAQRWQKKHAQWQKI---IIA 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC    +P ++ PT  +  +       ++        +E S    H       V +L
Sbjct: 138 ACEQCGRNVIPTLHMPTEFQAWVNQSTPALRLTLHPR---AEKSFR--HTAVGSDGVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  +E        F T + LGPR+LR++TAA+ A++ +QAI GD
Sbjct: 193 IGPEGGFSDQELYQTEQGGFHT-VQLGPRVLRTETAAITAISALQAIYGD 241


>gi|121728575|ref|ZP_01681596.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147674458|ref|YP_001215995.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio cholerae O395]
 gi|229519855|ref|ZP_04409289.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae TM
           11079-80]
 gi|229530311|ref|ZP_04419699.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           12129(1)]
 gi|254291180|ref|ZP_04961976.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|261210046|ref|ZP_05924344.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC341]
 gi|262167137|ref|ZP_06034851.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           RC27]
 gi|121629131|gb|EAX61574.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|146316341|gb|ABQ20880.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|150422874|gb|EDN14825.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227012322|gb|ACP08532.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229332084|gb|EEN97572.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           12129(1)]
 gi|229343143|gb|EEO08127.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae TM
           11079-80]
 gi|260840811|gb|EEX67353.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC341]
 gi|262024437|gb|EEY43124.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           RC27]
 gi|327483322|gb|AEA77729.1| Ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           LMA3894-4]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|229512531|ref|ZP_04402002.1| small ribosomal subunit 16S rRNA methyltransferase [Vibrio cholerae
           TMA 21]
 gi|229350424|gb|EEO15373.1| small ribosomal subunit 16S rRNA methyltransferase [Vibrio cholerae
           TMA 21]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITDRVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCSEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|312883853|ref|ZP_07743570.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368311|gb|EFP95846.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 118/242 (48%), Gaps = 44/242 (18%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEY-QSRSQTKQSDVQ 83
           S +   ++  VLRMK G  + LF+G   E+++ IS   K    +VE  QS  ++ +S+++
Sbjct: 21  SEEAAGHVGRVLRMKIGQELRLFDGSGSEFIATISSQSKK-NVEVEVKQSIERSAESNLK 79

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR---------TYTI 132
                +  + +++++ IQKSVE+G+  I P+I+   +     +D+ R            I
Sbjct: 80  LHLGQVISRGDKMEFTIQKSVELGVEVITPLIS---ERCGVKLDQKRFEKKLAQWQKIAI 136

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIA 185
           SA EQC    +P I P  +LE    NW            CG E    KL       ++I 
Sbjct: 137 SACEQCGRNRIPSIRPIMSLE----NW------------CGEEYDGLKLNLHPRADYSIN 180

Query: 186 HIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
            +P     V +LIGPEGG    E +      F + + LGPR+LR++TAA+ A+  +Q   
Sbjct: 181 TLPTPVEQVKLLIGPEGGLSEAEIDMTQKYAF-SDILLGPRVLRTETAALTAITALQVRF 239

Query: 242 GD 243
           GD
Sbjct: 240 GD 241


>gi|89256081|ref|YP_513443.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314557|ref|YP_763280.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. holarctica OSU18]
 gi|169656563|ref|YP_001428163.2| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|290954533|ref|ZP_06559154.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295312049|ref|ZP_06802864.1| 16S ribosomal RNA methyltransferase RsmE [Francisella tularensis
           subsp. holarctica URFT1]
 gi|89143912|emb|CAJ79131.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129456|gb|ABI82643.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|164551631|gb|ABU61207.2| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 242

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYV-GKSIRFKVEYQSRSQTKQSDV 82
           SG+ Y+Y  ++LR+K+ D I LFN  D  ++ +KI  +  K+I  +V  +     + + +
Sbjct: 21  SGEYYNYFKNMLRLKKSDLIELFNNTDSLQYKTKIITIDNKNITLEVIDKKHISNENNYI 80

Query: 83  QYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTYTISAA 135
             ++   IK+   + +IQK+ ++G+  I P+IT +T +          ++R     I+ +
Sbjct: 81  TNLYQAIIKSENFELVIQKATKLGVNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGS 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC  + +P I+ P  +   L+   ++  +V    T   ++ ++K+ +     N  I IG
Sbjct: 141 EQCGRVFIPKIHTPIDIN-DLQMPQNDLNLVLCPYTQAKQDFVQKVKSST---NFNIFIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           PEGG+  +E    HS  F T ++LG RIL+++TA +  ++++ 
Sbjct: 197 PEGGFSDKEMSKFHSNNFYT-INLGKRILKAETAPINILSIIN 238


>gi|119475424|ref|ZP_01615777.1| hypothetical protein GP2143_16431 [marine gamma proteobacterium
           HTCC2143]
 gi|119451627|gb|EAW32860.1| hypothetical protein GP2143_16431 [marine gamma proteobacterium
           HTCC2143]
          Length = 241

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 112/222 (50%), Gaps = 15/222 (6%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQS-DVQYIFS 87
           H+L+ VLR+K G +++LFNG   ++   I+ +G KS+   ++ +    ++ S  +    +
Sbjct: 26  HHLSKVLRLKVGSDVILFNGDGYDYSGHINAIGKKSVGIYIDSREIKHSESSLKIHLGVA 85

Query: 88  PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTISAAEQCDIL 141
             K +R+D++IQKS E+G+  I P++T  T+               +   ISA EQ    
Sbjct: 86  VSKGDRMDWIIQKSTELGVDEITPLLTERTELKLKGDRKEKKQHHWQQIAISACEQSGRA 145

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYH 201
            LP I     L   ++  +   + V    +    NS +       + +  +LIGPEGG  
Sbjct: 146 QLPSINRIQHLSEWIQTIEATRKFVLHHRSTALLNSNDD------VSSACLLIGPEGGL- 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           SE++  L        L LGPRILR++TA +AA++++Q   GD
Sbjct: 199 SEDEIALAEHYHFDALQLGPRILRTETAPLAAISILQHHWGD 240


>gi|262164080|ref|ZP_06031819.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           VM223]
 gi|262027608|gb|EEY46274.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           VM223]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQTGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVRLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|258625617|ref|ZP_05720499.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262172417|ref|ZP_06040095.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           MB-451]
 gi|258582119|gb|EEW06986.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|261893493|gb|EEY39479.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           MB-451]
          Length = 243

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQTGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|218778356|ref|YP_002429674.1| hypothetical protein Dalk_0499 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759740|gb|ACL02206.1| protein of unknown function DUF558 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 257

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 120/247 (48%), Gaps = 10/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           +  +R +++       +   +G    +   VLR+ +GD ++L +    E++  I   G +
Sbjct: 2   AETRRFYIEPEQITGDRAFITGQDAKHAKKVLRLAKGDPVILLDNSGLEYMGVILSAG-A 60

Query: 65  IRFKVEYQSR---SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              +VE Q R   +      +    + IKT+++D +++   E+GM   RP     +    
Sbjct: 61  RDMEVEIQDRRLGATESPLKIDLAMAMIKTSKMDKLLKGVTELGMHGWRPFYASRSVPKV 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK-NWDHNCQIVFADETCGSEN 176
           ++     DR +     A +QC+ + LP ++ P + E L   + +++  +VF +++     
Sbjct: 121 KDPEDRRDRWKKIAAEAVKQCERVRLPDVHAPVSFEELCAISAEYDLGVVFWEKSRTPFQ 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            + +    +   +V ++IGPEGG+   E   L     V    LGPRILR++TAA+A+ AL
Sbjct: 181 QVLQSRLDSPPKSVLVVIGPEGGFEDHETARLEESGMVH-AGLGPRILRAETAALASCAL 239

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 240 IQAGFGD 246


>gi|332875286|ref|ZP_08443118.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6014059]
 gi|323518770|gb|ADX93151.1| hypothetical protein ABTW07_2727 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332736543|gb|EGJ67538.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6014059]
          Length = 240

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 117/241 (48%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L  ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLVTLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + I   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPVNRNAPFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L   L + D    + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLNSSDLPTSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|262191080|ref|ZP_06049287.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae CT
           5369-93]
 gi|297580608|ref|ZP_06942534.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|262033056|gb|EEY51587.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae CT
           5369-93]
 gi|297535024|gb|EFH73859.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 243

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITDRVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S N+L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSINTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|222112634|ref|YP_002554898.1| 16S ribosomal RNA methyltransferase rsme [Acidovorax ebreus TPSY]
 gi|221732078|gb|ACM34898.1| protein of unknown function DUF558 [Acidovorax ebreus TPSY]
          Length = 242

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 107/208 (51%), Gaps = 11/208 (5%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTN 92
            VLR++ GD + LFNG+ GEW + ++++G+S ++ +V   S  + + +   ++   +  N
Sbjct: 27  QVLRLQPGDAVTLFNGEGGEWSATVTHMGRSDVQVQVGSHSAVEREAARAVHLVVGMPAN 86

Query: 93  -RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
            R+D++++K+ E+G  +I+P+    +      +         +   ++A EQC    +P 
Sbjct: 87  ERMDWLVEKATELGAASIQPIAAARSVLKLSGERAAKRQQHWQAIAVAACEQCGRNRVPS 146

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK--LHAIAHIPNVAILIGPEGGYHSE 203
           ++ P +L   L+    +     A     S  S  +    A A    V +L GPEGG  ++
Sbjct: 147 VHAPLSLADWLRQPPADALAPDAARLLLSLRSGSRPLREAAAEAGAVWVLHGPEGGLTAQ 206

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAV 231
           E++   +  F  P SLG R+LR++TA+V
Sbjct: 207 EEDAALAQGF-APASLGARVLRAETASV 233


>gi|225076881|ref|ZP_03720080.1| hypothetical protein NEIFLAOT_01932 [Neisseria flavescens
           NRL30031/H210]
 gi|224951767|gb|EEG32976.1| hypothetical protein NEIFLAOT_01932 [Neisseria flavescens
           NRL30031/H210]
          Length = 241

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 121/248 (48%), Gaps = 18/248 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG +G+    +  V +  R
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNG-NGKAYPALPEVLEKRR 58

Query: 67  FKVEYQSRSQTKQS---DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V       T      ++  + +     R+D+ +QKSVE+G+  IRPVI+         
Sbjct: 59  ASVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSG 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     ++R +   +SA EQ     +P + P TT    L+        +       S N 
Sbjct: 119 ERAEKRVERWQEIVVSACEQSGRNIVPKVLPLTTYAQALQQLPQETTKLLM-----SLNR 173

Query: 178 LEKLHAI-AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +KL  +      V  ++GPEGG+  +E++      F + ++LG R+LR++TA++AA+A 
Sbjct: 174 AQKLSDVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGFQS-VTLGKRVLRTETASLAAIAA 232

Query: 237 VQAICGDW 244
           +Q + GD+
Sbjct: 233 MQTLWGDF 240


>gi|292493337|ref|YP_003528776.1| hypothetical protein Nhal_3352 [Nitrosococcus halophilus Nc4]
 gi|291581932|gb|ADE16389.1| protein of unknown function DUF558 [Nitrosococcus halophilus Nc4]
          Length = 243

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 117/247 (47%), Gaps = 15/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL I +          ++  VLR++ G  + LF+G+  E+ + +  V K S
Sbjct: 2   RVPRIYSSLPLSIGSSVVLDERALQHVVRVLRLRAGAELWLFDGRGTEYRAVLETVEKRS 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
              ++ E   R+     D+       +  R+DY +QK+VE+G+  I P+ T  +   H +
Sbjct: 62  AEARILERMERNVESPLDIILGQGISRGERMDYALQKAVELGVSGIVPLFTERSA-VHLS 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R+       R   ISA EQC     P +  P +L   L +  H    V  D    S  
Sbjct: 121 GERLEKRLRHWRGVVISACEQCGRNYTPGVDTPRSLAAFLGDC-HAGLAVLLDPR--SHR 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+ L +      + +LIGPEGG    E +      F+  +SLGPR+LR++TA VAA+  
Sbjct: 178 PLKTLPSPLG-KRLILLIGPEGGLSEVEVKEAQQAGFID-VSLGPRVLRTETATVAALTA 235

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 236 LQLLWGD 242


>gi|89074101|ref|ZP_01160600.1| hypothetical protein SKA34_22077 [Photobacterium sp. SKA34]
 gi|89050037|gb|EAR55563.1| hypothetical protein SKA34_22077 [Photobacterium sp. SKA34]
          Length = 225

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 119/240 (49%), Gaps = 40/240 (16%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  V+RM+ G  +L+F+G + E+ + I+   K    +VE QSR +        
Sbjct: 3   SDDAANHVGRVMRMQAGQELLMFDGSNAEFPAVITNASKK-SVEVEIQSRVENN------ 55

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRT 129
           I SP+         + +++++ IQKSVE+G+  I P+I+         +     +++ + 
Sbjct: 56  IESPLDIHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLNAERFEKKLEQWQK 115

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKLHAIAHI 187
             I+A EQC    +P I P   LE     W   C    A+E  G + +L     ++I  +
Sbjct: 116 IAIAACEQCGRNVVPTIRPVMKLE----QW---C----AEEYDGLKLNLHPRAKYSINTL 164

Query: 188 P----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           P    N+ +LIGPEGG  +EE        F   L LGPR+LR++T A+ A+  +Q   GD
Sbjct: 165 PTPVTNLRLLIGPEGGLSAEEIGMTEEYKFDEIL-LGPRVLRTETTAMTAITALQVRFGD 223


>gi|85711779|ref|ZP_01042835.1| hypothetical protein OS145_07806 [Idiomarina baltica OS145]
 gi|85694394|gb|EAQ32336.1| hypothetical protein OS145_07806 [Idiomarina baltica OS145]
          Length = 249

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 117/244 (47%), Gaps = 14/244 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R+F   PL + +    S D + +   VLRM+EG  + LF   D  + + ++ V K S + 
Sbjct: 5   RIFHPEPLTVNSTVSLSDDAFQHTIKVLRMQEGQALELFCNDDFNYAAVLTSVAKKSAQV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
           ++     + T+     ++   + + +R+D+ +QKSVE+G+ AI P+ +        N DR
Sbjct: 65  EITGAQLNSTESPLFVHLGQVVSRGDRMDFALQKSVELGVNAITPLFSERC-GVKLNGDR 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   ISA EQ     +P + P   ++  +K      ++          N +E
Sbjct: 124 LEKKQQQWQKIVISACEQSGRSHVPIVLPAILVDDFVKTPFDGLRLTLDPYARVPLNQIE 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             +    I    ++IGPEGG+   E E      F  P+ LGPRILR++TAA+ A+A +Q 
Sbjct: 184 GANLAQRI---QLMIGPEGGFTDIEVEHARHHHF-KPIRLGPRILRTETAAMTALAAIQY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 EFGD 243


>gi|110803459|ref|YP_699307.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium perfringens
           SM101]
 gi|110683960|gb|ABG87330.1| RNA methyltransferase, RsmE family [Clostridium perfringens SM101]
          Length = 250

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVLEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPEVLEPMDFKGVLEKIDELDLMVIPYENATGYGIRAMVNSIENKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIVTLGPRILRTETAGFTCISLIQYELGDL 246


>gi|326561136|gb|EGE11501.1| ribosomal RNA small subunit methyltransferase E [Moraxella
           catarrhalis 7169]
          Length = 247

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 119/246 (48%), Gaps = 30/246 (12%)

Query: 7   LKRLFVDFPLCIKTQGK--ASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
           + R FVD PL     G+  A  D   H+   VLR   GD   LF+G  GE+   ++++  
Sbjct: 1   MPRFFVDTPLTTNLIGQIIALPDHVTHHWCKVLRASVGDCAFLFDGMGGEYTVTLTHIHK 60

Query: 63  KSIRFKVEYQ---SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           KS   K++     +R+   ++ +  + S  + +R+DY IQK+ EMG+  I  + +   Q 
Sbjct: 61  KSASVKIDAYHPINRTPPFRASIGLVMS--RGDRMDYAIQKATEMGVHCIHLLTSDRCQ- 117

Query: 120 THYNMDR-------VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
            H   DR        ++  ++A EQC +  +P I  P     LL  W  NCQ        
Sbjct: 118 AHLKYDRDFKKIAHWQSVAVAACEQCGMNIVPNIIAP----ILLDEWVANCQDELKLVLA 173

Query: 173 GSEN--SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
            SEN  +  K+     +P N+++LIG EGG    E +      FV P  +G R+LR++TA
Sbjct: 174 LSENNPAFNKI-----LPKNISLLIGAEGGLSPREIDLAIHHGFV-PWRIGERVLRTETA 227

Query: 230 AVAAMA 235
            V A++
Sbjct: 228 PVVALS 233


>gi|169795277|ref|YP_001713070.1| hypothetical protein ABAYE1140 [Acinetobacter baumannii AYE]
 gi|184158858|ref|YP_001847197.1| hypothetical protein ACICU_02538 [Acinetobacter baumannii ACICU]
 gi|213158057|ref|YP_002320108.1| hypothetical protein AB57_2769 [Acinetobacter baumannii AB0057]
 gi|215482810|ref|YP_002325013.1| RNA methyltransferase family protein [Acinetobacter baumannii
           AB307-0294]
 gi|301346012|ref|ZP_07226753.1| ribosomal RNA small subunit methyltransferase E [Acinetobacter
           baumannii AB056]
 gi|301510423|ref|ZP_07235660.1| ribosomal RNA small subunit methyltransferase E [Acinetobacter
           baumannii AB058]
 gi|301595608|ref|ZP_07240616.1| ribosomal RNA small subunit methyltransferase E [Acinetobacter
           baumannii AB059]
 gi|332850384|ref|ZP_08432704.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6013150]
 gi|332871823|ref|ZP_08440246.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6013113]
 gi|169148204|emb|CAM86067.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|183210452|gb|ACC57850.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|213057217|gb|ACJ42119.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988086|gb|ACJ58385.1| RNA methyltransferase family protein [Acinetobacter baumannii
           AB307-0294]
 gi|332730655|gb|EGJ61966.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6013150]
 gi|332731152|gb|EGJ62452.1| RNA methyltransferase, RsmE family [Acinetobacter baumannii
           6013113]
          Length = 240

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 117/241 (48%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPVNRNAPFKALLGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC-QIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P  L   L + D    + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPIALHEWLNSSDLPVSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G RILR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRILRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|73542528|ref|YP_297048.1| hypothetical protein Reut_A2843 [Ralstonia eutropha JMP134]
 gi|72119941|gb|AAZ62204.1| Conserved hypothetical protein 46 [Ralstonia eutropha JMP134]
          Length = 249

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 16/223 (7%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF-KVEYQSRSQTKQS-DVQYIFSPIKT 91
            VLR+  GD I LF+G+ G   + +  +GK     +V  +  ++T+    V         
Sbjct: 31  QVLRLAPGDAITLFDGRGGSHAATLLDLGKRHALARVGERDNTETEPPFRVMLAQGLAGG 90

Query: 92  NRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQCDILTLPF 145
           +++D++I+K+VE+G+ AI+P      V+              +    +A EQC    LP 
Sbjct: 91  DKMDWLIEKAVELGVTAIQPLQAARSVVRLSGDRAQKRQAHWQALVEAACEQCGRNRLPA 150

Query: 146 IYPPTTLEFLLKNWDHNCQIVF---ADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           + P T L+  L+      +++    AD++  +  +  ++  +A    V +LIGPEGG   
Sbjct: 151 VAPVTNLDTWLRAAGEGNRLLVSPRADQSLPAYAAANRVSLLAG--GVTLLIGPEGGLAP 208

Query: 203 EEKET-LHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           EE++  LH+    T +SLGPRILR++TA +A +A + A+ G +
Sbjct: 209 EEEDAALHA--GFTAVSLGPRILRTETAGLACLATLNALLGGF 249


>gi|168215653|ref|ZP_02641278.1| RNA methyltransferase, RsmE family [Clostridium perfringens NCTC
           8239]
 gi|182382065|gb|EDT79544.1| RNA methyltransferase, RsmE family [Clostridium perfringens NCTC
           8239]
          Length = 250

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THVKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPQVLEPMDFKEVLEKIDELDLMVIPYENATGYGIRAMVNSIENKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIVTLGPRILRTETAGFTCISLIQYELGDL 246


>gi|218767503|ref|YP_002342015.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria meningitidis
           Z2491]
 gi|121051511|emb|CAM07805.1| hypothetical protein NMA0528 [Neisseria meningitidis Z2491]
 gi|319409765|emb|CBY90071.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
          Length = 241

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 117/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F T ++LG RILR++T A+AA+A +Q + GD+
Sbjct: 199 EQEEQQAFDAGFQT-VTLGKRILRTETVALAALAAMQTLWGDF 240


>gi|121596395|ref|YP_988291.1| 16S ribosomal RNA methyltransferase RsmE [Acidovorax sp. JS42]
 gi|120608475|gb|ABM44215.1| protein of unknown function DUF558 [Acidovorax sp. JS42]
          Length = 242

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 107/208 (51%), Gaps = 11/208 (5%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTN 92
            VLR++ GD + LFNG+ GEW + ++++G+S ++ +V   S  + + +   ++   +  N
Sbjct: 27  QVLRLQPGDAVTLFNGEGGEWSATVTHMGRSDVQVQVGSHSAVEREAARAVHLVVGMPAN 86

Query: 93  -RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
            R+D++++K+ E+G  +I+P+    +      +         +   ++A EQC    +P 
Sbjct: 87  ERMDWLVEKATELGAASIQPIAAARSVLKLSGERAAKRQQHWQAIAVAACEQCGRNRVPS 146

Query: 146 IYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK--LHAIAHIPNVAILIGPEGGYHSE 203
           ++ P +L   L+    +     A     S  S  +    A A    V +L GPEGG  ++
Sbjct: 147 VHAPLSLADWLRQPPADALAPDAARLLLSLRSGSRPLREAAAQGGAVWVLHGPEGGLTAQ 206

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAV 231
           E++   +  F  P SLG R+LR++TA+V
Sbjct: 207 EEDAALAQGF-APASLGARVLRAETASV 233


>gi|260549771|ref|ZP_05823988.1| RNA methyltransferase [Acinetobacter sp. RUH2624]
 gi|260407288|gb|EEX00764.1| RNA methyltransferase [Acinetobacter sp. RUH2624]
          Length = 240

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 117/240 (48%), Gaps = 16/240 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + I   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIESFNPANRNAPFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
            D+ +        I+A EQC +  +P +  P +    L  W  + ++  +      E   
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPIS----LNEWLSSSELPVSKFVLAPEK-- 174

Query: 179 EKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           E+   ++ I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A++++
Sbjct: 175 EQKDVLSGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSIL 233


>gi|309783107|ref|ZP_07677826.1| RNA methyltransferase, RsmE family [Ralstonia sp. 5_7_47FAA]
 gi|308918215|gb|EFP63893.1| RNA methyltransferase, RsmE family [Ralstonia sp. 5_7_47FAA]
          Length = 249

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 121/255 (47%), Gaps = 25/255 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + K  R
Sbjct: 3   LPRFFVDTPLAPNTTVTLPEAVTRHI-HVLRLAVGDDVCLFDGSGHEFRARLDAINK--R 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKT----NRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 + +    ++ +Y  +  +     +++D++I+K+VE+G+ A+ P+ T        
Sbjct: 60  DATASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVNAVAPLQTERAVVRLS 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +    +A EQC    +P + P +TL    + W    +   A     S  
Sbjct: 120 GERAAKRVQHWQALVQAACEQCGRARVPAVAPVSTL----REWLAAARSTDAPRVLLSPR 175

Query: 177 SLEKLHAIA-------HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
             + L   A           + +LIGPEGG   +E+    S  F+ PL+LG RILR+++A
Sbjct: 176 GTQSLTQWAVQSRTRIEGSGIVLLIGPEGGLSPDEEALAESAGFL-PLTLGRRILRTESA 234

Query: 230 AVAAMALVQAICGDW 244
           A+ A++ + A+ G++
Sbjct: 235 ALVAVSALHAVLGEF 249


>gi|298369579|ref|ZP_06980896.1| RNA methyltransferase, RsmE family [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282136|gb|EFI23624.1| RNA methyltransferase, RsmE family [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 241

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSDVQYIFSP 88
           HVLR+K  + I+LFNG    + +++  + K      I  + E  + S    + VQ + S 
Sbjct: 27  HVLRLKPDEEIVLFNGDGKAYPARLGVLEKRRATAEILREEEADNESPLNITLVQAVSS- 85

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
               R+D+ +QKSVE+G+G IRPV++         +     + R +   +SA EQ    T
Sbjct: 86  --GERMDFTLQKSVELGVGEIRPVLSERCVVRLDGERAAKRVARWQEIVVSACEQSGRNT 143

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI-LIGPEGGYH 201
           +P + P  + +  L+        +       S  + +KL+ I    +  I ++GPEGG+ 
Sbjct: 144 VPQVLPLVSYQEALRQMPSEKTKLLM-----SVRNAQKLNRITPSSDGLIFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             E++      F   ++LGPR+LR++TA++AA+A +Q + GD+
Sbjct: 199 ESEEQQAFGAGF-QAVTLGPRVLRTETASLAAIAAMQTLWGDF 240


>gi|262278363|ref|ZP_06056148.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258714|gb|EEY77447.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 240

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 116/240 (48%), Gaps = 16/240 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L +    + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGLTIQLTETVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIESFNPTNRSAPFKAVLGQVMSKGDRMDYAIQKATELGVSQIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
            D+ +        I+A EQC +  +P +  P +    L  W  + Q+  +      E   
Sbjct: 121 RDQKKLDHWQAIAIAACEQCGLNLVPEVLAPIS----LSEWLSSTQLPASKFVLAPEK-- 174

Query: 179 EKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A++++
Sbjct: 175 EQKDVLAGIQPELALLIGPEGGLSENEITQANQAGFMN-WCIGDRVLRTETAPVVALSIL 233


>gi|294634386|ref|ZP_06712923.1| 16S rRNA methyltransferase RsmE [Edwardsiella tarda ATCC 23685]
 gi|291092194|gb|EFE24755.1| 16S rRNA methyltransferase RsmE [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 119/248 (47%), Gaps = 20/248 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSI 65
           + R++   PL I  +   S D  +++  VLRM  G  + LF+G +  + ++I S   KS+
Sbjct: 3   IPRIYHPQPLSIPGEVNLSDDAANHVGRVLRMGPGHALQLFDGSNRVFDAEIVSADKKSV 62

Query: 66  RFK---VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           R +   V  ++R       +  + S  +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 63  RVRLTAVHEENRESPLHLHLGQVMS--RGEKMEFTIQKSIELGVNVITPLISERC-GVRL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           + +R+       +   I+A EQC   +L  I P  TLE      D   ++        S 
Sbjct: 120 DAERLAKKQQQWQKIAIAACEQCGRNSLALIRPAMTLEAWCAEPDDGLRLNLHPRASASI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L +      +  V +LIGPEGG  + E        F T + LGPR+LR++T A+ A+ 
Sbjct: 180 NTLPQ-----PLSRVRLLIGPEGGLSASEIAMTADYHF-TDILLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|240015737|ref|ZP_04722277.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae FA6140]
          Length = 241

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    N +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSENTRLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|193077877|gb|ABO12758.2| hypothetical protein A1S_2336 [Acinetobacter baumannii ATCC 17978]
          Length = 240

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 118/241 (48%), Gaps = 18/241 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L + +  + +   +H+   VLR +  +   LFNG+ GE+L+ ++ + K   
Sbjct: 1   MNRFFIETELTVGSTIQLTESVFHHWVRVLRAQLQEQATLFNGQGGEYLATLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
           F          + +  + +   +  K +R+DY IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  FVTIENFNPVNRNAPFKALLGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC-QIVFADETCGSENS 177
            D+ +        I+A EQC +  +P +  P +L   L + D    + V A E       
Sbjct: 121 RDQKKLDHWQAVAIAACEQCGLNLVPEVLAPISLHEWLNSSDLPVSKFVLAPEK------ 174

Query: 178 LEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            E+   +A I P +A+LIGPEGG    E    +   F+    +G R+LR++TA V A+++
Sbjct: 175 -EQKDVLAGIQPELALLIGPEGGLSDNEITQANQAGFMN-WCIGDRVLRTETAPVVALSI 232

Query: 237 V 237
           +
Sbjct: 233 L 233


>gi|319639002|ref|ZP_07993760.1| hypothetical protein HMPREF0604_01384 [Neisseria mucosa C102]
 gi|317399906|gb|EFV80569.1| hypothetical protein HMPREF0604_01384 [Neisseria mucosa C102]
          Length = 241

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 121/251 (48%), Gaps = 24/251 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG +G+    +  V +  R
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNG-NGKSYPALPEVLEKRR 58

Query: 67  FKVEYQSRSQTKQS---DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V       T      ++  + +     R+D+ +QKSVE+G+  IRPVI+         
Sbjct: 59  ASVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSG 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + R +   +SA EQ     +P + P TT    L+            ET     S
Sbjct: 119 ERAEKRVARWQEIVVSACEQSGRNIVPRVLPLTTYAQALRQ--------LPQETAKLLMS 170

Query: 178 LEKLHAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L +   ++ +      V  ++GPEGG+  +E++      F + ++LG R+LR++TA++AA
Sbjct: 171 LNRAQKLSDVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGFQS-VTLGKRVLRTETASLAA 229

Query: 234 MALVQAICGDW 244
           +A +Q + GD+
Sbjct: 230 IAAMQTLWGDF 240


>gi|87121181|ref|ZP_01077072.1| hypothetical protein MED121_11304 [Marinomonas sp. MED121]
 gi|86163673|gb|EAQ64947.1| hypothetical protein MED121_11304 [Marinomonas sp. MED121]
          Length = 244

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 123/248 (49%), Gaps = 19/248 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R++VD PL   +        + ++  VLR+K   +++LFNG+ G++ +K+  V K S 
Sbjct: 3   IPRIYVDLPLQESSVFDLPQASFQHVCKVLRLKNDYSLILFNGQGGQYQAKLINVEKRSA 62

Query: 66  RFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
           + +V  YQ+        V    +  +  R+DY IQK+VE G+  I+P+ +   +    N 
Sbjct: 63  QVEVLNYQALENESPIKVTLGQTLSRGERMDYAIQKAVEAGVHRIQPLFSERCE-VKLNT 121

Query: 125 DRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +R+       +   ISAAEQ     +P +  P      L +W  NC+ +   +     +S
Sbjct: 122 ERLDKKIQHWQQIAISAAEQSGRGHVPEVLSPIN----LLDWTSNCKDML--KITMHHHS 175

Query: 178 LEKLHAIAHIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            + +  ++   +  V++LIGPEGG    E E      F  P++LG R+LR++TA V  + 
Sbjct: 176 AKPISEMSEPEDKAVSVLIGPEGGLTESEVEASIQHGF-QPVALGSRVLRTETAPVVILT 234

Query: 236 LVQAICGD 243
            +  + GD
Sbjct: 235 CINLLWGD 242


>gi|304316647|ref|YP_003851792.1| hypothetical protein Tthe_1189 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778149|gb|ADL68708.1| protein of unknown function DUF558 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 240

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 120/232 (51%), Gaps = 16/232 (6%)

Query: 23  KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKV--EYQSRSQTKQS 80
           + +GD  H++  VLR K G  +++ NGK+   +S +     S+  K+  EY    ++  +
Sbjct: 12  RINGDDAHHIIDVLRFKIGTKLIISNGKNQYIVSILDIENSSVILKIIEEYNQVVESPIN 71

Query: 81  DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISA 134
              Y   P K++++D +IQK  E+G+  I PV T ++      +N +  ++R +  ++ A
Sbjct: 72  ITLYQGLP-KSDKMDLIIQKCTEIGIKKIVPVETEFSTIKIKEKNIYNKINRWKKISLEA 130

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHN--CQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           ++Q     +P +  P   +  L++ +    C I +  ET      + K +  A   N+ +
Sbjct: 131 SKQSGRSIVPDVLVPVGFKDALESLNEFDLCLIPYEKETNMRLKDVLKKNFNAK--NICV 188

Query: 193 LIGPEGGYHSEEKETLHSLPF-VTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            IGPEGG+   E E + ++ +   P++LGPRILR++TA +   +++    GD
Sbjct: 189 FIGPEGGFS--ENEIMAAIEYGAIPVTLGPRILRTETAGIVTSSIILYELGD 238


>gi|150390795|ref|YP_001320844.1| hypothetical protein Amet_3045 [Alkaliphilus metalliredigens QYMF]
 gi|149950657|gb|ABR49185.1| protein of unknown function DUF558 [Alkaliphilus metalliredigens
           QYMF]
          Length = 254

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 124/252 (49%), Gaps = 17/252 (6%)

Query: 7   LKRLFVDFPLCIKTQGKA---SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           + R FV  P  +  Q +     GD   ++  VLR+  GD + + +G+  E++ +I  + K
Sbjct: 1   MNRFFV-VPSQVNQQARTISIVGDDVKHIGKVLRLVVGDLVEVCDGQALEYIGRIDEISK 59

Query: 64  S-IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
             +   +E Q    T+      ++  I K  +++ +IQK+ EMG+  I PV+T  T    
Sbjct: 60  EQVTLSIEKQENIFTEPPIQVRLYQGIPKATKMELIIQKTTEMGISDIIPVMTDRTIVQF 119

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DET 171
              ++    ++R +     A++Q     +P I+ P T    L+  + N   V A   ++T
Sbjct: 120 NNEKDREKKVERWQKIADEASKQSKRGKIPRIHIPMTYTKALEACNENDLNVLAYEKEKT 179

Query: 172 CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            G +  +  L  I  + ++ I IGPEGG+  +E E   S   V  ++LGPRILR++TA  
Sbjct: 180 MGLKALIASLVEITEVKSIGIWIGPEGGFTGKEIEKALSHD-VRSITLGPRILRTETAGF 238

Query: 232 AAMALVQAICGD 243
           A ++++    GD
Sbjct: 239 AVLSMLMYELGD 250


>gi|238754605|ref|ZP_04615959.1| Ribosomal RNA small subunit methyltransferase E [Yersinia ruckeri
           ATCC 29473]
 gi|238707236|gb|EEP99599.1| Ribosomal RNA small subunit methyltransferase E [Yersinia ruckeri
           ATCC 29473]
          Length = 243

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 119/248 (47%), Gaps = 20/248 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   PL   T+   S D  +++  VLRM EG ++ LF+G +  + ++I +V K   
Sbjct: 3   IPRIYHPQPLSAHTELALSDDAANHVGRVLRMSEGHHLQLFDGSNQVFSAEIIHVDKKSV 62

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
                ++  + ++S +      +  +  ++++ IQKS+E+G+  I P+   +++     +
Sbjct: 63  HVHLGEAALEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVNVITPL---FSERCGVKL 119

Query: 125 DRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           D  R            I+A EQC   TLP I     LE      D + ++        S 
Sbjct: 120 DGERLAKKIQQWQKIAIAACEQCGRNTLPEIREAMQLEAWCAEQDDSLKLNLHPRASNSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  V +LIGPEGG  ++E E      F T + LGPR+LR++T A+ A+ 
Sbjct: 180 NTLP-----LPVNRVRLLIGPEGGLTADEIEMTSHHGF-TDILLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|257095553|ref|YP_003169194.1| 16S ribosomal RNA methyltransferase RsmE [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048077|gb|ACV37265.1| protein of unknown function DUF558 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 254

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 117/246 (47%), Gaps = 16/246 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R     PL +  Q         +   VLR++ GD + LF G  GE+ ++I+ + + +R  
Sbjct: 6   RFHCPVPLAVGAQVDLPEVVAQHAVKVLRLRRGDAVTLFTGAGGEYSARIAGI-ERLRVS 64

Query: 69  VEYQSRSQTKQSD---VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
           VE      T++     +  + +    +++D  +QK+VE+G+    PVI+R +      Q 
Sbjct: 65  VEILQWLPTERESPLSITLVQALQAGDKMDMTVQKAVELGVDRFVPVISRRSVVRLADQR 124

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLE-FLLKNWDHNC-QIVFADETCGSENS 177
                +  R    ++ EQC    LP +  P +LE +L++       +++ A     S   
Sbjct: 125 ALRRAEHWRGVVAASCEQCGRNRLPEVAIPESLEHWLMRPPPPGVLRLLLAPVASYSLAM 184

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L    A  HI    +L+G EGG   EE   L +L     + LGPRILR++TA +AA+A +
Sbjct: 185 LSGPSADGHI---ELLVGAEGGLAPEEVR-LAALAGFLSVRLGPRILRTETAGLAALAAI 240

Query: 238 QAICGD 243
           Q + GD
Sbjct: 241 QFLWGD 246


>gi|261379381|ref|ZP_05983954.1| 16S rRNA methyltransferase RsmE [Neisseria subflava NJ9703]
 gi|284797829|gb|EFC53176.1| 16S rRNA methyltransferase RsmE [Neisseria subflava NJ9703]
          Length = 241

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 121/251 (48%), Gaps = 24/251 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG +G+    +  V +  R
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNG-NGKAYPALPEVLEKRR 58

Query: 67  FKVEYQSRSQTKQS---DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             V       T      ++  + +     R+D+ +QKSVE+G+  IRPVI+         
Sbjct: 59  ASVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSG 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + R +   +SA EQ     +P + P TT    L+            ET     S
Sbjct: 119 ERAEKRVARWQEIVVSACEQSGRNIVPKVLPLTTYAQALQQ--------LPQETTKLLMS 170

Query: 178 LEKLHAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L +   ++ +      V  ++GPEGG+  +E++      F + ++LG R+LR++TA++AA
Sbjct: 171 LNRAQKLSDVQPQSGKVVFMVGPEGGWTEKEEQQAFDAGFQS-VTLGKRVLRTETASLAA 229

Query: 234 MALVQAICGDW 244
           +A +Q + GD+
Sbjct: 230 IAAMQTLWGDF 240


>gi|332531193|ref|ZP_08407106.1| 16S ribosomal RNA methyltransferase RsmE [Hylemonella gracilis ATCC
           19624]
 gi|332039300|gb|EGI75713.1| 16S ribosomal RNA methyltransferase RsmE [Hylemonella gracilis ATCC
           19624]
          Length = 248

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 111/233 (47%), Gaps = 50/233 (21%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQS-DVQYIFSPIKT 91
            VLR++ GD + LFNG+ GEW + +  +G+ S+  +V++    + +   DV         
Sbjct: 31  QVLRLQPGDTLTLFNGRSGEWTATVLRMGRASVTVRVDHHHAVEREAPLDVHLAVGMPAN 90

Query: 92  NRLDYMIQKSVEMGMGAIRPVITRYT-----------QNTHYNMDRVRTYTISAAEQCDI 140
            R+D++++K+VE+G+ +I+P+ T  +           +  H+         I+A EQC  
Sbjct: 91  ERMDWLVEKAVELGVASIQPLQTERSVLRLSGERALKKQLHWQ-----GIAIAACEQCGR 145

Query: 141 LTLPFIY------------PPTTLEFLLKNWDHNC----QIVFADETCGSENSLEKLHAI 184
             LP ++            PP      + + D +C    Q++ +  + GS          
Sbjct: 146 NRLPPVHAVRPLQDVAAWSPPEVQRRFVLSLDDDCVPISQVLASRGSTGS---------- 195

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
                V +L GPEGG    E++   +  F  P+SLG R LR++TA +AA+A++
Sbjct: 196 -----VLLLSGPEGGLSPTEEQAARAAGF-QPVSLGQRTLRAETAPLAALAVL 242


>gi|160873963|ref|YP_001553279.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS195]
 gi|160859485|gb|ABX48019.1| protein of unknown function DUF558 [Shewanella baltica OS195]
 gi|315266197|gb|ADT93050.1| protein of unknown function DUF558 [Shewanella baltica OS678]
          Length = 243

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 111/244 (45%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK     
Sbjct: 5   RIYQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKKHVTV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                 + + +S +      +  + +R+++ IQKSVE+G+  I P+ +        N +R
Sbjct: 65  KLLSCEANSSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRC-GVKLNGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   ISA EQ     +P + P   L           ++          N L+
Sbjct: 124 LEKKIQQWQKIVISACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LAHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|217969920|ref|YP_002355154.1| 16S ribosomal RNA methyltransferase RsmE [Thauera sp. MZ1T]
 gi|217507247|gb|ACK54258.1| protein of unknown function DUF558 [Thauera sp. MZ1T]
          Length = 246

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 116/227 (51%), Gaps = 17/227 (7%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF--S 87
           H+   VLR+++G+ ++LF+G  GE  ++++  GK++ F    ++R+  ++S ++ +   +
Sbjct: 25  HHALRVLRLRDGEAVVLFDGSGGEVDARLAVRGKAV-FARLGEARAVERESPLRIVLVQA 83

Query: 88  PIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDIL 141
               +++D+++QK+VE+G+ AI+PV    +      +     +   +   I+A EQC   
Sbjct: 84  LASGDKMDWVVQKAVELGVHAIQPVQAERSVLRLAAERADKRVAHWQQVAIAACEQCGRN 143

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP----NVAILIGPE 197
            +P I P   L   L         V A     +    +     A  P     V +L+GPE
Sbjct: 144 RVPEIRPLQPLAHWLGAHRAAPGYVLAPGYVLAPGGAK---GFADEPEPKDEVHLLVGPE 200

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GG+ SE +           + LGPR+LR++TA +AA+A +QA  GD+
Sbjct: 201 GGW-SEGEMAAFDAAGCRRVRLGPRVLRTETAGLAAVAALQARWGDY 246


>gi|255318401|ref|ZP_05359634.1| RNA methyltransferase [Acinetobacter radioresistens SK82]
 gi|262378631|ref|ZP_06071788.1| RNA methyltransferase [Acinetobacter radioresistens SH164]
 gi|255304393|gb|EET83577.1| RNA methyltransferase [Acinetobacter radioresistens SK82]
 gi|262299916|gb|EEY87828.1| RNA methyltransferase [Acinetobacter radioresistens SH164]
          Length = 239

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 115/239 (48%), Gaps = 15/239 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L + T  + +   +H+   VLR + GD+  LFNG+ GE+ + ++ + K   
Sbjct: 1   MPRFYIEADLTVGTTVELTETVFHHWVKVLRAQIGDSATLFNGRGGEFEANLTEISKKTA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTHYN 123
                 S    +      +   +  K +R+DY+IQK+ E+G+  I+ + + R      Y+
Sbjct: 61  SVAIRSSNPADRTPPFTTVLGQVMSKGDRMDYVIQKATELGVTTIQLLTSERCEMRLKYD 120

Query: 124 MDRVR-----TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
            D+ +        I+A EQC +  +P I PP  L   L+      ++V A      +N L
Sbjct: 121 RDQKKLDHWQAVVIAACEQCGMNRIPEILPPVPLTDWLQQNLPATRLVLAPNK-RQQNVL 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
                     ++A+LIGPEGG    E +  +   F     +G RILR++TA V A++++
Sbjct: 180 TDAQT-----DLALLIGPEGGLSEAEIDMANHAGFKN-WCIGERILRTETAPVVALSIL 232


>gi|297539576|ref|YP_003675345.1| hypothetical protein M301_2406 [Methylotenera sp. 301]
 gi|297258923|gb|ADI30768.1| protein of unknown function DUF558 [Methylotenera sp. 301]
          Length = 244

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 114/245 (46%), Gaps = 14/245 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R F    L I    K S +   +    LR+  GD I LFNG   ++  ++  V KS +  
Sbjct: 5   RFFSTEDLVIGATVKLSENAATHATRALRLNAGDLIHLFNGDGFDYACELIVVKKSEVIA 64

Query: 68  KVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
           K+   Q+R      ++  +      +R+DY IQK+VE+G+  I+P+ T  +      +  
Sbjct: 65  KINASQARDTESPLNITLLQGISSGDRMDYSIQKAVELGVKQIQPIATERSVVKLSAERA 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              ++  +   ISA EQC   T+P +  P TL     NW  +     A     +    ++
Sbjct: 125 EKRLEHWQNIVISACEQCGRATIPQVLAPKTL----ANWLSSNSASSATRILLNPIGAKR 180

Query: 181 LHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           L  +      + +LIG EGG    E     S  F + + LGPRILR++TA   A+A +Q+
Sbjct: 181 LAELDKPSGEIQLLIGAEGGLSQAEINLALSQDFQSVI-LGPRILRTETAGPTAIATLQS 239

Query: 240 ICGDW 244
           + GD+
Sbjct: 240 LWGDF 244


>gi|88859066|ref|ZP_01133707.1| putative RNA methyltransferase with a deep trefoil knot
           [Pseudoalteromonas tunicata D2]
 gi|88819292|gb|EAR29106.1| putative RNA methyltransferase with a deep trefoil knot
           [Pseudoalteromonas tunicata D2]
          Length = 243

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 116/233 (49%), Gaps = 30/233 (12%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           D   ++  VLRM  GD + LFNG+ G++L++++ V K     V  Q  S  ++ DV+   
Sbjct: 23  DAAGHIGRVLRMSIGDKVCLFNGQGGQFLAELTEVSKK---GVNVQIES-FEEHDVE--- 75

Query: 87  SPIKT---------NRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTY 130
           SP+K          +++D+ IQKSVE+G+  I P+ T        + DR+       +  
Sbjct: 76  SPLKIHLGQGISRGDKMDFTIQKSVELGVTEITPLFTERC-GVKLSGDRLEKKHQQWQKI 134

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
            I+AAEQ     +  I+PP  LE  L       ++        +E+S++ +        +
Sbjct: 135 AIAAAEQSGRNFVTVIHPPIKLEQWLSQQSDELKLTLHPR---AEHSIKTITKPTE--GL 189

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             ++GPEGG+   E     +  F+  + LGPRILR++TAA+  ++ +Q   GD
Sbjct: 190 RFIVGPEGGFTDAEMLMTKNSGFID-IRLGPRILRTETAALTVLSALQLEFGD 241


>gi|241664175|ref|YP_002982535.1| hypothetical protein Rpic12D_2592 [Ralstonia pickettii 12D]
 gi|240866202|gb|ACS63863.1| protein of unknown function DUF558 [Ralstonia pickettii 12D]
          Length = 249

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 121/255 (47%), Gaps = 25/255 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + K  R
Sbjct: 3   LPRFFVDTPLAPNTTVTLPEAVTRHI-HVLRLAVGDDVCLFDGSGHEFRARLDAINK--R 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKT----NRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 + +    ++ +Y  +  +     +++D++I+K+VE+G+ A+ P+ T        
Sbjct: 60  DATASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVHAVTPLQTERAVVRLS 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +    +A EQC    +P + P +TL    + W    +   A     S  
Sbjct: 120 GERAAKRVQHWQALVQAACEQCGRARVPAVAPVSTL----REWLAAARSTDAPRVLLSPR 175

Query: 177 SLEKLHAIA-------HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
             + L   A           + +LIGPEGG   +E+    S  F+ PL+LG RILR+++A
Sbjct: 176 GTQSLTQWAVQSRTRIEGSGIVLLIGPEGGLSPDEEALAESAGFL-PLTLGRRILRTESA 234

Query: 230 AVAAMALVQAICGDW 244
           A+ A++ + A+ G++
Sbjct: 235 ALVAVSALHAVLGEF 249


>gi|110798700|ref|YP_696706.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium perfringens
           ATCC 13124]
 gi|110673347|gb|ABG82334.1| RNA methyltransferase, RsmE family [Clostridium perfringens ATCC
           13124]
          Length = 250

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 12/235 (5%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQ 76
           T    +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   SI+   +    ++
Sbjct: 14  THATITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEVSIKILEKLDVNNE 73

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTI 132
           +  +   +   P K  ++D ++QK VE+G+  I P IT       +     +DR+    +
Sbjct: 74  SNLNITLFQGMP-KAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGEFKKLDRLNKIAL 132

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHAIAHIPN 189
            A +Q     +P +  P   + +L+  D    +V   E     G    +  +     I N
Sbjct: 133 EACKQSKRTVIPQVLEPMDFKEVLEKIDQLDLMVIPYENATGYGIRAMVNSIEDKDSIKN 192

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I++GPEGG+   E E L        ++LGPRILR++TA    ++L+Q   GD 
Sbjct: 193 VGIMVGPEGGFEESEIEALKE-KGAHIVTLGPRILRTETAGFTCISLIQYELGDL 246


>gi|152981289|ref|YP_001352520.1| 16S ribosomal RNA methyltransferase RsmE [Janthinobacterium sp.
           Marseille]
 gi|151281366|gb|ABR89776.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 241

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 126/247 (51%), Gaps = 17/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +   PL I           H++  V+R+  GD+I LFNG+ GE+ + I+ + K  R
Sbjct: 1   MPRFYCPQPLAIGAVITLPDHVAHHI-QVVRLGSGDHITLFNGEGGEYTATITTIEKK-R 58

Query: 67  FKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYT 117
              E   +  R       V    +  + +++D++I+K+VE+G+ AI+P      V+    
Sbjct: 59  VTAEIKLFTPREVELPYAVTVAQALPEASKMDWIIEKAVELGVHAIQPLASQRCVVRLSA 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     M   +   ++A+EQ     L  +  P      ++  D + +I+ +     +E S
Sbjct: 119 ERAAKKMQHWQGVIVAASEQSGRNRLAALAEPVDFNQWVQQKDLHKRILLSPR---AEQS 175

Query: 178 LEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           L    A  H P +VA++IGPEGG+ ++++E L        LS+GPR+LR++TA ++A+A 
Sbjct: 176 LSDW-ARHHPPQSVALMIGPEGGF-TDKEEDLALAQGALMLSMGPRVLRTETAGLSALAA 233

Query: 237 VQAICGD 243
           + A+ G+
Sbjct: 234 LNAVWGE 240


>gi|332799054|ref|YP_004460553.1| Ribosomal RNA small subunit methyltransferase E [Tepidanaerobacter
           sp. Re1]
 gi|332696789|gb|AEE91246.1| Ribosomal RNA small subunit methyltransferase E [Tepidanaerobacter
           sp. Re1]
          Length = 252

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 121/249 (48%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLS---KISYVGK 63
           + R FV   L I  Q   SG+  H++  VLR + GD I + +G + E +     I   G 
Sbjct: 1   MSRFFVFQDLNINDQITISGEDAHHIIRVLRYQTGDVIHISDGANTESIGVILDIDTQGP 60

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           S++ K+  +++ ++    +       K  + D+++QK+ E+G+    P+IT+ T      
Sbjct: 61  SVKLKIIEKNKVESISPYITLFQGLPKGEKFDWILQKNTEIGVSEFIPIITQRTVVNISP 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHN--CQIVFADETCGS- 174
               +  +R       AA+QC  + +P I    + +  L+       C I + +E   S 
Sbjct: 121 SKLGHRKNRWGKIVKEAAKQCMRMDIPKIGDVLSFDLALQEIKKYSLCIIPWENEKEISI 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            + ++ ++    I  +A+ IG EGG+  +E E   +   V P+SLGPRILR++TA + A 
Sbjct: 181 RHIIKDMNENKSISKIAVFIGSEGGFSKDEVEKAKAAGAV-PVSLGPRILRTETAGIVAC 239

Query: 235 ALVQAICGD 243
           +++    GD
Sbjct: 240 SVLMYEIGD 248


>gi|322417811|ref|YP_004197034.1| hypothetical protein GM18_0269 [Geobacter sp. M18]
 gi|320124198|gb|ADW11758.1| protein of unknown function DUF558 [Geobacter sp. M18]
          Length = 246

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 114/231 (49%), Gaps = 17/231 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQ 83
           +G+ Y ++A VLR+K+G  + L +         I  VG K++  ++   S    ++  +Q
Sbjct: 19  TGELYRHMARVLRLKQGAEVELIDADGRRHAGVIEEVGAKALTVRITVSSAPPREEPGLQ 78

Query: 84  ---YIFSPIKTNRLDYMIQKSVEMGMG------AIRPVITRYTQNTHYNMDRVRTYTISA 134
              Y   P K  +LD ++QK  E+G+       A R V+    + T     R       A
Sbjct: 79  VTLYQGLP-KGEKLDLILQKCTELGVAEVVTFDAARSVVKLRGEKTASKQARYEKIVQEA 137

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF--ADETCGSENSLEKLHAIAHIPNVAI 192
           A Q    T P +    TL+ +LK+  H  +++    +E     + L K  A     +VA+
Sbjct: 138 ARQSGRCTPPRVAIGGTLKEVLKDAGHTVKLLLWEGEEKTTLRDCLGKYEAP---ESVAV 194

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           ++GPEGG  +EE E   +  F TP++LG RILR++TA +A ++++Q   GD
Sbjct: 195 VVGPEGGLSAEEVEQALACGF-TPVTLGKRILRTETAGLAMISILQFHWGD 244


>gi|117617899|ref|YP_857627.1| hypothetical protein AHA_3127 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559306|gb|ABK36254.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 243

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 113/238 (47%), Gaps = 36/238 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQ 83
           S D  +++  VLRM+ G  + LFNG   ++ + I+ VG KS+   ++        + D  
Sbjct: 21  SEDGANHIGRVLRMQPGQQLELFNGDGNQYPATIANVGKKSVEVTID--------RCDTH 72

Query: 84  YIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV------- 127
            + SP+         + +++D+ IQKSVE+G+  I P+ +          DR+       
Sbjct: 73  SVESPLAIHLGQVISRGDKMDFTIQKSVELGVTCITPLFSERC-GVKLPADRLEKKREQW 131

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   ISA EQC   T+P +  P  L+  L    +  ++        S N+L        I
Sbjct: 132 QKVVISACEQCGRNTVPEVRMPMELDAWLAEETNELKLNLHPRAPYSINTLP-------I 184

Query: 188 P--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           P   V +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 185 PEHGVRLLIGPEGGLSSDEIARTVQEDFKEML-LGPRVLRTETAALTAITALQCRFGD 241


>gi|222053521|ref|YP_002535883.1| protein of unknown function DUF558 [Geobacter sp. FRC-32]
 gi|221562810|gb|ACM18782.1| protein of unknown function DUF558 [Geobacter sp. FRC-32]
          Length = 246

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 126/247 (51%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           ++R  VD       +   +G  Y ++A VLR+K+G  ++L +G+ GE+   I  +   S+
Sbjct: 1   MRRFIVDKRDIDDAEAVITGYLYRHMAKVLRLKQGTAVMLTDGEGGEYEGVIESIDSTSL 60

Query: 66  RFKVEYQSRSQTKQSDVQY-IFSPI-KTNRLDYMIQKSVEMGMGAIRPV-----ITRYT- 117
           R +V  +          Q  I+  + K ++L+Y++QK  E+G   I P      I R + 
Sbjct: 61  RVRVVRRETLMVDDGGPQITIYQGLPKGDKLEYILQKCTELGAAGIVPFAASRSIARISP 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           Q +   +DR +     AA Q    T+P +     L  +L+   H+ +++  +E     N 
Sbjct: 121 QRSAGRVDRWQKIAAEAARQSRRATVPRVSLADDLSQVLQLAQHSVKLLLWEEE--KANL 178

Query: 178 L-EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           L E L  ++   ++ +LIGPEGG+  EE     S  F+ P+S+G RI+R++TA++  +++
Sbjct: 179 LRETLSGLSAPNDIGVLIGPEGGFSPEEAAAASSAGFI-PISMGRRIVRTETASLIILSI 237

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 238 LQYHWGD 244


>gi|268593084|ref|ZP_06127305.1| 16S rRNA methyltransferase RsmE [Providencia rettgeri DSM 1131]
 gi|291311353|gb|EFE51806.1| 16S rRNA methyltransferase RsmE [Providencia rettgeri DSM 1131]
          Length = 243

 Score = 88.2 bits (217), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 115/246 (46%), Gaps = 14/246 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++I+   K  
Sbjct: 2   RIPRIYHPEPLQINTTISLGDDAANHVGRVLRMTAGQKLELFDGSNQTFSAEITEATKKN 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            F     S+   ++S +      +  +  ++++ IQKSVE+G+  I P+++         
Sbjct: 62  VFVHIENSQIDDRESPLDLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLDG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + + +   I+A EQC    +P I P  TLE      D   ++        S N+
Sbjct: 122 ERLEKKLLQWQKIAIAACEQCGRNRIPEIRPVQTLEAWCTENDGAFKVNLHPRATESINT 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L        +  V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  +
Sbjct: 182 LP-----TELKKVRLLIGPEGGLSADEIAMTANYQF-TDILLGPRVLRTETTALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRLGD 241


>gi|94311915|ref|YP_585125.1| 16S ribosomal RNA methyltransferase RsmE [Cupriavidus metallidurans
           CH34]
 gi|93355767|gb|ABF09856.1| conserved hypothetical protein DUF558 [Cupriavidus metallidurans
           CH34]
          Length = 247

 Score = 88.2 bits (217), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SI 65
           R FVD  L   T  +   D       VLR+  GD I LFNG+ G   + ++ +GK   S 
Sbjct: 4   RFFVDAALAADTVLELP-DAVVRHVQVLRLAPGDAITLFNGQGGSHPATLTEIGKRHASA 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYTQN 119
                  S ++T  + V         +++D++I+K+VE+G+ AI+P      V+    + 
Sbjct: 63  TLGTHDASEAETPFA-VTLAQGLAGGDKMDWLIEKAVELGVSAIQPLQAARSVVRLSGER 121

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC-QIVFADETCGSENSL 178
                   +    +A EQC    LP + P   LE  L +      ++  +     S   L
Sbjct: 122 ATKRQAHWQALIEAACEQCGRNRLPALAPVANLESWLTSVPATAARLALSPRASASLPEL 181

Query: 179 EKLHAIA-HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            +    A     V +LIGPEGG   EE++      F+  +SLGPRILR++TA +  +A +
Sbjct: 182 AQAEREAWRAGGVTLLIGPEGGLSPEEEDRARRAGFIG-VSLGPRILRTETAGLTCLATL 240

Query: 238 QAICGDW 244
            AI G +
Sbjct: 241 NAILGGF 247


>gi|46914675|emb|CAG21452.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 225

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 117/241 (48%), Gaps = 42/241 (17%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  V+RM+ G  +LLF+G D E+ + IS   K    +V+ Q R++        
Sbjct: 3   SDDAANHVGRVMRMQVGQEVLLFDGSDAEFPAVISTASKK-NVEVDIQCRNENS------ 55

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------R 128
           I SP+         +  ++++ IQKSVE+G+  I P+I+        N +R        +
Sbjct: 56  IESPLNIHLGQVISRGEKMEFTIQKSVELGVMTITPLISERC-GVKLNAERFEKKLSQWQ 114

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKLHAIAH 186
              ++A EQC    +P I P   LE    +W   C    A+E  G + +L     ++I  
Sbjct: 115 KIVVAACEQCGRNVIPEIRPVMKLE----DW---C----AEEYDGLKLNLHPRANYSINT 163

Query: 187 IP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           +P     V +LIGPEGG  +EE        F   L LGPR+LR++T A+ A+  +Q   G
Sbjct: 164 LPEPVTKVRLLIGPEGGLSAEEISMTEQYKFDEIL-LGPRVLRTETTAMTAITALQVRFG 222

Query: 243 D 243
           D
Sbjct: 223 D 223


>gi|319427610|gb|ADV55684.1| rRNA base methyltransferase, RsmE [Shewanella putrefaciens 200]
          Length = 243

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 109/244 (44%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++   PL I        D   ++  VLRM  G+NI LFNG   ++L++I   GK     
Sbjct: 5   RIYQPQPLAINQLLNLDEDGAAHIGKVLRMGNGENISLFNGDGNDYLAEIVDAGKKHVTV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                 +   +S +      +  + +R+++ IQKSVE+G+  I P+ +        N +R
Sbjct: 65  KLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRC-GVKLNGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   +SA EQ     +P I P   L           ++          N L+
Sbjct: 124 LEKKIQQWQKIVVSACEQSGRSQVPLIRPAMDLHDWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LAHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|255020274|ref|ZP_05292342.1| Ribosomal RNA small subunit methyltransferase E [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970194|gb|EET27688.1| Ribosomal RNA small subunit methyltransferase E [Acidithiobacillus
           caldus ATCC 51756]
          Length = 246

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 111/224 (49%), Gaps = 16/224 (7%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKVEYQSRSQTKQSDVQY-IFS 87
           H+L  VLR + G  + LF G   ++ +++    GK     V  ++R +   S +Q  ++ 
Sbjct: 26  HHLLRVLRGRPGQELTLFTGDGRDYPAELLGARGKQALLAVG-RARWRDTGSPLQCCLWL 84

Query: 88  P-IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDI 140
           P I+  R D+ +QK+ E+G  A++PV+ R++              R R   I+A EQ   
Sbjct: 85  PVIRAERWDWALQKATELGAWALQPVVCRHSLVPLAEARAPKRQQRWRDIVIAACEQSSA 144

Query: 141 LTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK-LHAIAHIPNVAILIGPEGG 199
             +P + P   L  L    + +  +V  D + G+  SL K L        +A+L GPEGG
Sbjct: 145 TRIPELRPAMALSELGPP-EVDLAVV-CDPSYGT--SLGKVLGTRRSARRIALLCGPEGG 200

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            H EE     SL F+    LGPRILR++TA++ A+ L Q   GD
Sbjct: 201 LHPEELAWAESLGFLG-AHLGPRILRAETASITALTLAQGFLGD 243


>gi|229525160|ref|ZP_04414565.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           bv. albensis VL426]
 gi|229338741|gb|EEO03758.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           bv. albensis VL426]
          Length = 243

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQ 79
           S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK     +I  +VE    S    
Sbjct: 21  SEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKKQVLVNITERVENSIESPLDL 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTIS 133
              Q I    + +++++ IQKSVE+G+  I P+++         +     + + +   IS
Sbjct: 81  HLGQVIS---RGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAIS 137

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A EQC   T+P I P   LE          ++        S ++L        +  V +L
Sbjct: 138 ACEQCGRNTVPEIRPIMDLEAWCAEPTEAMKLNLHPRAKYSIHTLP-----TPVSKVRLL 192

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  +Q   GD
Sbjct: 193 IGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITALQVRFGD 241


>gi|160915014|ref|ZP_02077227.1| hypothetical protein EUBDOL_01021 [Eubacterium dolichum DSM 3991]
 gi|158432813|gb|EDP11102.1| hypothetical protein EUBDOL_01021 [Eubacterium dolichum DSM 3991]
          Length = 266

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 107/217 (49%), Gaps = 8/217 (3%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS-DVQ 83
           + +Q H+++HVLRM+E D + + + ++  + + + + GK +   ++ +    T+ +  + 
Sbjct: 37  NDEQAHHVSHVLRMRENDVVRIVDKENTMFFAHLLFEGKKVIAHLDQKIEDHTRNAVRIT 96

Query: 84  YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMD----RVRTYTISAAEQ 137
            +   IK  + DY++QKS E+G+  I P  +  T  +     MD    R     + A EQ
Sbjct: 97  LLQGMIKKEKWDYVLQKSAELGVDCIVPFTSSRTVVKAKEERMDKKLLRWNKILLEACEQ 156

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPE 197
           C   TL  +  P  L+   +       I + D    SE     L     I +V I IG E
Sbjct: 157 CKRSTLVDLKEPCLLKDAARYKSELNIIAYEDADATSEKLHRLLAKYPKISSVTIAIGSE 216

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           GG+  EE   L  + +   +SLG RILR++TAA+AA+
Sbjct: 217 GGFSKEEVSMLMEMGY-HRVSLGARILRAETAALAAI 252


>gi|187930070|ref|YP_001900557.1| hypothetical protein Rpic_3002 [Ralstonia pickettii 12J]
 gi|187726960|gb|ACD28125.1| protein of unknown function DUF558 [Ralstonia pickettii 12J]
          Length = 249

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 122/255 (47%), Gaps = 25/255 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD+I LF+G   E+ +++  + K  R
Sbjct: 3   LPRFFVDTPLAPNTTVTLDESVTRHI-HVLRLAAGDDICLFDGSGYEFRARLDAINK--R 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKT----NRLDYMIQKSVEMGMGAIRPVITR---YTQN 119
                   +    ++ +Y  +  +     +++D++I+K+VE+G+ A+ P+ T       +
Sbjct: 60  DATASLVDATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVNAVAPLQTERGVVRLS 119

Query: 120 THYNMDRVRTYTI---SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
               + RV+ +     +A EQC    +P + P  TL    + W    +   A     S  
Sbjct: 120 GERAVKRVQHWQALVQAACEQCGRARVPVVAPVATL----REWLATAKSTDAPRVLLSPR 175

Query: 177 SLEKLHAIAHIP-------NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
             + L   A           + +LIGPEGG   +E+    +  F+ PL+LG RILR+++A
Sbjct: 176 GAQSLTQWAVQSRTRIVGSGIVLLIGPEGGLSPDEEALAEAAGFL-PLTLGRRILRTESA 234

Query: 230 AVAAMALVQAICGDW 244
           A+ A++ + A+ G++
Sbjct: 235 ALVAVSALHAVLGEF 249


>gi|146296762|ref|YP_001180533.1| hypothetical protein Csac_1755 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410338|gb|ABP67342.1| protein of unknown function DUF558 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 242

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 114/227 (50%), Gaps = 15/227 (6%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDG--EWLSKISYVGKS-IRFKVEYQSRSQTK-QSDV 82
           D  +++  VLR +EG+   + N  DG  ++ +KI  + K  I+  +E +  +Q + Q DV
Sbjct: 22  DDLNHVVKVLRKREGE---VLNLCDGIYDYKAKILEISKDKIKVAIEEKVLNQREPQKDV 78

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITR-----YTQNTHYNMDRVRTYTISAAEQ 137
                 IK  ++D +IQK+ E+G+  + PVI++      ++     + R +     A +Q
Sbjct: 79  FLFQCIIKNQKMDIIIQKATELGVKVLIPVISKRVVIDISEKEEKKIQRWQRIAKEAQKQ 138

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPE 197
           C     P I  P  +  +    D    ++   E    EN    L   ++I  V ILIGPE
Sbjct: 139 CLRPYSPQIQRPIEIGRVKDFLDELDLLIIPYE---KENKKTYLDINSNINRVGILIGPE 195

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GG+  +E E    L  V  +SLG RILRS+TAA++ +++V  + G+ 
Sbjct: 196 GGFEEDEIEIFKDLQKVRIVSLGKRILRSETAAISVISIVMHLLGEM 242


>gi|193211908|ref|YP_001997861.1| 16S ribosomal RNA methyltransferase RsmE [Chlorobaculum parvum NCIB
           8327]
 gi|193085385|gb|ACF10661.1| protein of unknown function DUF558 [Chlorobaculum parvum NCIB 8327]
          Length = 247

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 115/229 (50%), Gaps = 17/229 (7%)

Query: 21  QGKAS--GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQT 77
           +G+AS  G+++H+LA VLR +EGD + + +G        +  +GKS ++  +    R   
Sbjct: 15  RGRASIGGEEFHHLARVLRCREGDTVPVTDGAGLSAELVVESIGKSELQGSIRNPRRVPP 74

Query: 78  KQSDVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYTQNT------HYNMDRVRTY 130
            ++ V    S +K   R D+ ++K+ E+G+  I P+IT+ T +T          +R R  
Sbjct: 75  PETRVSVAMSLLKAPQRFDFFLEKATELGIDRIIPIITQRTVSTPDLKKIDRKAERWRNI 134

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
             SAA Q     LP +  P + +  L+   ++ +++  +    SE +            V
Sbjct: 135 VHSAARQSRRYYLPELSTPCSFQEALQLEGYDLRLIAHE----SEEAFGPFEPAGQC--V 188

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
              IGPEGG+ SE +    +   V P+S G  +LR++TA V A+ALV+A
Sbjct: 189 LFFIGPEGGF-SEAEIAAAAQSGVRPVSFGASVLRAETAGVFAVALVRA 236


>gi|188585812|ref|YP_001917357.1| protein of unknown function DUF558 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350499|gb|ACB84769.1| protein of unknown function DUF558 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 240

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 118/228 (51%), Gaps = 28/228 (12%)

Query: 32  LAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIF--SP 88
           +  VLR+K GD ++L +GK G   S I+ +G+  I F++E +     K++ ++     S 
Sbjct: 1   MTRVLRLKIGDRVILLDGKGGACFSFINRLGEGQIEFELE-EPLIDNKEAPIRITLAQSL 59

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN---------MDRVRTYTISAAEQCD 139
           IK +  ++++QK  E+G     P+I++ T+    N         + R R    +AAEQC 
Sbjct: 60  IKKDNFEFVLQKGTELGATEFYPLISQRTEVNLLNKSDKKVSKKLTRWREIVKNAAEQCQ 119

Query: 140 ILTLPFIYPPTTLEFLLKNW-------DHNCQIVFADETCGSENS-LEK-LHAIAHIPNV 190
              LP I+ P   E  LKN            +I+  ++    EN+ L+K L  I   P+ 
Sbjct: 120 RQVLPLIHYPVNFEKYLKNNNENSNNNGSRLKIMCHEQ----ENTPLKKVLKTIETPPSS 175

Query: 191 AI-LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           AI LIGPEGG+   E +      F + +S+GPRILR++TA + A++ +
Sbjct: 176 AIILIGPEGGFSHNEVDLAREQGF-SSVSMGPRILRAETAGIVAVSAI 222


>gi|308188039|ref|YP_003932170.1| UPF0088 protein yggJ [Pantoea vagans C9-1]
 gi|308058549|gb|ADO10721.1| UPF0088 protein yggJ [Pantoea vagans C9-1]
          Length = 243

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 120/249 (48%), Gaps = 22/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   PL I ++     D  +++  VLRM  G  + LF+G +  + ++I++V K  R
Sbjct: 3   IPRIYHAGPLEIGSEITLDEDASNHVGRVLRMTAGQRLELFDGTNLTFAAEITHVDKK-R 61

Query: 67  FKVEY-QSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            KV   +S+   ++S +      +  +  ++++ IQKS+E+G+  I P+   +++     
Sbjct: 62  VKVSVTESQPDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I    TLE      D   ++        S
Sbjct: 119 LDAERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEADSGLKLNLHPRASHS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLPQ-----PVERVRLLIGPEGGLSADEIAMTAQHDF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|134094087|ref|YP_001099162.1| 16S ribosomal RNA methyltransferase RsmE [Herminiimonas
           arsenicoxydans]
 gi|133737990|emb|CAL61035.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 117/225 (52%), Gaps = 19/225 (8%)

Query: 31  YLAH---VLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVE---YQSRSQTKQSDVQY 84
           ++AH   V+R+  GD I LFNG+ GE+ + IS + K  R   E   ++ R       +  
Sbjct: 21  HVAHHIQVIRLSAGDAITLFNGEGGEYTATISTIEKK-RVTAEIKIFEPREVELPYAITL 79

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQC 138
             +  + +++D++I+K+VE+G  A++P      V+    +     M   +   I+A+EQ 
Sbjct: 80  AQALPEASKMDWIIEKAVELGAHALQPLASQRCVVRLSAERAAKKMQHWQGIIIAASEQS 139

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP-NVAILIGPE 197
               L  +  P          D + +I+ +     +E SL    A  H P +VA++IGPE
Sbjct: 140 GRNRLTTLAEPADFNQWATQQDLHVRIMLSPR---AEQSLSDW-ARHHPPQSVALMIGPE 195

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           GG+ +E++ET         LS+GPR+LR++TA +AA+A + A+ G
Sbjct: 196 GGF-TEKEETQAIANGALMLSMGPRVLRTETAGMAAIAALNAVWG 239


>gi|332285304|ref|YP_004417215.1| hypothetical protein PT7_2051 [Pusillimonas sp. T7-7]
 gi|330429257|gb|AEC20591.1| hypothetical protein PT7_2051 [Pusillimonas sp. T7-7]
          Length = 247

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 121/244 (49%), Gaps = 12/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +   PL   T  +      H+   VLR+K G +I+LF+G+ G++ + +   GK   
Sbjct: 6   ISRFYCATPLLPNTSIELPAALAHHAVRVLRLKTGSDIILFDGQGGQYTATLEITGKQAH 65

Query: 67  FKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPVITRYTQN 119
            ++  Y+         +  +      +++D++++K+VE+G      + A R V+    + 
Sbjct: 66  ARLGGYEPVEAELTGHITLVQGIPSGDKMDWVVEKAVELGASRIVPLAAQRSVLQLSGER 125

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHN-CQIVFADETCGSENSL 178
               +D  R  + +A+EQC    +  +  P TL+  +   D +   I+F     GS   L
Sbjct: 126 LRKRLDHWRRISQAASEQCGRNRIMEVASPLTLQQYIAASDADPASILFCHP--GSSRKL 183

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  A+    ++ +++GPEGG+ S+E+  L +   +TP+  G R+LR++TA +A +A V 
Sbjct: 184 AQ-AALEAGNSLTLVVGPEGGW-SDEELALMAKHQLTPVGFGARVLRTETAGLALIAAVS 241

Query: 239 AICG 242
            + G
Sbjct: 242 TLRG 245


>gi|325204878|gb|ADZ00332.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M01-240355]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLADIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|309379533|emb|CBX21899.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGITAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|268317477|ref|YP_003291196.1| hypothetical protein Rmar_1925 [Rhodothermus marinus DSM 4252]
 gi|262335011|gb|ACY48808.1| protein of unknown function DUF558 [Rhodothermus marinus DSM 4252]
          Length = 239

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 113/224 (50%), Gaps = 15/224 (6%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           D+ H+   VLR + GD +++ +G  G    ++  V +  ++ +V  ++R    +   +  
Sbjct: 22  DEAHHAVRVLRHRPGDEVIVVDGVGGWHRLRLELVDRQGVQGRV-LETRRDVGEPPYRLT 80

Query: 86  FSPI---KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILT 142
                  +T R +  ++K+VE+G+ AI P++T  T+ TH+  +R R   I+A +QC    
Sbjct: 81  IGLALLKQTARFETFLEKAVELGVAAIVPLLTARTERTHFRPERARRLLIAAMKQCGRSR 140

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP--NVAILIGPEGGY 200
           LP ++ P     +L   D     +   E    +     +H +   P  +  +L+GPEGG+
Sbjct: 141 LPLLHAPRPFAEVLH--DPAALRLLCHEQ--PDRPRHPIHELLRRPVGDALVLVGPEGGF 196

Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAA-VAAMALVQAICGD 243
            S+E     +  F T +SLG R LR++TAA VAA A +  IC D
Sbjct: 197 TSDEVLQAEAAGFQT-VSLGARRLRAETAALVAASAFL--ICQD 237


>gi|261393256|emb|CAX50882.1| conserved hypothetical protein [Neisseria meningitidis 8013]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGITAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|59802454|ref|YP_209166.1| hypothetical protein NGO2160 [Neisseria gonorrhoeae FA 1090]
 gi|240079873|ref|ZP_04724416.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae FA19]
 gi|240127370|ref|ZP_04740031.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268596016|ref|ZP_06130183.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268685742|ref|ZP_06152604.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|293397817|ref|ZP_06642023.1| ribosomal RNA small subunit methyltransferase E [Neisseria
           gonorrhoeae F62]
 gi|59719349|gb|AAW90754.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|268549804|gb|EEZ44823.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268626026|gb|EEZ58426.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291611763|gb|EFF40832.1| ribosomal RNA small subunit methyltransferase E [Neisseria
           gonorrhoeae F62]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    N +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSENTKLIM------SINRACKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|308048318|ref|YP_003911884.1| 16S rRNA m(3)U-1498 methyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307630508|gb|ADN74810.1| 16S rRNA m(3)U-1498 methyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 243

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 116/255 (45%), Gaps = 32/255 (12%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL    Q     D  +++  VLRM+ G  ++LFNG   ++ + I   GK  
Sbjct: 2   RVPRIYQPVPLAAGQQLALDDDGANHIGRVLRMQPGQAVMLFNGDGQQYPAIIDEAGKK- 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRY 116
              V  QS  Q       ++ SP+         +  ++++ IQKSVE+G  +I P+ +  
Sbjct: 61  NVLVTVQSVEQ------HHVESPLALHLGQVISRGEKMEFTIQKSVELGAASITPLWSER 114

Query: 117 TQNTHYNMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFAD 169
                   DR+       +   I+A EQC    +P + P   L+  +       ++    
Sbjct: 115 C-GVKLAGDRLDKKVAQWQKIAIAACEQCGRNVVPEVRPVMRLDQWMAEPFEGLKLNLHP 173

Query: 170 ETCGSENSL-EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
               S N+L E + A+       +LIGPEGG  +EE        F T + LGPR+LR++T
Sbjct: 174 RAEYSINTLPEPVQALR------LLIGPEGGLSAEEIAAAREFDF-TDILLGPRVLRTET 226

Query: 229 AAVAAMALVQAICGD 243
           AA+ AM  +Q   GD
Sbjct: 227 AALTAMTALQVRFGD 241


>gi|294142457|ref|YP_003558435.1| hypothetical protein SVI_3686 [Shewanella violacea DSS12]
 gi|293328926|dbj|BAJ03657.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 242

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 120/256 (46%), Gaps = 36/256 (14%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSI 65
           + R++ D PL +        +   ++  VLRM +G+ I LFNG + ++L++ IS   K++
Sbjct: 3   IPRIYQDSPLAVGDTLALHDEAASHIGRVLRMSQGEQISLFNGSEHDYLAEIISASKKNV 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
             K+   S + ++     ++   I + +R+D+ IQKSVE+G+  I P+ +         +
Sbjct: 63  SVKILSSSINSSESPLHIHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLSGE 122

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + + +   I A EQ     +P I P  +LE     W            CG +   
Sbjct: 123 RLEKKIHQWQKIVIGACEQSGRSRVPEIRPAMSLE----AW------------CGEQTDS 166

Query: 179 EKL-------HAIA----HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
            KL       H I      +P V +LIGPEGG    E        F T + LGPR+LR++
Sbjct: 167 LKLNLHPRASHGIQGLSLDVPKVRLLIGPEGGLSETEILKTEQDKF-TDILLGPRVLRTE 225

Query: 228 TAAVAAMALVQAICGD 243
           TAA+ A++ +Q   GD
Sbjct: 226 TAALTAISALQLKFGD 241


>gi|183596310|ref|ZP_02958338.1| hypothetical protein PROSTU_00045 [Providencia stuartii ATCC 25827]
 gi|188023914|gb|EDU61954.1| hypothetical protein PROSTU_00045 [Providencia stuartii ATCC 25827]
          Length = 243

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 112/246 (45%), Gaps = 14/246 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++IS   K  
Sbjct: 2   RIPRIYHPEPLQINTTIALGDDAANHVGRVLRMTAGQKLELFDGSNQVFCAEISEATKKK 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                  S    ++S +      +  +  ++++ IQKSVE+G+  I P+++         
Sbjct: 62  VSVNIIDSHVDDRESPLDLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLDP 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +       + +   I+A EQC    +P I P  +LE      D   ++        S N+
Sbjct: 122 ERLEKKRQQWQKIAIAACEQCGRNRIPQIRPVQSLEAWCAEEDGAFKVNLHPRATQSINT 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L      A +  V +LIGPEGG   EE     +  F T + LGPR+LR++T A+ A+  +
Sbjct: 182 LP-----AELNKVRLLIGPEGGLSEEEIAMTANYQF-TDILLGPRVLRTETTALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRLGD 241


>gi|240114827|ref|ZP_04728889.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID18]
 gi|260441357|ref|ZP_05795173.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           DGI2]
 gi|268600483|ref|ZP_06134650.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291044717|ref|ZP_06570426.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268584614|gb|EEZ49290.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291011611|gb|EFE03607.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 241

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    N +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSENTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+  +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAITAMQTLWGDF 240


>gi|251779327|ref|ZP_04822247.1| conserved surface protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243083642|gb|EES49532.1| conserved surface protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 254

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 115/239 (48%), Gaps = 16/239 (6%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQ 79
           T+GK  GD   ++  VLR+ EG+ ++L N +  E+L +I  VGK        +  S   +
Sbjct: 14  TEGKILGDDVKHIYKVLRLNEGEKVVLNNCEGKEYLGEIESVGKQEVIVNILEELSTNNE 73

Query: 80  SDVQY-IFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTIS 133
           S V   +F  + K  ++D ++QK  E+G+    P+IT       +     ++R+    + 
Sbjct: 74  SRVNITLFQGLPKGQKMDLIVQKGTELGIKEFVPIITDRVDVKLKGEFKKLERLNRIALE 133

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF---ADETCGSENSLEKLH----AIAH 186
           AA+Q     +P +      +  L        I+      E  G ++ +++L      +  
Sbjct: 134 AAKQSKRSIIPNVREVVEFDEALNELQRLDLILVPYENAENFGFKSLVKELSDKNVDLNS 193

Query: 187 IPNVAILIGPEGGYHSEEKETL-HSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           I N+ ++IGPEGG+   E ETL H   ++  ++LG RILR++TA   A +L+Q    D 
Sbjct: 194 IENIGVVIGPEGGFEESEIETLKHKGAYI--ITLGNRILRTETAGFVATSLIQYELADL 250


>gi|217972024|ref|YP_002356775.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS223]
 gi|217497159|gb|ACK45352.1| protein of unknown function DUF558 [Shewanella baltica OS223]
          Length = 243

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 109/244 (44%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R+F   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK     
Sbjct: 5   RIFQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKKHVTV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                     +S +      +  + +R+++ IQKSVE+G+  I P+ +        N +R
Sbjct: 65  KLLSCEVNLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRC-GVKLNGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   +SA EQ     +P + P   L           ++          N L+
Sbjct: 124 LEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LAHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|299531912|ref|ZP_07045312.1| 16S ribosomal RNA methyltransferase RsmE [Comamonas testosteroni
           S44]
 gi|298720087|gb|EFI61044.1| 16S ribosomal RNA methyltransferase RsmE [Comamonas testosteroni
           S44]
          Length = 246

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 113/218 (51%), Gaps = 15/218 (6%)

Query: 34  HVLRMKEGDNILLFNGK------DGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIF 86
            VLR + GD I LF G+       GE+ + I+++G+S +  +V+  S ++ +   V ++ 
Sbjct: 27  QVLRHQPGDVITLFEGQTGNGFTGGEFQATITHMGRSDVGVRVDSHSPAEREAERVVHLV 86

Query: 87  SPIKTN-RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCD 139
             +  N R+D++++K+ E+G+ +I+PV+   +            ++R ++  +SA EQC 
Sbjct: 87  VGMPANERMDWLVEKATELGVASIQPVMAARSVLKLKGDRADKKIERWQSIAVSACEQCG 146

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
              +P I+ P  L   L++ D              E +     A      V +L GPEGG
Sbjct: 147 RNQVPVIHAPLPLADWLRSKDAPATDTTRLVLSLREGNQPLRTAAGDAQTVWVLHGPEGG 206

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             ++E++      +  P SLG R+LR++TA+VAA++L+
Sbjct: 207 LTAQEEDWALEQGW-KPASLGSRVLRAETASVAALSLL 243


>gi|269101820|ref|ZP_06154517.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161718|gb|EEZ40214.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 243

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 124/253 (49%), Gaps = 44/253 (17%)

Query: 15  PLCIKTQGKA--SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
           P  + +QG    S D  +++  V+RM+ G  I+LF+G + E+ + I+   K    +VE Q
Sbjct: 9   PESLPSQGSVMLSDDAANHVGRVMRMQAGQEIMLFDGSNAEFPAIITNASKK-NVEVEIQ 67

Query: 73  SRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            R +        I SP+         +  ++++ IQKSVE+G+  I P+I+        N
Sbjct: 68  QRVECS------IESPLNIHLGQVVSRGEKMEFTIQKSVELGVNTITPLISERC-GVKLN 120

Query: 124 MDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +R        +   I+A EQ     +P I P   LE    +W   C    A+E  G + 
Sbjct: 121 GERFDKKLAQWQKIAIAACEQSGRNVVPEIRPIMKLE----DW---C----AEEFSGLKL 169

Query: 177 SL--EKLHAIAHIP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           +L     ++I  +P    +V +LIGPEGG  S+E +   +  F   L LGPR+LR++TAA
Sbjct: 170 NLHPRAKYSINTLPTPVTDVRLLIGPEGGLSSDEIDMTENYNFDEIL-LGPRVLRTETAA 228

Query: 231 VAAMALVQAICGD 243
           + A+  +Q   GD
Sbjct: 229 MTAITALQVRFGD 241


>gi|152976741|ref|YP_001376258.1| hypothetical protein Bcer98_3037 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025493|gb|ABS23263.1| protein of unknown function DUF558 [Bacillus cytotoxicus NVH
           391-98]
          Length = 249

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 117/244 (47%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+      T  +  GD  H++A V+RM  GD+I    NGK     +++I+  +V 
Sbjct: 1   MQRYFVEEKNVNGTTIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAACTIAEITNEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   +      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  STI---VEWIETTSELPILVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL---KNWDHNCQIVFADETCG 173
            + T   ++R++     AAEQ     +P +Y P + + LL   K +D  C + + +E   
Sbjct: 118 AKKTDKKVERLKKIVKEAAEQSHRTEIPHVYAPVSFKQLLEMSKEYD-VCLVAYEEEAKQ 176

Query: 174 SE--NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E  N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA +
Sbjct: 177 GEKANFAKALTTIEPGQKLLIVFGPEGGLSEEEVSALREYKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|119503497|ref|ZP_01625580.1| hypothetical protein MGP2080_03120 [marine gamma proteobacterium
           HTCC2080]
 gi|119460559|gb|EAW41651.1| hypothetical protein MGP2080_03120 [marine gamma proteobacterium
           HTCC2080]
          Length = 243

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 107/231 (46%), Gaps = 34/231 (14%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSP 88
           H+L  VLR + GDNI LF G   +W   +S V K S+   V   S   T+        SP
Sbjct: 26  HHLVKVLRARVGDNITLFTGTGLDWQCCVSEVHKRSVTLSVGGASNPNTE--------SP 77

Query: 89  IKT---------NRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTI 132
           +KT         +R D+ IQK+ E G+  I P+ +    +     DR+       +    
Sbjct: 78  LKTHLGLCLSKGDRFDWAIQKATEAGVATITPLYSDRV-DVKLPADRIPKRIAHWQQIVR 136

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           SA EQC    +P I+ PT     L NW    Q   ++      +    +  +    ++A+
Sbjct: 137 SACEQCGRAIVPQIFDPTP----LSNW---AQEQVSEAKLFLHHRESAMLPVTRPTSIAL 189

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           L+GPEGG    ++       F+  + LGPR+LR++TA + A++++ A  GD
Sbjct: 190 LVGPEGGLSETDRGYASDAGFIG-VKLGPRVLRTETAPLVALSILGARWGD 239


>gi|254804259|ref|YP_003082480.1| hypothetical protein NMO_0244 [Neisseria meningitidis alpha14]
 gi|304388478|ref|ZP_07370582.1| 16S rRNA methyltransferase RsmE [Neisseria meningitidis ATCC 13091]
 gi|254667801|emb|CBA03770.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|304337534|gb|EFM03699.1| 16S rRNA methyltransferase RsmE [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|319941739|ref|ZP_08016061.1| hypothetical protein HMPREF9464_01280 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804672|gb|EFW01539.1| hypothetical protein HMPREF9464_01280 [Sutterella wadsworthensis
           3_1_45B]
          Length = 249

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 110/249 (44%), Gaps = 23/249 (9%)

Query: 9   RLFVDFPLCIKTQGKASGDQYH-------YLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           R F+D P    T     G ++        +    LR+  G+ + LFNG    W   + + 
Sbjct: 5   RFFIDAP----TDAFQLGGRFELPPKTARHAGRSLRLAAGEIVELFNGTGAAWSGPVGFS 60

Query: 62  GKSIRFKVEYQS-RSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPVIT 114
             S   ++E+++ R+      +  + S +   + D++++K+VE G      M A R V  
Sbjct: 61  DASAWVELEHRTDRTAESPLAITLLQSLVAPEKADWIVEKAVEAGISEIIFMPAERSVTK 120

Query: 115 RYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +     + R+     SAAEQC    +P +    +LE   K    + + V A     S
Sbjct: 121 LAGERLEKRLARLTDIARSAAEQCGRNVVPLVRAVPSLEAGFKTVSGDVKFVLAPGADAS 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
             S      +  + +VA  +GPEGG+ + E E L +     P  LGPR+LR++TA +AA 
Sbjct: 181 AAS----SMLPGLLSVAFAVGPEGGFSAREIE-LAAAHGWRPQLLGPRVLRTETAGLAAA 235

Query: 235 ALVQAICGD 243
              Q + GD
Sbjct: 236 IWAQTLVGD 244


>gi|255659202|ref|ZP_05404611.1| RNA methyltransferase, RsmE family [Mitsuokella multacida DSM
           20544]
 gi|260848654|gb|EEX68661.1| RNA methyltransferase, RsmE family [Mitsuokella multacida DSM
           20544]
          Length = 248

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 121/234 (51%), Gaps = 22/234 (9%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDG-EWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           G   H+L HV+R K G  +++ + ++    +    +   ++  ++  +  + T +S +Q 
Sbjct: 18  GADAHHLMHVMRAKPGQEVIVVDDENQVARMEMTRFTSDAVTMELVERLDADT-ESPIQL 76

Query: 85  IFSP--IKTNRLDYMIQKSVEMGMGAIRPV-----ITRY-TQNTHYNMDRVRTYTISAAE 136
             +   +K +++D+++QK+VE+G+  I PV     + RY  +       R +     AA+
Sbjct: 77  GLAMCLLKADKMDFVVQKAVELGVNCIVPVASHNCVVRYDAKKAKQRQQRWQKIADEAAK 136

Query: 137 QCDILTLPFIYPPTTL-EFLLKNW---DHNCQIVFA---DETCGSENSLEKLHAIAHIPN 189
           QC    L  ++P  TL +FL   W   D + + +F    +E     + L++  +  ++  
Sbjct: 137 QCGRTVLVKVFPIETLKDFLSHAWYEDDMDSEFLFCYENEENVSVRDCLQRTTSERYM-- 194

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             +LIGPEGG+  EE E +        ++LGPRILR++TAAVA +++VQ   GD
Sbjct: 195 --LLIGPEGGFTLEEAEAVVKAGG-QSVTLGPRILRAETAAVAGLSIVQYEKGD 245


>gi|50085384|ref|YP_046894.1| hypothetical protein ACIAD2284 [Acinetobacter sp. ADP1]
 gi|49531360|emb|CAG69072.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 243

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 118/244 (48%), Gaps = 24/244 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L + T    +   +H+   VLR +  D  + FNG+ GE+   +  + K   
Sbjct: 1   MNRFYIEADLSVNTDTLLTESVFHHWVRVLRAQVNDCAIFFNGQGGEYQVTLQEINK--- 57

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI------KTNRLDYMIQKSVEMGMGAIRPVIT-RYTQN 119
            K    S  Q    D    F  I      K +R+DY IQK+ E+G+  I+ + + R    
Sbjct: 58  -KNATVSIDQFNPVDRTPAFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMR 116

Query: 120 THYNMDRVR-----TYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCG 173
             Y+ D+ +     +  I+A EQC +  +P I PP +L E++      N ++V A E   
Sbjct: 117 LKYDRDQKKIDHWQSIAIAACEQCGMNRVPEILPPVSLNEWINTATLPNTKLVLAPEK-E 175

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            +N L+   +      +A+LIGPEGG    E    ++  F+    +G R+LR++TA V A
Sbjct: 176 QQNVLKNAQS-----ELALLIGPEGGLSENEIIAANNKGFIN-WCIGERVLRTETAPVVA 229

Query: 234 MALV 237
           ++++
Sbjct: 230 LSIL 233


>gi|311278138|ref|YP_003940369.1| hypothetical protein Entcl_0810 [Enterobacter cloacae SCF1]
 gi|308747333|gb|ADO47085.1| protein of unknown function DUF558 [Enterobacter cloacae SCF1]
          Length = 243

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 118/247 (47%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   P+ +  Q   S D  +++  VLRM  G  I LF+G +  + ++I +  K S
Sbjct: 2   RIPRIYHPEPVTVGQQMALSDDAANHVGRVLRMGIGQAIQLFDGSNQLFDAEIVHADKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +R  V  +  +  ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VRVTV-LKGETDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 AERLNKKIQQWQKIAIAACEQCGRNRIPEIRPAMDLEQWCAEQDDALKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPQ-----PVERVRLLIGPEGGLSADEIAMTARYRF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|300869308|ref|ZP_07113899.1| 16S ribosomal RNA methyltransferase RsmE [Oscillatoria sp. PCC
           6506]
 gi|300332685|emb|CBN59097.1| 16S ribosomal RNA methyltransferase RsmE [Oscillatoria sp. PCC
           6506]
          Length = 284

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 123/274 (44%), Gaps = 40/274 (14%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + L+RL +        Q   +  Q HYL  VLR++EGD  L  +G+   WL++++ +   
Sbjct: 2   AQLQRLAIAPSQLQDRQIILTAQQQHYLYRVLRLREGDRFLAMDGRGHCWLAELAAIDAV 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
              + E   +S+    DV  + +  K N  D +++++VE+G+  I PV++  T  + +  
Sbjct: 62  AVIQEEVFIKSELN-VDVTLMAALPKGNGFDDVVRQAVELGVYCIIPVVSDRTLLKPSSQ 120

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-------TCGSE 175
            ++R +     AAEQ +   +P +  P +    ++N D   + +            C  +
Sbjct: 121 KIERWQRIAAEAAEQSERQIVPVMLEPVSFAVGVENCDRKYKYICVARGDSRHLLDCLLD 180

Query: 176 NSLEKLHA-----------------------------IAHIPNVAILIGPEGGYHSEEKE 206
           N +EK  +                             I + P++ I  GPEGG+  +E  
Sbjct: 181 NKIEKEESPITNHQSPIINSQLPITNYQLPITNHQSQITNYPSIVIATGPEGGWTEKEVT 240

Query: 207 TLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           T     F  P+SLG RILR+ TA + A++++  +
Sbjct: 241 TAIQFSF-QPVSLGSRILRAVTAPIVALSIIAGV 273


>gi|298715395|emb|CBJ28006.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 301

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 126/292 (43%), Gaps = 92/292 (31%)

Query: 36  LRMKEGDNILLFNGKDGEWLSKIS--------------------------------YVGK 63
           +R+++G+ + +F+G +GE+L+ ++                                   K
Sbjct: 1   MRLRDGNPVRVFDGVNGEFLAAVATSSSSSSRLERSGEKIGSGRGGRRGRGKRSAGGAEK 60

Query: 64  SIRFKVEYQSRSQTKQS-------------DVQYIFSPIKTNRLDYMIQKSVEMGMGAIR 110
            I  +VE  +R Q                 +++ +F+PI+  RL  +++K+VE+G   + 
Sbjct: 61  VIELRVECLTRRQPGIGGGGGGEVEDLDAPEIELVFAPIRKQRLKMLVEKAVEVGASRLT 120

Query: 111 PVITRYTQNTHYN----MDRVRTYT-ISAAEQCDILTLPFIYPPTTLEFLLKNWD---HN 162
           PV+T  TQ    +    +DR+   T + AAEQC+ +T+P +  P TL   L++ +    +
Sbjct: 121 PVLTARTQKGAVSDASMLDRLGAVTAVEAAEQCERMTVPPMASPVTLASYLRSLELRHSS 180

Query: 163 CQ---IVFADETCGSENSLEK---------------LHAIA-------------HI---- 187
           C    IV        + SL                 L A+A             H+    
Sbjct: 181 CDGSSIVGLARDRDGDRSLPDIVFVCKERDVDAPPLLEALAEYEQAFSEQRRQDHVNSSD 240

Query: 188 ----PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
                N A LIGPEGG+  +E  TL   PFV  +SLG  +LR++TAAV A++
Sbjct: 241 DNRNANAAFLIGPEGGFDPDEIGTLAQYPFVRFVSLGRTVLRAETAAVYALS 292


>gi|240013291|ref|ZP_04720204.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae DGI18]
 gi|240120363|ref|ZP_04733325.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID24-1]
          Length = 241

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTRLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|126175723|ref|YP_001051872.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS155]
 gi|152999348|ref|YP_001365029.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS185]
 gi|304411141|ref|ZP_07392756.1| protein of unknown function DUF558 [Shewanella baltica OS183]
 gi|307306436|ref|ZP_07586179.1| protein of unknown function DUF558 [Shewanella baltica BA175]
 gi|125998928|gb|ABN63003.1| protein of unknown function DUF558 [Shewanella baltica OS155]
 gi|151363966|gb|ABS06966.1| protein of unknown function DUF558 [Shewanella baltica OS185]
 gi|304350334|gb|EFM14737.1| protein of unknown function DUF558 [Shewanella baltica OS183]
 gi|306910727|gb|EFN41155.1| protein of unknown function DUF558 [Shewanella baltica BA175]
          Length = 243

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK     
Sbjct: 5   RIYQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKKHVTV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                 +   +S +      +  + +R+++ IQKSVE+G+  I P+ +        N +R
Sbjct: 65  KLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRC-GVKLNGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   +SA EQ     +P + P   L           ++          N L+
Sbjct: 124 LEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LAHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|300853987|ref|YP_003778971.1| hypothetical protein CLJU_c08010 [Clostridium ljungdahlii DSM
           13528]
 gi|300434102|gb|ADK13869.1| conserved hypothetical protein [Clostridium ljungdahlii DSM 13528]
          Length = 251

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 113/228 (49%), Gaps = 11/228 (4%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQ-Y 84
           G+   ++  VLR+K GD I + N    E+L  I  + K        +  +   +S ++ Y
Sbjct: 20  GEDVKHIRKVLRLKCGDKININNCNGKEFLGAIEKIDKDEVVVNIIEELTLYNESKIKIY 79

Query: 85  IFSPI-KTNRLDYMIQKSVEMGMGAIRPVIT-----RYTQNTHYNMDRVRTYTISAAEQC 138
           +F  + K+ ++D ++QK+VE+G+  I PV+T     +        +DR       A +QC
Sbjct: 80  LFQGLPKSGKMDLIVQKAVELGVYEITPVVTSRVVVKNDSGEFKKVDRWNKIAKEACKQC 139

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DETCGSENSLEKLHAIAHIPNVAILIG 195
               +P +  P + + LL   ++   IV     +   G +  +  +   +++  +AI+IG
Sbjct: 140 KRSIIPKVNVPISFKELLSEGEYMDVIVVPYENESNTGIKKIVNSIKDKSNLEKIAIVIG 199

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+  +E + L ++      +LGPRILR++TA    ++L+    GD
Sbjct: 200 PEGGFEEQEIDELKNINSHIA-TLGPRILRTETAGFVCISLIMYELGD 246


>gi|239998111|ref|ZP_04718035.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae 35/02]
 gi|240112081|ref|ZP_04726571.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae MS11]
 gi|240124855|ref|ZP_04737741.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|254492891|ref|ZP_05106062.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268593962|ref|ZP_06128129.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268598139|ref|ZP_06132306.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268683436|ref|ZP_06150298.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|226511931|gb|EEH61276.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268547351|gb|EEZ42769.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268582270|gb|EEZ46946.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268623720|gb|EEZ56120.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|317165554|gb|ADV09095.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 241

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTRLIM------SINRARKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|120597613|ref|YP_962187.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. W3-18-1]
 gi|146294248|ref|YP_001184672.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella putrefaciens
           CN-32]
 gi|120557706|gb|ABM23633.1| protein of unknown function DUF558 [Shewanella sp. W3-18-1]
 gi|145565938|gb|ABP76873.1| protein of unknown function DUF558 [Shewanella putrefaciens CN-32]
          Length = 243

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 109/244 (44%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++   PL I        D   ++  VLRM  G+NI LFNG   ++L++I   GK     
Sbjct: 5   RIYQPQPLAINQLLNLDEDGAAHIGKVLRMGNGENISLFNGDGNDYLAEIVDAGKKHVTV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                 +   +S +      +  + +R+++ IQKSVE+G+  I P+ +        N +R
Sbjct: 65  KLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRC-GVKLNGER 123

Query: 127 V-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +       +   +SA EQ     +P + P   L           ++          N L+
Sbjct: 124 LEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LAHT-----RVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|170078905|ref|YP_001735543.1| hypothetical protein SYNPCC7002_A2310 [Synechococcus sp. PCC 7002]
 gi|169886574|gb|ACB00288.1| conserved hypothetical protein (DUF558) [Synechococcus sp. PCC
           7002]
          Length = 236

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 113/224 (50%), Gaps = 22/224 (9%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           +Q HYL  VLR++ GD +++ NG    WL +++   + I+  +E Q   QT+      + 
Sbjct: 22  EQRHYLLSVLRLRAGDRLIVLNGLGQAWLGELTET-EEIQL-IESQ-HLQTECPIPVKLV 78

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMDRVRTYTISAAEQCDILTLP 144
           + +  N  D +++   E+G+  I PVI+  T  + +   + R R     AAEQ +   +P
Sbjct: 79  AALPKNGFDEVVRCCTELGVTQIYPVISERTILKPSENKLKRWRKIATEAAEQSERAIVP 138

Query: 145 FIYPPTTLEFLLKNWDHNCQIVFADET--CGS-ENSLEKLHAIAHI--PNVAILIGPEGG 199
            I  P     LL+        +  ++T  CG+ E SL  L A+     P + +LIGPEGG
Sbjct: 139 KIETPQPFLQLLET-------LSPEQTYLCGAREKSLHLLDALPKTLPPEITVLIGPEGG 191

Query: 200 YHSEE--KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
           +   E  +     +P V   SLG  ILR+ TA++ A+ALV + C
Sbjct: 192 WTETEIQQAIAKGMPVV---SLGNSILRAVTASITAIALVNSHC 232


>gi|167630502|ref|YP_001681001.1| hypothetical protein HM1_2440 [Heliobacterium modesticaldum Ice1]
 gi|167593242|gb|ABZ84990.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 254

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 113/234 (48%), Gaps = 17/234 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQ-YI 85
           ++  +L+ VLR++ GD +L F+G+  E+ + ++ +     F    +    ++++ ++ ++
Sbjct: 21  EESQHLSKVLRLRAGDAVLAFDGQGNEYEAIVAEINGDKAFLESLRPTGASREAPIRLWL 80

Query: 86  FSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQC 138
              + K  +++ +IQK+ E+G+  I PV+T  +             DR +     AA+QC
Sbjct: 81  LQGVAKGEKMELVIQKATELGVEKIFPVLTERSVVRFDAAKAKERRDRWQKIAREAAKQC 140

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN-----SLEKLHAIAH---IPNV 190
               +P +  P     ++ +WD    ++   E    +      ++ K   + H      +
Sbjct: 141 WRTVIPEVQLPAAWAEVITDWDMTMPLLIPWEKEQGKGLKQVLTVLKKEGLLHDSPAKVI 200

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            + IGPEGG  + E          T +SLGPRILR++TA +AA+A +    GDW
Sbjct: 201 GLAIGPEGGLTAAEVALARDRGART-VSLGPRILRTETAGIAALAAIMYELGDW 253


>gi|62129237|gb|AAX66940.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322716087|gb|EFZ07658.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 259

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++ F      S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNFHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|269837717|ref|YP_003319945.1| hypothetical protein Sthe_1689 [Sphaerobacter thermophilus DSM
           20745]
 gi|269786980|gb|ACZ39123.1| protein of unknown function DUF558 [Sphaerobacter thermophilus DSM
           20745]
          Length = 249

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 109/239 (45%), Gaps = 21/239 (8%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R ++  PL        + +Q    A VLR+  G  ++LFNG DG+ +          R  
Sbjct: 7   RFYLPAPLPPGESVALTEEQARQAARVLRLAPGAPVVLFNG-DGQEVPGTIEDCAPRRVT 65

Query: 69  VEYQSRSQTKQSDVQYIF---SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
           V        +   V  I    + IK +R D+++QK  E+G+  I P+ T  T      + 
Sbjct: 66  VRLGEPRAGRSCPVPAIHVAQALIKADRFDWVVQKVTELGVARITPLATSRTVVSLPVER 125

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R +   + AAEQ   +T+P I  P TL+ LL        +V     C  EN   
Sbjct: 126 ARQRRERWQRIAVEAAEQSGRVTIPEIDEPATLDDLLPLMARIPALV-----CW-ENEAM 179

Query: 180 KLHAIAHIPNVA---ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            LH +  +P      ++IGPEGG+  EE          T +SLGP ILRS+TAA+AA+A
Sbjct: 180 PLHRV-RLPTAGPLLVVIGPEGGFTREEIAAAVDAGART-VSLGPLILRSETAALAALA 236


>gi|162139548|ref|YP_218021.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
          Length = 243

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 16  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 75

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 76  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++ F      S N+L        +  
Sbjct: 134 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNFHPRAHASINTLP-----LPVER 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 189 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|90412046|ref|ZP_01220053.1| hypothetical protein P3TCK_24711 [Photobacterium profundum 3TCK]
 gi|90327024|gb|EAS43403.1| hypothetical protein P3TCK_24711 [Photobacterium profundum 3TCK]
          Length = 225

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 117/241 (48%), Gaps = 42/241 (17%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  V+RM+ G  +LLF+G + E+ + IS   K    +V+ Q R++        
Sbjct: 3   SDDAANHVGRVMRMQVGQEVLLFDGSNAEFPAVISAASKK-NVEVDIQCRNENS------ 55

Query: 85  IFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------R 128
           I SP+         +  ++++ IQKSVE+G+  I P+I+        N +R        +
Sbjct: 56  IESPLNIHLGQVISRGEKMEFTIQKSVELGVMTITPLISERC-GVKLNAERFEKKLSQWQ 114

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--EKLHAIAH 186
              I+A EQC    +P I P   LE    +W   C    A+E  G + +L     ++I  
Sbjct: 115 KIVIAACEQCGRNVIPEIRPVMKLE----DW---C----AEEYDGLKLNLHPRANYSINT 163

Query: 187 IP----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           +P     V +LIGPEGG  +EE        F   L LGPR+LR++T A+ A+  +Q   G
Sbjct: 164 LPEPVSKVRLLIGPEGGLSAEEISMTEQYKFDEIL-LGPRVLRTETTAMTAITALQVRFG 222

Query: 243 D 243
           D
Sbjct: 223 D 223


>gi|307245046|ref|ZP_07527140.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306854034|gb|EFM86245.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 243

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 114/239 (47%), Gaps = 37/239 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM EG+ I+LF+G +  + + +  VGK         S    ++S++  
Sbjct: 21  SEDATNHVGRVLRMTEGEQIILFDGSNHIFHATLQAVGKKQIIAKIDGSELDNRESNLPI 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQNTHYNMDRVRTYTISAAE 136
               +  + +R+++ IQKSVE+G+  I P+      +    +     + + +   I+A E
Sbjct: 81  HLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIPN 189
           QC    +P I P       L +W            C  ++ + KL       + I  +PN
Sbjct: 141 QCGRNEIPEIRPIMK----LTDW------------CKEQDDMLKLNLHPRAKYTIRQLPN 184

Query: 190 VA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V      +LIG EGG  +EE E   +  F T + LG R+LR++TA++AA+  +Q   GD
Sbjct: 185 VPEAGVRLLIGSEGGLSAEEIEMTETQGF-TEVLLGKRVLRTETASLAAITALQVCFGD 242


>gi|237808014|ref|YP_002892454.1| hypothetical protein Tola_1251 [Tolumonas auensis DSM 9187]
 gi|237500275|gb|ACQ92868.1| protein of unknown function DUF558 [Tolumonas auensis DSM 9187]
          Length = 243

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 115/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS- 64
            + R++ + PL +        D  +++  VLRM     I LFNG+ G++ + I+  GK  
Sbjct: 2   RVPRIYQNSPLNVGASVSLDDDAANHVGRVLRMVPDQEICLFNGQGGQYQAVITESGKKH 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPV------ITRYT 117
           +  K+ ++ + S      +       + +++++ IQKSVE+G+  I P+      +    
Sbjct: 62  VTVKITDFSAHSVESPLSIHLGQVISRGDKMEFTIQKSVELGVNVITPLWSSRCGVKLQG 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 +++ +   ISA EQC   ++P I P  +LE  L       ++        S  +
Sbjct: 122 DRLDKKLEQWQKIAISACEQCGRNSVPLIRPVMSLENWLAEPTDELKLTLHPRAQYSVGT 181

Query: 178 L-EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           L E  H       V ++IGPEGG   +E        F   L LGPR+LR++TAA+ A+  
Sbjct: 182 LPEPTHG------VRLVIGPEGGLSDDEIALTEQYNFQEML-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQCRFGD 241


>gi|188588657|ref|YP_001920258.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium botulinum E3
           str. Alaska E43]
 gi|188498938|gb|ACD52074.1| conserved surface protein [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 254

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 16/239 (6%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQ 79
           T+GK  GD   ++  VLR+ EG+ ++L N +  E+L +I  VGK        +  S   +
Sbjct: 14  TEGKILGDDVKHIYKVLRLNEGEKVVLNNCEGKEYLGEIQSVGKQEVIVNILEELSTNNE 73

Query: 80  SDVQY-IFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTIS 133
           S V   +F  + K  ++D ++QK  E+G+    P+IT       +     ++R+    + 
Sbjct: 74  SRVNITLFQGLPKGQKMDLIVQKGTELGIKEFVPIITDRVDVKLKGEFKKLERLNRIALE 133

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF---ADETCGSENSLEKLH----AIAH 186
           AA+Q     +P +         L        I+      E  G ++ +++L      +  
Sbjct: 134 AAKQSKRSIIPNVREVVEFNEALNELQRLDLILVPYENAENFGFKSLVKELSDKNVDLNS 193

Query: 187 IPNVAILIGPEGGYHSEEKETL-HSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           I N+ ++IGPEGG+   E ETL H   ++  ++LG RILR++TA   A +L+Q    D 
Sbjct: 194 IENIGVVIGPEGGFEESEIETLKHKGAYI--ITLGNRILRTETAGFVATSLIQYELADL 250


>gi|226938941|ref|YP_002794012.1| hypothetical protein LHK_00007 [Laribacter hongkongensis HLHK9]
 gi|226713865|gb|ACO73003.1| Methyltrans_RNA domain containing protein [Laribacter hongkongensis
           HLHK9]
          Length = 240

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 111/220 (50%), Gaps = 18/220 (8%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYIFSPIKT- 91
            VLR++  D ++LF+GK GEW +++  +G+ S R  VE     + +   +  +   + T 
Sbjct: 27  QVLRLRTDDPLILFDGKGGEWRARLVELGRRSARVHVEAFQAVERESPLLLSLAQGVSTG 86

Query: 92  NRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
           +R+++ +QK VE+G+   +P++T         +      +R      +A EQC    +P 
Sbjct: 87  DRMEFTLQKGVELGIAVFQPLVTERAMLKLAGERAERKHERWNDIVRAACEQCGRNRIPE 146

Query: 146 IYPPTTLE-FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA-ILIGPEGGYHSE 203
           I P  TL  FL +      + +    +   E  L    A    P  A +L GPEGG  S+
Sbjct: 147 IRPLMTLAAFLAQPRADAARFIL---SPAGERRLADYPA----PQAAWLLAGPEGGLSSQ 199

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           E+    +  +  PL LGPR+LR++TAA+AA A +Q + GD
Sbjct: 200 EEAAAMAAGW-EPLRLGPRVLRTETAALAAAAAMQTLWGD 238


>gi|221133775|ref|ZP_03560080.1| hypothetical protein GHTCC_02514 [Glaciecola sp. HTCC2999]
          Length = 244

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 125/249 (50%), Gaps = 22/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--- 63
           + R+FV  PL +        +  H+L +VLR+K+   ++LFNG   E+ ++I+ V K   
Sbjct: 3   ITRVFVPEPLIVDAALTIDNESAHHLINVLRVKQDQPLVLFNGDGNEYSAQINEVHKRKV 62

Query: 64  --SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
             ++  K+   + S+      Q I    K +R++ ++QK+ E+G+  I P+IT+   N  
Sbjct: 63  IVNVDAKLAIGAESKFPIHLGQGI---AKGDRMETVLQKATELGVTEITPIITQRC-NVK 118

Query: 122 YNMDR-------VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
            + +R            I A EQ     LP ++PP TL    K      +I F      +
Sbjct: 119 LSPERWAKKLVQWEKVIIGACEQSGRNVLPILHPPITLSEWCKQSTEQYRITFDPH---A 175

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           +  L+ L    H   + ILIGPEGG+   E        F T + +GPR+LR++TAA+A++
Sbjct: 176 QQHLQALPVTQH--GIRILIGPEGGFSEAETYGAEQTGFNT-VKIGPRVLRTETAAIASI 232

Query: 235 ALVQAICGD 243
           A++QA  GD
Sbjct: 233 AIIQATYGD 241


>gi|261855041|ref|YP_003262324.1| hypothetical protein Hneap_0420 [Halothiobacillus neapolitanus c2]
 gi|261835510|gb|ACX95277.1| protein of unknown function DUF558 [Halothiobacillus neapolitanus
           c2]
          Length = 244

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 125/248 (50%), Gaps = 15/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R+++D  L          ++ +YL +VLR+++G  + +F+G++ E  + +S +GK  
Sbjct: 2   RIPRIYLDAALAEGATLPLPAERLNYLKNVLRLRDGQALRVFDGQNHEADATLS-LGKRE 60

Query: 66  RFKVEYQSRSQTKQSDVQ--YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                 +  + + +S +Q   I +  K  ++D++IQK+VE+G+    PV T  +      
Sbjct: 61  GSLAIGRVAAHSVESPLQTHLIQAMGKGEKMDWVIQKAVELGVTRFTPVSTERSVVELKG 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +       R     I A EQ     LP + P  +LE  L   D   + V       +  S
Sbjct: 121 ERADKRHARFIDIAIGACEQSGRNFLPRVDPILSLEEALTQTDAALKWVLHP----NPGS 176

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              L A+A   +VA+LIGPEGG    E E   +  F+ PL+LG R+LR++TA + A++++
Sbjct: 177 GAALPAVAP-DSVALLIGPEGGLSDHEVEAAIASGFM-PLTLGSRVLRTETAPIVALSVL 234

Query: 238 QAICGDWY 245
           Q   GD++
Sbjct: 235 QMQWGDFF 242


>gi|238787363|ref|ZP_04631162.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           frederiksenii ATCC 33641]
 gi|238724625|gb|EEQ16266.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           frederiksenii ATCC 33641]
          Length = 243

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I  V K  
Sbjct: 2   RIPRIYHPQPLQANTELTLSDEAANHVGRVLRMGEGQSLQLFDGSNQVFAAEIIRVDKKN 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 62  LTVRLAEGQPEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC   T+P I     L       D + ++        S
Sbjct: 119 LDGERLAKKIQQWQKIAIAACEQCGRNTVPEIREAMQLSDWCAEQDDSLKLNLHPRASNS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L      A +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----ASLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|296124207|ref|YP_003631985.1| hypothetical protein Plim_3975 [Planctomyces limnophilus DSM 3776]
 gi|296016547|gb|ADG69786.1| protein of unknown function DUF558 [Planctomyces limnophilus DSM
           3776]
          Length = 251

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 110/226 (48%), Gaps = 16/226 (7%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQTKQSDV 82
           G + H+  HVLR+K G  I+LF+G      +++   G+    +R     Q  S       
Sbjct: 22  GSEAHHALHVLRVKTGQQIVLFDGHGNSATAEVIRPGRKDVGLRIVSGIQHSSPPALQLT 81

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMDRVRTYTISAAEQCDI 140
             + +P K +RLD+M++K  E+G+    P+IT+ +        ++R+R   ISA +Q   
Sbjct: 82  LLVATP-KGDRLDWMVEKLTELGVSRFVPLITQRSVVDPRESKLERLRQTVISACKQSHR 140

Query: 141 LTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-----GSENSLEKLHAIAHIP----NVA 191
             L  I  P  L   L   DH  Q   + +        S +S     A + +P    ++A
Sbjct: 141 DWLMEIEEPARLTDWLNRKDHPTQWFGSLQAPLVARKASNDSQPIASANSRMPLENTSLA 200

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           ILIGPEGG+ SEE+  L +     P+ LG  +LR++TAA+A  +L 
Sbjct: 201 ILIGPEGGWTSEEESQLMT-SGARPVRLGQFVLRTETAAIALTSLA 245


>gi|187935444|ref|YP_001885097.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium botulinum B
           str. Eklund 17B]
 gi|187723597|gb|ACD24818.1| conserved surface protein [Clostridium botulinum B str. Eklund 17B]
          Length = 254

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 115/234 (49%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQ 79
           ++GK  GD   ++  VLR+ EG+ ++L N +  E+L +I  VGK        +  S   +
Sbjct: 14  SEGKILGDDVKHIYKVLRLNEGEKVVLNNCEGKEYLGEIQSVGKQEVIVNILEELSTNNE 73

Query: 80  SDVQY-IFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTIS 133
           S V   +F  + K  ++D ++QK  E+G+    P+IT       +     ++R+    + 
Sbjct: 74  SRVNITLFQGLPKGQKMDLIVQKGTELGIKEFVPIITDRVDVKLKGEFKKLERLNRIALE 133

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA----DETCGSENSLEKLH----AIA 185
           AA+Q     +P +      +  L N      ++       E  G ++ +++L      + 
Sbjct: 134 AAKQSKRSIIPNVREVVEFDEAL-NELQGLDLILVPYENAENFGFKSLVKELSDKNVDLN 192

Query: 186 HIPNVAILIGPEGGYHSEEKETL-HSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            I N+ I+IGPEGG+   E ETL H   ++  ++LG RILR++TA   A +L+Q
Sbjct: 193 SIENIGIVIGPEGGFEESEIETLKHKGAYI--ITLGNRILRTETAGFVATSLIQ 244


>gi|294338581|emb|CAZ86910.1| putative Ribosomal RNA small subunit methyltransferase E (16S rRNA
           m3U1498 methyltransferase) rsmE [Thiomonas sp. 3As]
          Length = 236

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 109/215 (50%), Gaps = 29/215 (13%)

Query: 35  VLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFS---PIKT 91
           VLR+KEG+ + +F+G  GEW  ++    K++  +  +   +  +++DV+ + +   P   
Sbjct: 31  VLRLKEGEPVAVFDGTGGEWSGEV-IDPKTLLLRTHH---AVEREADVRVMLAVGMP-AN 85

Query: 92  NRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
            R+D +++K+VE+G+ AI+P+ITR +      +     +   +   I+A EQC    +P 
Sbjct: 86  ERMDALVEKAVELGVAAIQPLITRRSVLRLQGERAQRRVAHWQGVAIAACEQCGRNRVPE 145

Query: 146 IYPPTTLEFLLKNWD------HNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
           + P  TL   L++        H C +        S  +   L   A   +  ++ GPEGG
Sbjct: 146 VAPVATLSDWLQHLGNDNARLHRCVL--------SPLATRALEPFAAGESGWMVSGPEGG 197

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              +E   L    F   +SLGPR+LR+DTA +AA+
Sbjct: 198 LGEDEIALLQRSGFQA-VSLGPRVLRADTAPLAAL 231


>gi|95928478|ref|ZP_01311225.1| protein of unknown function DUF558 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135268|gb|EAT16920.1| protein of unknown function DUF558 [Desulfuromonas acetoxidans DSM
           684]
          Length = 261

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 116/247 (46%), Gaps = 11/247 (4%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG- 62
            S ++R F        +      D  H+++ VLR++  D I+L +G+ G    +I  +  
Sbjct: 7   RSLMRRFFTPQITFTHSSADLPRDVAHHISTVLRLRTDDRIVLCDGRGGCAECRIDEISP 66

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
           K  R         Q     V  I     +++LD ++QK+ E+G+  +RPV  +  Q    
Sbjct: 67  KRCRVTRLRHWLEQETALPVTLIQGLPHSDKLDLILQKTTELGVQQVRPVRCQRCQYPIA 126

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  ++R +     AA Q +   LP +    + E  L++ D + ++V  ++   ++ 
Sbjct: 127 PAKAARKLERWQKIVTEAARQSERSWLPEVAALCSFEEALQHCDADVKLVLWEQ---ADQ 183

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+++        VA+++GPEGG   EE        FV  + LGPRILR++TA +A MA+
Sbjct: 184 PLQRVLPEISPDRVAVVVGPEGGLAQEEVALAVEHGFVA-VGLGPRILRTETAGMALMAI 242

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 243 LQYQYGD 249


>gi|264680843|ref|YP_003280753.1| hypothetical protein CtCNB1_4711 [Comamonas testosteroni CNB-2]
 gi|262211359|gb|ACY35457.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 246

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 112/218 (51%), Gaps = 15/218 (6%)

Query: 34  HVLRMKEGDNILLFNGK------DGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIF 86
            VLR + GD I LF G+       GE+ + I+++G+S +  +V+  S ++ + +   ++ 
Sbjct: 27  QVLRHQPGDVITLFEGQTGNGFTGGEFQATITHMGRSDVGVRVDSHSPAEREAARAVHLV 86

Query: 87  SPIKTN-RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCD 139
             +  N R+D++++K+ E+G+ +I+PV+   +            ++R ++  +SA EQC 
Sbjct: 87  VGMPANERMDWLVEKATELGVASIQPVMAARSVLKLKGDRADKKIERWQSIAVSACEQCG 146

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
              +P I+ P  L   L++ D              E +     A      V +L GPEGG
Sbjct: 147 RNQVPVIHAPLPLADWLRSKDAPATDATRLVLSLREGNQPLRTAAGDAQAVWVLHGPEGG 206

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
             ++E E L       P SLG R+LR++TA+VAA++L+
Sbjct: 207 LTAQE-EDLALEQGWKPASLGSRVLRAETASVAALSLL 243


>gi|24372421|ref|NP_716463.1| hypothetical protein SO_0832 [Shewanella oneidensis MR-1]
 gi|24346395|gb|AAN53908.1|AE015528_1 conserved hypothetical protein TIGR00046 [Shewanella oneidensis
           MR-1]
          Length = 243

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 112/244 (45%), Gaps = 16/244 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSIRF 67
           R++   PL +  Q     D   ++  VLRM  G+ I LFNG   ++L++ I    KS+  
Sbjct: 5   RIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGNGEQISLFNGDGHDYLAEIIDAAKKSVTV 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
           KV     +   +S +      +  + +R+++ IQKSVE+G+  I P+ +         + 
Sbjct: 65  KV-LSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLSGER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   ISA EQ     +P + P   L+          ++          N L+
Sbjct: 124 LDKKIQQWQKIVISACEQSGRSQVPVVRPAMELQQWCSEPTSALKLNLHPRAAHGINGLD 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  +Q 
Sbjct: 184 LSHT-----RVRLLIGPEGGLSAEEIAMTETHQF-TDVLLGPRVLRTETASLTAITALQL 237

Query: 240 ICGD 243
             GD
Sbjct: 238 RFGD 241


>gi|238798622|ref|ZP_04642097.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           mollaretii ATCC 43969]
 gi|238717508|gb|EEQ09349.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           mollaretii ATCC 43969]
          Length = 243

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 116/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   T+   S +  +++  VLRM EG N+ LF+G +  + ++I  V K  
Sbjct: 2   RIPRIYHPQPLQANTELALSDEAANHVGRVLRMSEGQNLQLFDGSNQVFTAEIIRVDKKS 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 62  LVVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC   T+P I     L       D + ++        S
Sbjct: 119 LDGERLAKKIQQWQKIAIAACEQCGRNTIPEIRAAMQLSDWCAEQDDSLKLNLHPRASNS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG   +E      L F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----PSLNKVRLLIGPEGGLSVDEIAMTSHLGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|58697158|ref|ZP_00372581.1| surface protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536534|gb|EAL59900.1| surface protein [Wolbachia endosymbiont of Drosophila simulans]
          Length = 182

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 93/180 (51%), Gaps = 3/180 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+  L        +  Q HY+ +V+R+K+ DN+ LFNGKDGEWL ++  + + +   
Sbjct: 5   RLYVEEALSQGVSLALNPQQSHYICNVMRLKKYDNLSLFNGKDGEWLGEVVNISRKLTEV 64

Query: 69  VEYQSRSQTKQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
              +   Q +  +  Y++   +K+  L+ +++++ EMG+  I+ + T  T   + N+ R 
Sbjct: 65  TPKECTKQQQYEENLYLYCAMVKSAALNNIVRQATEMGVICIQFISTERTVVKNINLSRA 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           +   I AAEQ   +++P I PP     L  +   N   V  DET  ++  L+    +A I
Sbjct: 125 KLQAIEAAEQSGRISIPEILPPINFCELPDSQSKN--FVLCDETGKADKVLKGKKNVAII 182


>gi|283835293|ref|ZP_06355034.1| 16S rRNA methyltransferase RsmE [Citrobacter youngae ATCC 29220]
 gi|291068451|gb|EFE06560.1| 16S rRNA methyltransferase RsmE [Citrobacter youngae ATCC 29220]
          Length = 243

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 116/248 (46%), Gaps = 18/248 (7%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +Q     D  +++  VLRM  G  + LF+G +  + ++I++  K S
Sbjct: 2   RIPRIYHPEPLTSGSQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITHASKKS 61

Query: 65  IRFKV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY----- 116
           +  KV   E   R       +  + S  +  ++++ IQKS+E+G+  I P+ +       
Sbjct: 62  VDVKVLNVELDDRESPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKL 119

Query: 117 -TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
            ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S 
Sbjct: 120 DSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  + +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+ 
Sbjct: 180 NTLP-----LPVERIRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|207721568|ref|YP_002252007.1| hypothetical protein RSMK01827 [Ralstonia solanacearum MolK2]
 gi|206586729|emb|CAQ17314.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 249

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 126/255 (49%), Gaps = 25/255 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R ++D PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + +  R
Sbjct: 3   LPRFYIDSPLAPHTTVTLPESVARHI-HVLRLAVGDDVQLFDGSGLEFRARLDAINR--R 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKT----NRLDYMIQKSVEMGMGAIRP------VITRY 116
                 + +    ++ +Y+ +  +     +++D++I+K+VE+G+ AI P      V+   
Sbjct: 60  DATASLADATQPDTEARYVITLAQGIAGGDKMDWLIEKAVELGVHAIAPLQTERGVVRLS 119

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +    +A EQC    +P + P TTL   L     + +        GS++
Sbjct: 120 GERAAKRVQHWQALVQAACEQCGRARVPAVSPVTTLRDWLTAAKASGRARVMLSPRGSQS 179

Query: 177 -------SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
                  S E++ +      + +LIGPEGG  S ++E+L       PL+LG RILR+++A
Sbjct: 180 LTQWAAQSRERIDST----GIELLIGPEGGL-SPDEESLAEAAGYLPLTLGRRILRTESA 234

Query: 230 AVAAMALVQAICGDW 244
           A+ A++ + A+ G++
Sbjct: 235 ALVAVSALHAVLGEF 249


>gi|261823140|ref|YP_003261246.1| 16S ribosomal RNA methyltransferase RsmE [Pectobacterium wasabiae
           WPP163]
 gi|261607153|gb|ACX89639.1| protein of unknown function DUF558 [Pectobacterium wasabiae WPP163]
          Length = 244

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 112/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
           S D  +++  VLRM  G ++ LF+G +  + ++I   GK S+R  V    + + K+S + 
Sbjct: 22  SDDAANHVGRVLRMNTGQSLQLFDGSNHVFDAEIIAAGKKSVRVSV-TAGKLEDKESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     + + +   ++A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERCGVKLDAERMEKKISQWQKIAVAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ     +P + P  TLE      D+  ++        S N+L        +  V +LIG
Sbjct: 141 EQSGRNCVPLVRPAMTLEAWCAEQDNALKLNLHPRATQSINTLP-----LPVDRVRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  + E  T+ S    T + LGPR+LR++T A+ AM  +Q   GD
Sbjct: 196 PEGGLTATEI-TMTSEHGFTDILLGPRVLRTETTALTAMTALQVRFGD 242


>gi|254515811|ref|ZP_05127871.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR5-3]
 gi|219675533|gb|EED31899.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR5-3]
          Length = 245

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 104/225 (46%), Gaps = 19/225 (8%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIF 86
            ++A  LRM+  D + LFNG   E    I+ + K  R  V     S+  +    D   I 
Sbjct: 26  RHIAKALRMRVEDTLCLFNGNGVEARGLITAIDKD-RVSVSLHDLSEPPRESPLDTVLII 84

Query: 87  SPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRT-------YTISAAEQCD 139
           +  + +R+D ++QK+ E+G+  I P+I+  T     + +R+           ISA EQC 
Sbjct: 85  ALSRGDRMDTVVQKATELGVSEIWPMISERT-GVRLDGERLSKKQEHWGRVAISACEQCG 143

Query: 140 ILTLPFIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
              LP I  P +  E L +    +  +       G+   L +        ++ +L+GPEG
Sbjct: 144 RNRLPLIAAPVSYAETLSRAAQQDASLRLVLHPLGNAEPLPE-----QCRSLIMLVGPEG 198

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           G   +E        F T   LGPRILR++TA +A +A+ QA  GD
Sbjct: 199 GLSDQEVAGACDAGF-TAFQLGPRILRTETAPLAGLAVAQARWGD 242


>gi|163942067|ref|YP_001646951.1| hypothetical protein BcerKBAB4_4162 [Bacillus weihenstephanensis
           KBAB4]
 gi|229135136|ref|ZP_04263937.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST196]
 gi|163864264|gb|ABY45323.1| protein of unknown function DUF558 [Bacillus weihenstephanensis
           KBAB4]
 gi|228648313|gb|EEL04347.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST196]
          Length = 249

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 118/244 (48%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E  +++I+  +V 
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TTI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL---KNWDHNCQIVFADETCG 173
            +     ++R+R     AAEQ     +P ++ P++ + LL     +D  C + + +E   
Sbjct: 118 AKKADKKVERLRKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYD-VCLVAYEEEAKQ 176

Query: 174 SENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S   + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA +
Sbjct: 177 GEKSNFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|284007789|emb|CBA73643.1| ribosomal RNA small subunit methyltransferase E [Arsenophonus
           nasoniae]
          Length = 245

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 116/229 (50%), Gaps = 18/229 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
           S +  ++++ VLRM  G NI LF+G +  ++ +I    K S++ ++   + +  ++S + 
Sbjct: 23  SDNATNHVSRVLRMSVGQNIELFDGSNSIFIGQILEANKKSVKIQLGLATIA-NRESPLD 81

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISA 134
                +  +  ++++ IQKSVE+G+  I P+++    N   +  R+       ++  ISA
Sbjct: 82  LHLGQVISRGEKMEFTIQKSVELGVNIITPLLSERC-NVKLDPRRLSKKQQQWQSIAISA 140

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
            EQC    +P I P   +E      D   +I    +   S N+L     +A +  + +LI
Sbjct: 141 CEQCGRNKIPLIRPVMPIEAWCMEKDDALKINLHPKAQSSINTL-----LASVNKIRLLI 195

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG   +E     +  F T + LGPRILR++T A+ A+  +Q   GD
Sbjct: 196 GPEGGLSPDEIIMTTNYQF-TNILLGPRILRTETTALTAITALQVRFGD 243


>gi|67924875|ref|ZP_00518269.1| Conserved hypothetical protein 46 [Crocosphaera watsonii WH 8501]
 gi|67853274|gb|EAM48639.1| Conserved hypothetical protein 46 [Crocosphaera watsonii WH 8501]
          Length = 241

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 116/235 (49%), Gaps = 21/235 (8%)

Query: 21  QGKA---SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQT 77
           QGK    + +Q HYL +VLR+KE    ++ +G +  +L K++     I  +++ Q+    
Sbjct: 13  QGKIINLTPEQKHYLKNVLRLKEDSEFIVIDGHNQTYLVKLNQDKGEIIKELKEQTELPI 72

Query: 78  KQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMDRVRTYTISAA 135
               V  + +  K    D +I+   E+G+  I P+IT+ T  + + + ++R R     A 
Sbjct: 73  ---TVTLMIALPKNKGFDEVIRSCTELGVNTIIPIITKRTLLKPSSHKIERWRKIVKEAT 129

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDH---NCQIVFADETCGSENSLEKL--HAIAHIPN- 189
           EQ +   +P I  P +    L N D+   NC I      C +    + L  + +  I N 
Sbjct: 130 EQSERQIVPIIMEPMSFSEALNNMDNTNKNCYI------CVARKKAKHLLTYLLPEITNS 183

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           V I  G EGG+  EE +    L F+ P++LG R+LR+ TA + A++LV A+   +
Sbjct: 184 VIIATGCEGGWTEEEIDQAEDLGFI-PVNLGSRVLRAVTAPLVALSLVGAVAEKY 237


>gi|85858413|ref|YP_460615.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB]
 gi|85721504|gb|ABC76447.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
          Length = 274

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 19/236 (8%)

Query: 17  CIKTQGKA---SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQS 73
           C+ T G     S +  HY+  V RMK G  + LF+G+  E+ + I  +    R   E   
Sbjct: 23  CVLTVGDRCFLSEEHLHYVRSVQRMKPGSRLSLFDGRGQEYTAVIVDISAE-RALAEIID 81

Query: 74  RSQT--KQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMD 125
           R     + + +  I +  K  ++D+++QK+ E+G+  I P  +  +      +      +
Sbjct: 82  RKSAPERPARITLIQALPKGQKMDFIVQKATELGVDEILPFSSERSIPRLPPEKARLKTE 141

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNC-QIVFADETC--GSENSLEKLH 182
           R R     AA QC    +P I    +   +LK  D +  +++F +E    G ++ L+K  
Sbjct: 142 RWRKIAGEAARQCRRSDVPNIPEIQSFAGILKAADADSLKMIFWEEESRQGLKDLLKKFS 201

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                   +IL+GPEGG  SEE E   +  FV+ +SLG +IL+ +TAAVA +A++Q
Sbjct: 202 GTCIF---SILVGPEGGLTSEEVEAATAAGFVS-VSLGKQILKLETAAVAILAIIQ 253


>gi|320355424|ref|YP_004196763.1| hypothetical protein Despr_3346 [Desulfobulbus propionicus DSM
           2032]
 gi|320123926|gb|ADW19472.1| protein of unknown function DUF558 [Desulfobulbus propionicus DSM
           2032]
          Length = 260

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 107/224 (47%), Gaps = 12/224 (5%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           SG +  ++A VLR+K G  + LF+G+     + +  VGK          R++     V  
Sbjct: 19  SGAEARHIASVLRLKPGQAVELFDGQGQVCAAVLQTVGKHQVTARVTAIRNERPAVSVPL 78

Query: 85  IFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQN---THYNMDRVRTYTISAAEQCD 139
             +   +K  ++D ++QK+ E+G  A  PV++ Y +N     +  +R +   I A +QC 
Sbjct: 79  TLAQCLLKGKKMDLLVQKATELGAQAFMPVVSAYCENHGDRDHQRERWQRIMIEACKQCH 138

Query: 140 ILTLPFIYPPTTLEFL-LKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
                 I P   L+      +DH    + A E  G   +      I H   + + +GPEG
Sbjct: 139 RSNPMAILPVARLDQADFTPYDHR---LAAWE--GERQAALPTRFIDHPGPLCLFLGPEG 193

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           G H ++   L    F TP SLG  ILR +TAA+AA+++VQ + G
Sbjct: 194 GLHDDDLRLLTQWSF-TPFSLGRHILRGETAALAALSIVQYLSG 236


>gi|116747664|ref|YP_844351.1| hypothetical protein Sfum_0215 [Syntrophobacter fumaroxidans MPOB]
 gi|116696728|gb|ABK15916.1| protein of unknown function DUF558 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 254

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 116/249 (46%), Gaps = 14/249 (5%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIR 66
           KR FV+  +  +       D  H++ HVLR++ G+ + L +G  G WL  I   G  ++R
Sbjct: 4   KRFFVERAVPGEGTIDLGVDAAHHIEHVLRLRAGEEVELIDGVGGGWLGAIVEAGTGTVR 63

Query: 67  FKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMG---AIRPVITRYTQNTHY 122
            ++  +     + S ++    +  + +R+D +++++ E+G+    A R   ++Y      
Sbjct: 64  VRITGRLGPPAESSLNLSLALAFSRADRMDLVLRQATEIGVNRFIAFRSRRSQYALTGRA 123

Query: 123 NMDRVRTYTISAAE---QCDILTLPFIYPPTTLEFLLKNWDH-----NCQIVFADETCGS 174
              R+  +   A E   QC  L +P +   + +  LL   +      N   + A E    
Sbjct: 124 AGKRLERWQRIAREAVCQCGRLNVPEMVILSDVRELLAKIEQRERSGNLLRILAFERGNG 183

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           +  ++   A      V + +GPEGG+ SEE E L    F   + LGPRILR +TAA   +
Sbjct: 184 KGIVDLHRAFPQCTEVMVAVGPEGGWSSEEAELLTRNGF-HAVHLGPRILRLETAAAIVL 242

Query: 235 ALVQAICGD 243
           + VQ + GD
Sbjct: 243 SSVQLLWGD 251


>gi|304396754|ref|ZP_07378634.1| protein of unknown function DUF558 [Pantoea sp. aB]
 gi|304355550|gb|EFM19917.1| protein of unknown function DUF558 [Pantoea sp. aB]
          Length = 243

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 119/249 (47%), Gaps = 22/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   PL I ++     D  +++  VLRM  G  + LF+G +  + ++I++V K  R
Sbjct: 3   IPRIYHAEPLDIGSEITLDEDASNHVGRVLRMTAGQRLELFDGTNLTFAAEITHVDKK-R 61

Query: 67  FKVEY-QSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            KV   +S+    +S +      +  +  ++++ IQKS+E+G+  I P+   +++     
Sbjct: 62  VKVSVTESQPDDHESPLHLHLGQVMSRGEKMEFTIQKSIELGVNIITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I    TLE      D   ++        S
Sbjct: 119 LDAERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEADSGLKLNLHPRASHS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLPQ-----PVERVRLLIGPEGGLSADEIAMTAQHDF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|325135519|gb|EGC58137.1| hypothetical protein TIGR00046 [Neisseria meningitidis M0579]
          Length = 241

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 116/225 (51%), Gaps = 25/225 (11%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYV-----GKSIRFKVEYQSRSQTKQSDVQYIFSP 88
           +VLR++  +NI LFNGK     ++++ +     G  I  +    + S    + +Q I S 
Sbjct: 27  NVLRVRPNENITLFNGKGKAHAARLTVLEKRRAGAEILHEETADAESPLNITLIQSISS- 85

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
              +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T
Sbjct: 86  --GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNT 143

Query: 143 LPFIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGG 199
           +P + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG
Sbjct: 144 VPPVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRQ-PSGAIVFMVGPEGG 196

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +  +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 197 WTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|254521669|ref|ZP_05133724.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219719260|gb|EED37785.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 245

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 108/230 (46%), Gaps = 22/230 (9%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           +  ++L  V+R++EGD  +LFNG   ++ + ++  GK  ++ +++   R   +      +
Sbjct: 23  ETANHLVRVMRLREGDACVLFNGDGHDYSATLTVAGKREVQVRIDAVERVDNESPLAITL 82

Query: 86  FSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRT---------YTISAA 135
              I +  ++D ++QK+ E+G+ AI PV     + T   +D  R             SA 
Sbjct: 83  LQGIARGEKMDLILQKATELGVAAIIPV---NAERTEVKLDAARAEKRVAHWNNVVTSAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP--NVAIL 193
            Q     +P +  P +L         +   +  D          +L  +   P   + I 
Sbjct: 140 GQSGRARIPQVGSPLSLAQAAATLPADTLRLTLDP-----QGAHRLSTLDGAPTGGIVIA 194

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+   +++ L +  F   L LGPRILR++TA +AA+A +QA  GD
Sbjct: 195 IGPEGGWSPRDRDQLAAAGF-QGLQLGPRILRTETAGLAAIAALQARLGD 243


>gi|50122843|ref|YP_052010.1| 16S ribosomal RNA methyltransferase RsmE [Pectobacterium
           atrosepticum SCRI1043]
 gi|49613369|emb|CAG76820.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 244

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 114/233 (48%), Gaps = 18/233 (7%)

Query: 21  QGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQ 79
           + + S D  +++  VLRM  G ++ LF+G +  + ++I   GK S+R       + + K+
Sbjct: 18  EAELSDDAANHIGRVLRMNTGQSLQLFDGSNHVFDAEIIAAGKKSVRVSF-TAGKLEDKE 76

Query: 80  SDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTY 130
           S +      +  +  ++++ IQKS+E+G+  I P+++        + DR+       +  
Sbjct: 77  SPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERC-GVKLDADRMEKKISQWQKI 135

Query: 131 TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
            ++A EQ     +P + P  TLE      D+  ++        S N+L        I  V
Sbjct: 136 AVAACEQSGRNCVPLVRPAMTLEAWCAEQDNALKLNLHPRATQSINTLP-----LPIDRV 190

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +LIGPEGG  + E  T+ S    T + LGPR+LR++T A+ AM  +Q   GD
Sbjct: 191 RLLIGPEGGLTATEI-TMTSEHGFTDILLGPRVLRTETTALTAMTALQVRFGD 242


>gi|194100123|ref|YP_002003263.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           NCCP11945]
 gi|240122667|ref|ZP_04735623.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268681265|ref|ZP_06148127.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|193935413|gb|ACF31237.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|268621549|gb|EEZ53949.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
          Length = 241

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRIRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTRLIM------SINRACKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|307132693|ref|YP_003884709.1| hypothetical protein Dda3937_00423 [Dickeya dadantii 3937]
 gi|313104178|sp|P37995|RSME_DICD3 RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|306530222|gb|ADN00153.1| predicted protein [Dickeya dadantii 3937]
          Length = 244

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 113/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQS-RSQTKQSDVQ 83
           S D  +++  VLRM  G  + LF+G +  + ++I   GK    +V Y + +++ ++S + 
Sbjct: 22  SEDAANHVGRVLRMSAGQALQLFDGSNQVFDAEIVQAGKK-NVRVRYAAGQTENRESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     + + +   I+A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERCGVKLDGERLEKKIAQWQKIAIAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    +P I P  TLE      D+  ++        S N+L        +  + +LIG
Sbjct: 141 EQCGRNRVPEIRPVQTLESWCAEPDNGLKLNLHPRAAHSINTLP-----LPVSRIRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  ++E     +  F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 196 PEGGLSADEIAMTATQGF-TDILLGPRVLRTETTALTAITALQVRFGD 242


>gi|251788143|ref|YP_003002864.1| 16S ribosomal RNA methyltransferase RsmE [Dickeya zeae Ech1591]
 gi|247536764|gb|ACT05385.1| protein of unknown function DUF558 [Dickeya zeae Ech1591]
          Length = 244

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 113/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQS-RSQTKQSDVQ 83
           S D  +++  VLRM  G  + LF+G +  + ++I   GK    +V Y + +++ ++S + 
Sbjct: 22  SEDAANHVGRVLRMSAGQALQLFDGSNQVFDAEIIQAGKK-SVRVRYAAGQTENRESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     + + +   I+A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNIITPLLSERCGIKLDGERLEKKISQWQKIAIAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    +P I P  TLE      D+  ++        S N+L        +  + +LIG
Sbjct: 141 EQCGRNRVPEIRPVQTLESWCAESDNGLKLNLHPRATQSINTLP-----LPVSRIRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  ++E     +  F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 196 PEGGLSADEIAMTATQGF-TDILLGPRVLRTETTALTAITALQVRFGD 242


>gi|241759555|ref|ZP_04757658.1| RNA methyltransferase, RsmE family [Neisseria flavescens SK114]
 gi|241320112|gb|EER56473.1| RNA methyltransferase, RsmE family [Neisseria flavescens SK114]
          Length = 241

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 122/248 (49%), Gaps = 18/248 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--- 63
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG    + +    + K   
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNGNGKAYPALPEVLEKRCA 59

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           S+R   E  + +++   ++  + +     R+D+ +QKSVE+G+  IRPVI+         
Sbjct: 60  SVRILREEATDNESP-LNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSG 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + R +   +SA EQ     +P + P  T    L+        +       S N 
Sbjct: 119 ERAEKRVARWQEIVVSACEQSGRNIVPKVLPLMTYAQALQQLPQETAKLLM-----SLNR 173

Query: 178 LEKLHAI-AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +KL  +      V  ++GPEGG+  +E++      F + ++LG R+LR++TA++AA+A 
Sbjct: 174 AQKLSDVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGFQS-VTLGKRVLRTETASLAAIAT 232

Query: 237 VQAICGDW 244
           +Q + GD+
Sbjct: 233 MQTLWGDF 240


>gi|212709359|ref|ZP_03317487.1| hypothetical protein PROVALCAL_00395 [Providencia alcalifaciens DSM
           30120]
 gi|212688271|gb|EEB47799.1| hypothetical protein PROVALCAL_00395 [Providencia alcalifaciens DSM
           30120]
          Length = 243

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++I+   K   F 
Sbjct: 5   RIYHPEPLQINTTISLCDDAANHVGRVLRMTAGQQLELFDGSNHIFNAEITEATKKNVFV 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
               S    ++S +      +  +  ++++ IQKSVE+G+  I P+++         +  
Sbjct: 65  RVLNSTLDDRESPLDIHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLDGERL 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              + + +   I+A EQ     +P I P  +LE      D   +I        S N+L  
Sbjct: 125 EKKLQQWQKIAIAACEQSGRNRIPVIRPVQSLEAWCAENDGAFKINLHPRASESINTLP- 183

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
               A + +V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  +Q  
Sbjct: 184 ----ADLKHVRLLIGPEGGLSADEIAMTANYQF-TDILLGPRVLRTETTALTAITALQVR 238

Query: 241 CGD 243
            GD
Sbjct: 239 LGD 241


>gi|240117029|ref|ZP_04731091.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID1]
 gi|268602715|ref|ZP_06136882.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268586846|gb|EEZ51522.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
          Length = 241

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 116/223 (52%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHTARLTVLEKH-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I H P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTRLIM------SINRACKLGDIRH-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAMQTLWGDF 240


>gi|83814115|ref|YP_446222.1| hypothetical protein SRU_2116 [Salinibacter ruber DSM 13855]
 gi|294508153|ref|YP_003572211.1| hypothetical protein SRM_02338 [Salinibacter ruber M8]
 gi|83755509|gb|ABC43622.1| conserved hypothetical protein TIGR00046 [Salinibacter ruber DSM
           13855]
 gi|294344481|emb|CBH25259.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 239

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 104/215 (48%), Gaps = 13/215 (6%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           ++  +L  VLR + GD++ + +G  G + ++I +VG           R    + D+    
Sbjct: 22  EEARHLRTVLRGEAGDDMTVVDGDGGWYRARIDHVGPDQVVGTITDERDNVGEPDMDVTV 81

Query: 87  SP---IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTL 143
           +     K +R +  ++K+VE+G   + P+ TR T+      +R+R   ++A +QC    L
Sbjct: 82  ALGILKKRSRFETFVEKAVELGARRVVPLRTRRTERDAIREERLRNVMVAAMKQCRRSRL 141

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETC-GSENSLEKLHAIAHIPNVA---ILIGPEGG 199
           P +  P ++E LL       ++V     C   E S+    A A     A   +L+GPEGG
Sbjct: 142 PALAAPQSIEPLLAGDVGETRLV-----CHAGEESVPIQQAAADTRQRASALVLVGPEGG 196

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           +   E E        TP+SLG R LR++TA +AA+
Sbjct: 197 FAPPEVEAAVEA-EATPVSLGARRLRAETAGIAAL 230


>gi|194366854|ref|YP_002029464.1| 16S ribosomal RNA methyltransferase RsmE [Stenotrophomonas
           maltophilia R551-3]
 gi|194349658|gb|ACF52781.1| protein of unknown function DUF558 [Stenotrophomonas maltophilia
           R551-3]
          Length = 245

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 110/228 (48%), Gaps = 18/228 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           +  ++L  V+R++EGD  +LFNG   ++ + ++  GK  ++ +++      T+      +
Sbjct: 23  ETANHLVRVMRLREGDTCVLFNGDGHDYSATLTVAGKREVQVRIDAVQAIDTESPLAITL 82

Query: 86  FSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRT---------YTISAA 135
              I +  ++D ++QK+ E+G+ AI PV     + T   +D  R             SA 
Sbjct: 83  LQGIARGEKMDLILQKATELGVAAIVPV---NAERTEVKLDAARAEKRVAHWNNVVTSAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
            Q     +P + PP +L         +   +  D      + L  L A A    + I IG
Sbjct: 140 GQSGRARIPQVGPPLSLAQAAAALPVDTLRLTLDPQ--GAHRLSTLDA-APGGGIVIAIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+   +++ L +  F   L LGPRILR++TA +AA+A +QA  GD
Sbjct: 197 PEGGWSPRDRDQLAAAGF-QGLQLGPRILRTETAGLAAIAALQARLGD 243


>gi|317493538|ref|ZP_07951959.1| RsmE family RNA methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918481|gb|EFV39819.1| RsmE family RNA methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 243

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 109/229 (47%), Gaps = 18/229 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVE---YQSRSQTKQS 80
           S +  +++  VLRM EG  I LF+G +  +++ I    K ++R KV+    + R      
Sbjct: 21  SEEAANHVGRVLRMSEGHEIQLFDGSNQVFVAHIVAASKKNVRVKVQSGVLEDRESPLHL 80

Query: 81  DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISA 134
            +  + S  +  ++++ IQKS+E+G   I P+I+         +     + + +   I+A
Sbjct: 81  HLGQVIS--RGEKMEFTIQKSIELGASIITPLISERCGVKLDAERMAKKLGQWQKIAIAA 138

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
            EQC    +P I P   LE      D + ++        S N+L        +  V +LI
Sbjct: 139 CEQCGRNVIPEIRPTMLLEQWCAEQDDSLKLNLHPRANASINTLP-----LPVERVRLLI 193

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 194 GPEGGLSADEIAMTAGYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|325127441|gb|EGC50371.1| hypothetical protein TIGR00046 [Neisseria meningitidis N1568]
          Length = 241

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAARLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLADIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|15677755|ref|NP_274919.1| hypothetical protein NMB1925 [Neisseria meningitidis MC58]
 gi|7227182|gb|AAF42254.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|254670885|emb|CBA07409.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|316985547|gb|EFV64494.1| RNA methyltransferase family protein [Neisseria meningitidis
           H44/76]
 gi|325133384|gb|EGC56048.1| hypothetical protein TIGR00046 [Neisseria meningitidis M13399]
 gi|325139579|gb|EGC62119.1| hypothetical protein TIGR00046 [Neisseria meningitidis CU385]
 gi|325143638|gb|EGC65957.1| hypothetical protein TIGR00046 [Neisseria meningitidis M01-240013]
 gi|325200977|gb|ADY96432.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           H44/76]
 gi|325206833|gb|ADZ02286.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M04-240196]
          Length = 241

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAARLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|17228844|ref|NP_485392.1| 16S ribosomal RNA methyltransferase RsmE [Nostoc sp. PCC 7120]
 gi|17130696|dbj|BAB73306.1| alr1349 [Nostoc sp. PCC 7120]
          Length = 235

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 112/241 (46%), Gaps = 13/241 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           S L+R+ +      + Q   +  Q HYL  VLR++EGD  ++ +G    WL+ ++   + 
Sbjct: 2   SQLQRITIAPSQLQQEQVLLTTQQKHYLKRVLRLREGDRFIVMDGLGKWWLANLTE--EQ 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
            +   E   +++   +    I  P K +  D +++   E+G+  I PV++  T    +  
Sbjct: 60  AQVLEELAVKTELPVAITLMIALP-KGSGFDEVVRSCTELGVACIAPVLSDRTLLNPSTQ 118

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD--HNCQIVFADETCGSENSLEK 180
            ++R R     AAEQ +   +P I  P T    + N    H        E    +N L  
Sbjct: 119 KLERWRRIASEAAEQSERAFVPTILEPLTFSDAVNNITAVHRYICEARGEYVHLKNVLTD 178

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           +        V + IGPEGG+   E E   +L F  P+SLG RILR+ TA + A++L+ A 
Sbjct: 179 ISG-----GVVVAIGPEGGWTDRELEEATTLRF-QPVSLGGRILRAVTAPLVALSLISAA 232

Query: 241 C 241
           C
Sbjct: 233 C 233


>gi|225574856|ref|ZP_03783466.1| hypothetical protein RUMHYD_02934 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037930|gb|EEG48176.1| hypothetical protein RUMHYD_02934 [Blautia hydrogenotrophica DSM
           10507]
          Length = 246

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 122/240 (50%), Gaps = 10/240 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS-YVGKSI 65
           +KR F       + +   +G+  +++  VLRM+EG+ + + +G+  E+  +I  +    I
Sbjct: 1   MKRFFAKPEQIDEREIHITGEDVNHIRQVLRMREGEELWVSDGEKKEYHCRIKDFQQDEI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
             ++ Y   S  +     Y+F  + K ++++ +IQK+VE+G   + PV T         +
Sbjct: 61  LLEILYAQESDYELPSRIYLFQGLPKGDKMELIIQKAVELGAFEVIPVATSRCVVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENS 177
                 +R +    +AA+Q   L +P I+P  +L E L  +   + +++  +   G   +
Sbjct: 121 KAAKKQERWQEIARNAAKQSRRLLVPQIHPVCSLREALDYSGSLDVKLLPYELAKGMRQT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L  I    ++ I IGPEGG+  EE E   ++  V P++LG RILR++TA +  ++++
Sbjct: 181 KETLAGIKRGQSIGIFIGPEGGFAPEEVEQAMAVG-VEPITLGKRILRTETAGMTVLSIL 239


>gi|322514739|ref|ZP_08067765.1| 16S rRNA methyltransferase RsmE [Actinobacillus ureae ATCC 25976]
 gi|322119334|gb|EFX91450.1| 16S rRNA methyltransferase RsmE [Actinobacillus ureae ATCC 25976]
          Length = 248

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 39/240 (16%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM EGD I+LF+G +  + + +  VGK         S    ++S++  
Sbjct: 26  SEDATNHVGRVLRMTEGDQIILFDGSNHIFHATLQAVGKKQIIAKIDSSELDNRESNLPI 85

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
               +  + +R+++ IQKSVE+G+  I P+ +         +     + + +   I+A E
Sbjct: 86  HLGQVISRGDRMEFTIQKSVELGVKTITPLCSERCGVKLNDERQDKKLQQWQKIAIAACE 145

Query: 137 QCDILTLPFIYPPTTLEFL-LKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIP 188
           QC    +P I P     F+ L +W            C  ++ + KL       + I  +P
Sbjct: 146 QCGRNEIPEIRP-----FMKLTDW------------CKEQDDMLKLNLHPRAKYTIRQLP 188

Query: 189 NVA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           NV      +LIG EGG  +EE     +  F T + LG R+LR++TA++ A+  +Q   GD
Sbjct: 189 NVPEAGVRLLIGSEGGLSAEEIAMTETEGF-TEVLLGKRVLRTETASLTAITALQVCFGD 247


>gi|291295971|ref|YP_003507369.1| hypothetical protein Mrub_1587 [Meiothermus ruber DSM 1279]
 gi|290470930|gb|ADD28349.1| protein of unknown function DUF558 [Meiothermus ruber DSM 1279]
          Length = 232

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRF 67
           R FV+    I+ Q +  G + H+L  VLR +EGD + +F+GK  E  +++       +R 
Sbjct: 5   RAFVE---SIQPQVELVGREAHHLLDVLRAREGDWLTVFDGKGLEGRARVLQTEPGWVRL 61

Query: 68  KVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY---TQNTHY 122
           +VE  + +  +  Q    Y+ + +K + L  + + + E+G   I P++T++    + +  
Sbjct: 62  QVEETWPASKEPPQPITLYV-ALLKGDHLAEVARAATELGASQIVPILTQHCVVRELSEA 120

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
              R+    + AA+QC+   +P + P   L+ +        +  F  +      +L   H
Sbjct: 121 KRQRLERIVLEAAKQCERAVVPKVQPVLQLKLI-----PPVEQGFVAQP--RTQALLHEH 173

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
                P  A+L GPEGG    E + L +  F TP++LGPRILR++TA VA ++LV A  G
Sbjct: 174 FDPSKPT-ALLTGPEGGLGEAEVQFLQARGF-TPVTLGPRILRAETAPVALLSLVTAAFG 231


>gi|58177000|pdb|1V6Z|A Chain A, Crystal Structure Of Tt1573 From Thermus Thermophilus
 gi|58177001|pdb|1V6Z|B Chain B, Crystal Structure Of Tt1573 From Thermus Thermophilus
 gi|85544471|pdb|2CX8|A Chain A, Crystal Structure Of Methyltransferase With Ligand(Sah)
 gi|85544472|pdb|2CX8|B Chain B, Crystal Structure Of Methyltransferase With Ligand(Sah)
 gi|160286352|pdb|2Z0Y|A Chain A, Crystal Structure Of Ttha0657-Sam Complex
 gi|160286353|pdb|2Z0Y|B Chain B, Crystal Structure Of Ttha0657-Sam Complex
          Length = 228

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 106/210 (50%), Gaps = 24/210 (11%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF- 86
           +  +L  VLR + GD   +F+G+  E L+++  +G  +R++V  + R   ++  V+ +  
Sbjct: 19  ETRHLVEVLRARVGDRFTVFDGER-EALAEVVDLGPPLRYRV-LEERRPEREVGVEVVLY 76

Query: 87  -SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---QNTHYNMDRVRTYTISAAEQCDILT 142
            + +K ++L  +++ + E+G   I+P++TR++   +     + R+R   + AA+Q   + 
Sbjct: 77  VALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEXGEGKLRRLRAVALEAAKQSGRVV 136

Query: 143 LPFIYPPTTLEFLLKNWD----HNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
           +P + PP  L+ + +       H        E    E  L            A+ +GPEG
Sbjct: 137 VPEVLPPIPLKAVPQVAQGLVAHVGATARVREVLDPEKPL------------ALAVGPEG 184

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           G+  EE   L +  F TP+SLG RILR++T
Sbjct: 185 GFAEEEVALLEARGF-TPVSLGRRILRAET 213


>gi|79362513|ref|NP_175422.2| methyltransferase [Arabidopsis thaliana]
 gi|49660069|gb|AAT68325.1| hypothetical protein At1g50000 [Arabidopsis thaliana]
 gi|55740521|gb|AAV63853.1| hypothetical protein At1g50000 [Arabidopsis thaliana]
 gi|332194384|gb|AEE32505.1| ribosomal RNA small subunit methyltransferase E [Arabidopsis
           thaliana]
          Length = 296

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 113/222 (50%), Gaps = 16/222 (7%)

Query: 23  KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSR---SQTK 78
           +  G ++ ++A VLR+K+ D + LFNGK G     I  + K+ + F  +   +    Q  
Sbjct: 70  RVQGSEFWHMAKVLRLKQEDRVELFNGKGGLVEGCIQSIDKTGVDFIAQEDQKVILPQGM 129

Query: 79  QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN-MDRVRTYTISAAEQ 137
           Q  V   F  +K  R D++I+K  E+G  ++ P++T  +     N +DR+   + +AA+Q
Sbjct: 130 QWQVFAAFGTLKGGRADWLIEKCTELGASSVTPLLTERSPIISENRVDRLERVSFAAAKQ 189

Query: 138 CDILTLPFIYPP----TTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           C  L    + PP    T L+ +LK+    C +  A+    ++  L  +++ A   +  ++
Sbjct: 190 CQRLHQMVLNPPIKFGTLLDHILKS--KLCLVATAE----AKPLLNAVNSSAKESSGLLI 243

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           +GPEG +  +E E +      T + LGP  LR +TA +A +A
Sbjct: 244 VGPEGDFTKKEVEMMLEAGG-TAVGLGPHRLRVETATIALLA 284


>gi|266621760|ref|ZP_06114695.1| RNA methyltransferase, RsmE family [Clostridium hathewayi DSM
           13479]
 gi|288866557|gb|EFC98855.1| RNA methyltransferase, RsmE family [Clostridium hathewayi DSM
           13479]
          Length = 245

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 118/224 (52%), Gaps = 14/224 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRFKVEYQSRSQTKQSDVQ 83
           +G   +++ +VLRMK G+ +L+ NG D +++ ++  +   ++  ++   +   T+     
Sbjct: 19  TGPDVNHIKNVLRMKPGEEVLISNGVDKDYVCRLQTITSDAVTAEIVTVTEGGTELPAKF 78

Query: 84  YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
           Y+F  + K+++++++IQK+VE+G+  + PV TR T      +     + R    + SAA+
Sbjct: 79  YLFQGLPKSDKMEFLIQKAVELGVYQVIPVETRRTVVKLDAKKVEAKVRRWNAVSESAAK 138

Query: 137 QCDILTLPFIYPPTTLEFLLK---NWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           Q   L +P +    T +  L     +D N  I+  +   G  ++      I    +  I 
Sbjct: 139 QSKRLIIPEVTGVMTFQEALNYAGGFDKN--IIPFEHAEGMADTKAYFAGIRPGMSCGIF 196

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           IGPEGG+  EE  +  S   V P++LG RILR++TA +A ++++
Sbjct: 197 IGPEGGFEDEEI-SQASEAGVKPVTLGKRILRTETAGLAVLSVL 239


>gi|296134635|ref|YP_003641877.1| protein of unknown function DUF558 [Thiomonas intermedia K12]
 gi|295794757|gb|ADG29547.1| protein of unknown function DUF558 [Thiomonas intermedia K12]
          Length = 236

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 110/210 (52%), Gaps = 19/210 (9%)

Query: 35  VLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFS---PIKT 91
           VLR+KEG+ + +F+G  GEW  ++    +++  +  +   +  +++DV+ + +   P   
Sbjct: 31  VLRLKEGEPVAVFDGTGGEWSGEV-IDPQTLLLRAHH---AVEREADVRVMLAVGMP-AN 85

Query: 92  NRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLPF 145
            R+D +++K+VE+G+ AI+P+ITR +      +     +   +   I+A EQC    +P 
Sbjct: 86  ERMDALVEKAVELGVAAIQPLITRRSVLRLQGERAQRRVAHWQGVAIAACEQCGRNRVPE 145

Query: 146 IYPPTTLEFLLKNW-DHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEE 204
           + P  TL   L++  + N Q+        S  +   L   A   +  ++ GPEGG   +E
Sbjct: 146 VAPVATLSDWLQHLGNDNAQL---HRCVLSPLATNPLRPFASGESGWMVSGPEGGLGEDE 202

Query: 205 KETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              L    F   +SLGPR+LR+DTA +AA+
Sbjct: 203 IALLQRSGFQA-VSLGPRVLRADTAPLAAL 231


>gi|237729877|ref|ZP_04560358.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908483|gb|EEH94401.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 243

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 116/248 (46%), Gaps = 18/248 (7%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   P+   +Q     D  +++  VLRM  G  + LF+G +  + ++I++  K S
Sbjct: 2   RIPRIYHPEPITSGSQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITHASKKS 61

Query: 65  IRFKV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY----- 116
           +  KV   E   R       +  + S  +  ++++ IQKS+E+G+  I P+ +       
Sbjct: 62  VDVKVLNAELDDRESPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKL 119

Query: 117 -TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
            ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S 
Sbjct: 120 DSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  + +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+ 
Sbjct: 180 NTLP-----LPVERIRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|291618768|ref|YP_003521510.1| YggJ [Pantoea ananatis LMG 20103]
 gi|291153798|gb|ADD78382.1| YggJ [Pantoea ananatis LMG 20103]
          Length = 243

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 119/249 (47%), Gaps = 22/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   P+ + ++     D   ++  VLRM  G ++ LF+G +  + ++I++V K  R
Sbjct: 3   IPRIYHSQPVHVGSEITLDEDASGHVGRVLRMTSGQHVELFDGSNLTFAAEITHVDKK-R 61

Query: 67  FKVEY-QSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            KV    S+   ++S +      +  +  ++++ IQKS+E+G+  I P+   +++     
Sbjct: 62  VKVSITASQEDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            ++A EQC    +P I P   LE      +   ++        S
Sbjct: 119 LDAERLAKKIQQWQKIAVAACEQCGRNRVPEIRPAMALEAWCSEAESGLKLNLHPRASHS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLPQ-----PVERVRLLIGPEGGLSTDEIAMTAQHGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|327395101|dbj|BAK12523.1| hypothetical UPF0088 protein YggJ [Pantoea ananatis AJ13355]
          Length = 243

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 119/249 (47%), Gaps = 22/249 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   P+ + ++     D   ++  VLRM  G ++ LF+G +  + ++I++V K  R
Sbjct: 3   IPRIYHSQPVHVGSEITLDEDASGHVGRVLRMTSGQHVELFDGSNLTFAAEITHVDKK-R 61

Query: 67  FKVEY-QSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            KV    S+   ++S +      +  +  ++++ IQKS+E+G+  I P+   +++     
Sbjct: 62  VKVSITASQEDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            ++A EQC    +P I P   LE      +   ++        S
Sbjct: 119 LDAERLAKKIQQWQKIAVAACEQCGRNRVPEIRPAMALEAWCSEAESGLKLNLHPRASHS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLPQ-----PVERVRLLIGPEGGLSADEIAMTAQHGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|242237998|ref|YP_002986179.1| 16S ribosomal RNA methyltransferase RsmE [Dickeya dadantii Ech703]
 gi|242130055|gb|ACS84357.1| protein of unknown function DUF558 [Dickeya dadantii Ech703]
          Length = 244

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 106/228 (46%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM  G  + LF+G +  + ++I   GK          R +  +S +  
Sbjct: 22  SEDAANHVGRVLRMTAGQALQLFDGSNQVFDAEILQTGKKSVCVRYAAGRVEDCESPLHL 81

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV-------RTYTISAA 135
               +  +  ++++ IQKS+E+G+  I P+ +        + DR+       +   ISA 
Sbjct: 82  HLGQVMSRGEKMEFTIQKSIELGVSVITPLFSERC-GVKLDGDRLDKKIAQWQNIAISAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    +P I P  TLE      D+  ++        S N+L        I  + +LIG
Sbjct: 141 EQCGRNRIPEIRPAMTLESWCAESDNGLKLNLHPRATQSINTLS-----LPISRIRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  S E     +  F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 196 PEGGLSSGEIAMTAAQGF-TDILLGPRVLRTETTALTAITALQVRFGD 242


>gi|229019535|ref|ZP_04176352.1| RNA methyltransferase, RsmE [Bacillus cereus AH1273]
 gi|229025777|ref|ZP_04182176.1| RNA methyltransferase, RsmE [Bacillus cereus AH1272]
 gi|228735485|gb|EEL86081.1| RNA methyltransferase, RsmE [Bacillus cereus AH1272]
 gi|228741791|gb|EEL91974.1| RNA methyltransferase, RsmE [Bacillus cereus AH1273]
          Length = 249

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 116/243 (47%), Gaps = 18/243 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T+ +  GD  H++  V+RM  GD+I    NGK  E  +++I+  +V 
Sbjct: 1   MQRYFVEEKHVSETKIRIVGDDVHHIGRVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TAI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL--KNWDHNCQIVFADETCGS 174
            +     ++R++     AAEQ     +P ++ P + + LL   N    C + + +E    
Sbjct: 118 AKKADKKVERLKKIVKEAAEQSHRSEIPEVHAPASFKQLLAMSNEYDVCLVAYEEEAKQG 177

Query: 175 ENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           E S   + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + 
Sbjct: 178 EKSNFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLY 236

Query: 233 AMA 235
           A++
Sbjct: 237 ALS 239


>gi|114777358|ref|ZP_01452355.1| hypothetical protein SPV1_13699 [Mariprofundus ferrooxydans PV-1]
 gi|114552140|gb|EAU54642.1| hypothetical protein SPV1_13699 [Mariprofundus ferrooxydans PV-1]
          Length = 240

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 110/243 (45%), Gaps = 20/243 (8%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW---LSKISYVGKSI 65
           RL ++ PL   T      +  HYL  V+R   GD ++LFNG  GE+   +  +S    S 
Sbjct: 4   RLHLNQPLEAGTTVDLPANLAHYLHTVMRHAVGDTVILFNGHGGEYHAVIDSLSRKAASC 63

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT----- 120
           R    +++  +     V  +    ++ +++ ++QK  E+G       ITR  +++     
Sbjct: 64  RITA-FENIDREMACRVHIVQGACRSEKIETVLQKGTELGAAGFH--ITRSERSSLKLDG 120

Query: 121 ---HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 +DR R     AAEQC    +P ++  T L  +     H   +     T  S   
Sbjct: 121 SKLDARLDRWRKIVTEAAEQCGRTIVPTVHWHTRLSDIPC---HGLGLTLHPHTAASWQQ 177

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +     I     + + +GPEGG+   +  TL    F + ++ GPRILR++TAA A +A +
Sbjct: 178 IRT--EIRESSEITLAVGPEGGWSDADIATLGERGFRS-IAFGPRILRTETAAPALLAAI 234

Query: 238 QAI 240
           QA+
Sbjct: 235 QAV 237


>gi|55980626|ref|YP_143923.1| 16S ribosomal RNA methyltransferase RsmE [Thermus thermophilus HB8]
 gi|55772039|dbj|BAD70480.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 228

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 106/210 (50%), Gaps = 24/210 (11%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF- 86
           +  +L  VLR + GD   +F+G+  E L+++  +G  +R++V  + R   ++  V+ +  
Sbjct: 19  ETRHLVEVLRARVGDRFTVFDGER-EALAEVVDLGPPLRYRV-LEERRPEREVGVEVVLY 76

Query: 87  -SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---QNTHYNMDRVRTYTISAAEQCDILT 142
            + +K ++L  +++ + E+G   I+P++TR++   +     + R+R   + AA+Q   + 
Sbjct: 77  VALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEMGEGKLRRLRAVALEAAKQSGRVV 136

Query: 143 LPFIYPPTTLEFLLKNWD----HNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
           +P + PP  L+ + +       H        E    E  L            A+ +GPEG
Sbjct: 137 VPEVLPPIPLKAVPQVAQGLVAHVGATARVREVLDPEKPL------------ALAVGPEG 184

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           G+  EE   L +  F TP+SLG RILR++T
Sbjct: 185 GFAEEEVALLEARGF-TPVSLGRRILRAET 213


>gi|325131649|gb|EGC54355.1| hypothetical protein TIGR00046 [Neisseria meningitidis M6190]
 gi|325137512|gb|EGC60095.1| hypothetical protein TIGR00046 [Neisseria meningitidis ES14902]
 gi|325141520|gb|EGC63990.1| hypothetical protein TIGR00046 [Neisseria meningitidis 961-5945]
 gi|325199017|gb|ADY94473.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           G2136]
          Length = 241

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLADIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|297852690|ref|XP_002894226.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297340068|gb|EFH70485.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 295

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 109/220 (49%), Gaps = 12/220 (5%)

Query: 23  KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSR---SQTK 78
           +  G ++ ++A VLR+K+ D + LFNGK G     I  + K+ + F  +   +    Q  
Sbjct: 69  RVQGSEFWHMAKVLRLKQEDRVELFNGKGGLVEGCIQSIDKTGVDFIAQEDQKVILPQGI 128

Query: 79  QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN-MDRVRTYTISAAEQ 137
           Q  V   F  +K  R D++++K  E+G  ++ P++T  +     N +DR+   + +AA+Q
Sbjct: 129 QWQVFAAFGTLKGGRADWLVEKCTELGASSVTPLLTERSSIISENRVDRLERVSFAAAKQ 188

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHN--CQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           C  L    + PP   + LL +   +  C +  A+ T      L  +++     +  +++G
Sbjct: 189 CQRLHQMVLNPPIKFDTLLGHISKSKLCLVATAEAT----PLLNAVNSSTKETSGILIVG 244

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           PEG +  +E E +      T + LGP  LR +TA +A +A
Sbjct: 245 PEGDFTKKEVEMMLE-AGSTAVGLGPHRLRVETATIALLA 283


>gi|325201437|gb|ADY96891.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M01-240149]
 gi|325207417|gb|ADZ02869.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           NZ-05/33]
          Length = 241

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAAQLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
            +R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GDRMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFDAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|226311620|ref|YP_002771514.1| hypothetical protein BBR47_20330 [Brevibacillus brevis NBRC 100599]
 gi|226094568|dbj|BAH43010.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 252

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 114/248 (45%), Gaps = 31/248 (12%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV+     + +    GD  H++ +V+R +EG+ I++ +G            G+S R
Sbjct: 1   MQRYFVEPHSFTENELTIVGDDVHHIVNVMRAREGEEIIVSDG-----------AGRSAR 49

Query: 67  FKVEYQSRSQTKQSDVQYIFS----PI---------KTNRLDYMIQKSVEMGMGAIRPVI 113
            K+ Y S  + +   ++ +      PI         K  +L++++QK  E+G  +  P  
Sbjct: 50  AKLVYLSAKEVRAEVMEMLQEERELPIRVTIGQGLPKGEKLEWILQKGTELGAYSFFPFS 109

Query: 114 TRYT------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF 167
           +  T      +     ++R R     AAEQ     LP +  P +   +L+          
Sbjct: 110 SERTIVKLDAKKEAKKLERWRKIVKEAAEQSHRAVLPELLSPVSFREILEAGQSYTHCAI 169

Query: 168 ADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
           A E  GS    + L  +    ++ +L+GPEGG+  EE     S  F+T +SLGPRILR++
Sbjct: 170 AYEKEGSTTIHQVLEEMTASDSLLVLVGPEGGFSPEEVAQAESKGFLT-VSLGPRILRTE 228

Query: 228 TAAVAAMA 235
           TA+   +A
Sbjct: 229 TASQYVLA 236


>gi|161869288|ref|YP_001598455.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria meningitidis
           053442]
 gi|161594841|gb|ABX72501.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 241

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAARLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
             R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GERMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|269137637|ref|YP_003294337.1| hypothetical protein ETAE_0279 [Edwardsiella tarda EIB202]
 gi|267983297|gb|ACY83126.1| conserved hypothetical protein [Edwardsiella tarda EIB202]
 gi|304557702|gb|ADM40366.1| Ribosomal RNA small subunit methyltransferase E [Edwardsiella tarda
           FL6-60]
          Length = 243

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 118/248 (47%), Gaps = 18/248 (7%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKS 64
            + R++   PL I  +     D  +++  VLRM  G  + LF+G +  + ++I S   KS
Sbjct: 2   RIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDGSNRVFDAEIISADKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +R ++ +   +  ++S +      +  +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 62  VRVRLNHVQEAD-RESPLHLHLGQVMSRGEKMEFTIQKSIELGVSVITPLISERC-GVRL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           + +R+       +   I+A EQC    +P I P   LE      D   ++        S 
Sbjct: 120 DAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPAMDLEAWCAEEDDCLRLNLHPRASASI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L +      +  V +LIGPEGG  + E        F T + LGPR+LR++T A+ A+ 
Sbjct: 180 NTLPQ-----PLTRVRLLIGPEGGLSAAEIAMTADYRF-TDILLGPRVLRTETTALTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|229013531|ref|ZP_04170665.1| RNA methyltransferase, RsmE [Bacillus mycoides DSM 2048]
 gi|228747768|gb|EEL97637.1| RNA methyltransferase, RsmE [Bacillus mycoides DSM 2048]
          Length = 249

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 118/244 (48%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E  +++I+  +V 
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TTI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL---KNWDHNCQIVFADETCG 173
            +     ++R++     AAEQ     +P ++ P++ + LL     +D  C + + +E   
Sbjct: 118 AKKADKKVERLKKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYD-VCLVAYEEEAKQ 176

Query: 174 SENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S   + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA +
Sbjct: 177 GEKSNFAKSLATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|126663640|ref|ZP_01734636.1| hypothetical protein FBBAL38_11239 [Flavobacteria bacterium BAL38]
 gi|126624223|gb|EAZ94915.1| hypothetical protein FBBAL38_11239 [Flavobacteria bacterium BAL38]
          Length = 234

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 111/213 (52%), Gaps = 14/213 (6%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY-- 84
           ++  ++  VLR KEGD I + NG    + S+I    +    K E +   +T Q  V +  
Sbjct: 21  EESKHIVKVLRKKEGDTIFITNGLGFLFESEIILASEK---KCEVKIAKETFQEPVAFYT 77

Query: 85  --IFSPIKTN-RLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDIL 141
               +P K N RL++ ++K+ E+G+  I P+I  +++   Y +DR      +A +Q    
Sbjct: 78  HIAVAPTKMNDRLEWFLEKATEIGIDEITPIICDHSERKVYKIDRAEKIIQAAMKQSLHY 137

Query: 142 TLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGY 200
            LP I  PT+L +F+  N++    I   +ET   + S +  + I H   + ILIGPEG +
Sbjct: 138 YLPKINEPTSLSQFVKLNFEGQKFIAHCEET--DKKSFK--NEIKHNEKITILIGPEGDF 193

Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            ++E     +  F+ P++LG   LR++TAA+ A
Sbjct: 194 STKEINLAIANQFI-PVTLGNTRLRTETAALVA 225


>gi|91794324|ref|YP_563975.1| hypothetical protein Sden_2974 [Shewanella denitrificans OS217]
 gi|91716326|gb|ABE56252.1| protein of unknown function DUF558 [Shewanella denitrificans OS217]
          Length = 244

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 108/229 (47%), Gaps = 22/229 (9%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KSIRFKVEYQSRSQTKQSDVQYI 85
           D   ++  VLRM EG+ ++LFNG   ++L+ I+    K+I   +     ++++     ++
Sbjct: 24  DGAAHIGRVLRMSEGEQVMLFNGDGKDYLADITSASKKNITITIISMEDNRSESGLNLHL 83

Query: 86  FSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQC 138
              I + +R+++ IQKSVE+G+  I P+ +         +     +++ +   ISA EQ 
Sbjct: 84  GQVISRGDRMEFTIQKSVELGVNTITPLFSERCGVKLTGERLEKKINQWQKIVISACEQS 143

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI----PNVAILI 194
               +P I P   +    +      ++                H I  +    P V +LI
Sbjct: 144 GRSQVPLIRPAMDVAAWCQEPSQALKLNLHPRAS---------HGIKGLTLENPRVRLLI 194

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG  SEE        F T + LGPR+LR++TA++ A+  +Q   GD
Sbjct: 195 GPEGGLSSEEILMTEQCDF-TDVLLGPRVLRTETASLTAITALQLTFGD 242


>gi|190575526|ref|YP_001973371.1| 16S ribosomal RNA methyltransferase RsmE [Stenotrophomonas
           maltophilia K279a]
 gi|190013448|emb|CAQ47083.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 245

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 109/228 (47%), Gaps = 18/228 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVE-YQSRSQTKQSDVQY 84
           +  ++L  V+R++EGD  +LFNG   ++ + ++  GK  ++ +++  Q+        +  
Sbjct: 23  ETANHLVRVMRLREGDTCVLFNGDGHDYSATLTAAGKREVQVRIDAVQAVDNESPLAITL 82

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRT---------YTISAA 135
           +    +  ++D ++QK+ E+G+ AI PV     + T   +D  R             SA 
Sbjct: 83  LQGIARGEKMDLILQKATELGVSAIVPV---NAERTEVKLDVARAEKRVAHWNNVVTSAC 139

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
            Q     +P +  P +L         +   +  D      + L  L A A    + I IG
Sbjct: 140 GQSGRARIPQVGSPVSLAQAATTLPADTLRLTLDPH--GAHRLSTLDA-APTGGIVIAIG 196

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+   +++ L +  F   L LGPRILR++TA +AA+A +QA  GD
Sbjct: 197 PEGGWSPRDRDQLAAAGF-QGLQLGPRILRTETAGLAAIAALQARLGD 243


>gi|308390021|gb|ADO32341.1| hypothetical protein NMBB_2198 [Neisseria meningitidis alpha710]
 gi|325129462|gb|EGC52292.1| hypothetical protein TIGR00046 [Neisseria meningitidis OX99.30304]
          Length = 241

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQS---DVQYIFSPIK 90
           +VLR++  +NI LF+GK     ++++ + K  R + E      T      ++  I S   
Sbjct: 27  NVLRVRPNENITLFDGKGKAHAARLTVLEKR-RAEAEILHEDTTDNESPLNITLIQSISS 85

Query: 91  TNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILTLP 144
             R+D+ +QKSVE+G+ AI+PVI+         +     + R +   ISA EQ    T+P
Sbjct: 86  GERMDFTLQKSVELGVTAIQPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVP 145

Query: 145 FIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI--LIGPEGGYH 201
            + P     E L K    + +++       S N   KL  I   P+ AI  ++GPEGG+ 
Sbjct: 146 PVLPIIGYREALDKMPSESTKLIM------SINRARKLGDIRQ-PSGAIVFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +E++      F   ++LG RILR++TA +AA+A +Q + GD+
Sbjct: 199 EQEEQQAFDAGF-QAVTLGKRILRTETAPLAALAAMQTLWGDF 240


>gi|293390908|ref|ZP_06635242.1| 16S rRNA methyltransferase RsmE [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951442|gb|EFE01561.1| 16S rRNA methyltransferase RsmE [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 244

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 117/248 (47%), Gaps = 23/248 (9%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           R++   PL   T    S D  +++  VLRM+ GD + LF+G +  + + I+ V  KS+  
Sbjct: 5   RIYHPIPLNQHTTCALSEDGANHVGRVLRMRAGDQLELFDGSNHIYQAVITAVTKKSVEV 64

Query: 68  KV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
            +   ++ +R       +  + S  +  R+++ IQKSVE+G+  I P+   +++     +
Sbjct: 65  DILNRQFDNRESHLTIHLGQVIS--RGERMEFTIQKSVELGVNVITPL---WSERCGVKL 119

Query: 125 DRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           D  R            I+A EQC    +P I P   L+      D   ++        S 
Sbjct: 120 DGERMEKKIQQWQKIAIAACEQCGRNKIPEIRPLMKLQQWCAERDEALKLNLHPRASYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L ++ A      V +LIG EGG   +E        FV  L LG R+LR++TAA+AA+ 
Sbjct: 180 RTLPEIPA----AGVRLLIGSEGGLSPQEIAQTEQQGFVEVL-LGKRVLRTETAAIAAIT 234

Query: 236 LVQAICGD 243
           ++Q   GD
Sbjct: 235 VLQVCFGD 242


>gi|229062009|ref|ZP_04199335.1| RNA methyltransferase, RsmE [Bacillus cereus AH603]
 gi|229169059|ref|ZP_04296775.1| RNA methyltransferase, RsmE [Bacillus cereus AH621]
 gi|228614468|gb|EEK71577.1| RNA methyltransferase, RsmE [Bacillus cereus AH621]
 gi|228717318|gb|EEL68991.1| RNA methyltransferase, RsmE [Bacillus cereus AH603]
          Length = 249

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 118/244 (48%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E  +++I+  +V 
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TTI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL---KNWDHNCQIVFADETCG 173
            +     ++R++     AAEQ     +P ++ P++ + LL     +D  C + + +E   
Sbjct: 118 AKKADKKVERLKKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYD-VCLVAYEEEAKQ 176

Query: 174 SENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S   + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA +
Sbjct: 177 GEKSNFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|153003145|ref|YP_001377470.1| 16S ribosomal RNA methyltransferase RsmE [Anaeromyxobacter sp.
           Fw109-5]
 gi|152026718|gb|ABS24486.1| protein of unknown function DUF558 [Anaeromyxobacter sp. Fw109-5]
          Length = 246

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 102/224 (45%), Gaps = 15/224 (6%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQT-KQSDVQYI 85
           +  HYL  VLR+  G  + +F+G+ G W +++    +++      + R+Q    +++  +
Sbjct: 23  EARHYLRDVLRLGPGAEVEVFDGRGGAWAARVDAAYEALLLG---ERRAQGGAAAEIWLV 79

Query: 86  FSPIKTNRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQCD 139
            +  K  ++D ++QK+ E+G   + P      V+            R R     AA QC 
Sbjct: 80  AALAKGEKMDLVVQKATELGAAGVAPFAAERSVVRLEPDKGEERARRWRRIAEEAARQCG 139

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
              +P +  P  L  +L         +          +LE + A A+    A ++GPEGG
Sbjct: 140 RADVPEVRAPAPLAGVLAALPPGALAIALQPGGPPVLALEPVAARAY----AAIVGPEGG 195

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
               E     +       +LGPR+LR++TAA+ A+AL+QA  GD
Sbjct: 196 LTDVELAACDAAGARR-AALGPRVLRAETAAIVAVALLQARFGD 238


>gi|194472615|ref|ZP_03078599.1| protein YggJ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|197248239|ref|YP_002148008.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|198245476|ref|YP_002217069.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|205358823|ref|ZP_02659413.2| protein YggJ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205359716|ref|ZP_02831876.2| protein YggJ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|207858355|ref|YP_002245006.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|194458979|gb|EDX47818.1| protein YggJ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|197211942|gb|ACH49339.1| protein YggJ [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197939992|gb|ACH77325.1| protein YggJ [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|205331705|gb|EDZ18469.1| protein YggJ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205343320|gb|EDZ30084.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206710158|emb|CAR34514.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|320087526|emb|CBY97291.1| Ribosomal RNA small subunit methyltransferase E 16S rRNA m3U1498
           methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|326624841|gb|EGE31186.1| protein YggJ [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 259

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|238918250|ref|YP_002931764.1| hypothetical protein NT01EI_0287 [Edwardsiella ictaluri 93-146]
 gi|238867818|gb|ACR67529.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 243

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 121/250 (48%), Gaps = 22/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKS 64
            + R++   PL I  +     D  +++  VLRM  G  + LF+G +  + ++I S   K+
Sbjct: 2   RIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDGSNRVFDAEIVSADKKN 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +R +++   R +  +S +      +  +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 62  VRVRLDG-VREEDSESPLHLHLGQVMSRGEKMEFTIQKSIELGVSVITPLISERC-GVRL 119

Query: 123 NMDRV-------RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
           + +R+       +   I+A EQC    +P I P  TLE      D   ++        S 
Sbjct: 120 DAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPIMTLEAWCAEPDDGLRLNLHPRASASI 179

Query: 176 NSLEKLHAIAHIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           N+L        +P   + +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A
Sbjct: 180 NTLP-------LPQHRIRLLIGPEGGLSADEIAMTANHRF-TDILLGPRVLRTETTALTA 231

Query: 234 MALVQAICGD 243
           +  +Q   GD
Sbjct: 232 ITALQVRFGD 241


>gi|227326188|ref|ZP_03830212.1| hypothetical protein PcarcW_02253 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 244

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 113/232 (48%), Gaps = 16/232 (6%)

Query: 21  QGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQ 79
           + + S D  +++  VLRM  G ++ LF+G +  + ++I   GK S+R +     + + K+
Sbjct: 18  EAELSDDAANHVGRVLRMTTGQSLQLFDGSNHVFDAEIIAAGKKSVRVRF-TAGKLEDKE 76

Query: 80  SDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYT 131
           S +      +  +  ++++ IQKS+E+G+  I P+++         +     + + +   
Sbjct: 77  SPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERCGVKLDAERMEKKISQWQKIA 136

Query: 132 ISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA 191
           ++A EQ     +P + P  TLE      D   ++        S N+L        +  V 
Sbjct: 137 VAACEQSGRNCVPLVRPAMTLEAWCAEQDDALKLNLHPRATQSINTLP-----LPVARVR 191

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +LIGPEGG  + E  T+ S    T + LGPR+LR++T A+ AM  +Q   GD
Sbjct: 192 LLIGPEGGLTAGEI-TMTSEHGFTDILLGPRVLRTETTALTAMTALQVRFGD 242


>gi|158320271|ref|YP_001512778.1| hypothetical protein Clos_1236 [Alkaliphilus oremlandii OhILAs]
 gi|158140470|gb|ABW18782.1| protein of unknown function DUF558 [Alkaliphilus oremlandii OhILAs]
          Length = 256

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 122/233 (52%), Gaps = 19/233 (8%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYI 85
           +   +++ VLR+KE D + + +G+  E++  I+ + K+ +   +E + R  T+++ V+ +
Sbjct: 23  EDVKHISKVLRLKEKDIVEICDGESKEYICSIASIHKNEVVLSIE-EERKSTQEASVEVV 81

Query: 86  F--SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT-------QNTHYNMDRVRTYTISAAE 136
                 K  ++D +IQK+ E+G+  I PV+   T       ++    ++R +     AA+
Sbjct: 82  LYQGVPKGAKMDLIIQKTTELGIKEIIPVMMERTVVQFDSPKDEVKKVERWQKIAEEAAK 141

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFA---DETCGSENSLEKL--HAIAHIPNVA 191
           Q     +P I+ P + +  +++   N   +     +E  G +N ++ L     A I  + 
Sbjct: 142 QSKRGMIPKIHLPMSFKDAIEDSRKNALNIMPYENEENRGFKNIIKNLSKEDQASIKKIG 201

Query: 192 ILIGPEGGYHSEEKETLHSLP-FVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           + IGPEGG+  EE E + ++   + P++LGPRILR++TA    ++LV    GD
Sbjct: 202 VWIGPEGGF--EESEVVKAIENGIHPVTLGPRILRTETAGFTMLSLVMYELGD 252


>gi|194442934|ref|YP_002042353.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194737195|ref|YP_002116042.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195873572|ref|ZP_02697636.2| protein YggJ [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197300804|ref|ZP_02661220.2| protein YggJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204928270|ref|ZP_03219470.1| protein YggJ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205357183|ref|ZP_02345767.2| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205359187|ref|ZP_02667829.2| protein YggJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205360780|ref|ZP_02686433.2| protein YggJ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|224584887|ref|YP_002638686.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238909892|ref|ZP_04653729.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|161365422|gb|ABX69190.1| hypothetical protein SPAB_03859 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401597|gb|ACF61819.1| protein YggJ [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408317|gb|ACF68536.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194712697|gb|ACF91918.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633273|gb|EDX51687.1| protein YggJ [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197290907|gb|EDY30261.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204322592|gb|EDZ07789.1| protein YggJ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205323264|gb|EDZ11103.1| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205338220|gb|EDZ24984.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205347043|gb|EDZ33674.1| protein YggJ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|224469415|gb|ACN47245.1| hypothetical protein SPC_3159 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322613491|gb|EFY10432.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322621083|gb|EFY17941.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322624147|gb|EFY20981.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322628114|gb|EFY24903.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633233|gb|EFY29975.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322636189|gb|EFY32897.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322639527|gb|EFY36215.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647540|gb|EFY44029.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648724|gb|EFY45171.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653779|gb|EFY50105.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657885|gb|EFY54153.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663988|gb|EFY60187.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669001|gb|EFY65152.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673005|gb|EFY69112.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678004|gb|EFY74067.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322681180|gb|EFY77213.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322687890|gb|EFY83857.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323194914|gb|EFZ80101.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196665|gb|EFZ81813.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202635|gb|EFZ87675.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207878|gb|EFZ92824.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212570|gb|EFZ97387.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214947|gb|EFZ99695.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323222677|gb|EGA07042.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225420|gb|EGA09652.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230565|gb|EGA14683.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235084|gb|EGA19170.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239123|gb|EGA23173.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244519|gb|EGA28525.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323247134|gb|EGA31100.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253383|gb|EGA37212.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256310|gb|EGA40046.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262514|gb|EGA46070.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323267390|gb|EGA50874.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269206|gb|EGA52661.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 259

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|213023350|ref|ZP_03337797.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213163039|ref|ZP_03348749.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213424112|ref|ZP_03357005.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580648|ref|ZP_03362474.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612784|ref|ZP_03370610.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213648200|ref|ZP_03378253.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213850166|ref|ZP_03381064.1| 16S rRNA m3U1498 methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828647|ref|ZP_06546457.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 259

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLRLNLHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|83746774|ref|ZP_00943822.1| surface protein [Ralstonia solanacearum UW551]
 gi|207744320|ref|YP_002260712.1| hypothetical protein RSIPO_02511 [Ralstonia solanacearum IPO1609]
 gi|83726543|gb|EAP73673.1| surface protein [Ralstonia solanacearum UW551]
 gi|206595725|emb|CAQ62652.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 249

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 125/255 (49%), Gaps = 25/255 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R ++D PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + +  R
Sbjct: 3   LPRFYIDSPLAPHTTVTLPESVARHI-HVLRLAVGDDVQLFDGSGLEFRARLDAINR--R 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKT----NRLDYMIQKSVEMGMGAIRP------VITRY 116
                 + +    ++ +Y  +  +     +++D++I+K+VE+G+ AI P      V+   
Sbjct: 60  DATASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVHAITPLQTERGVVRLS 119

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +    +A EQC    +P + P TTL   L     + +        GS++
Sbjct: 120 GERAAKRVQHWQALVQAACEQCGRARVPAVSPVTTLRDWLTAAKASGRARVMLSPRGSQS 179

Query: 177 -------SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
                  S E++ +      + +LIGPEGG  S ++E+L       PL+LG RILR+++A
Sbjct: 180 LTQWAAQSRERIDST----GIELLIGPEGGL-SPDEESLAEAAGYLPLTLGRRILRTESA 234

Query: 230 AVAAMALVQAICGDW 244
           A+ A++ + A+ G++
Sbjct: 235 ALVAVSALHAVLGEF 249


>gi|16761869|ref|NP_457486.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29143356|ref|NP_806698.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|291084775|ref|ZP_06542159.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
 gi|25345391|pir||AF0877 conserved hypothetical protein STY3247 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504171|emb|CAD02918.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138990|gb|AAO70558.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 243

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 16  TQISLCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 75

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 76  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 134 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLRLNLHPRAHASINTLP-----LPVER 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 189 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|317049423|ref|YP_004117071.1| hypothetical protein Pat9b_3219 [Pantoea sp. At-9b]
 gi|316951040|gb|ADU70515.1| protein of unknown function DUF558 [Pantoea sp. At-9b]
          Length = 243

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 116/250 (46%), Gaps = 22/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R+F   PL + ++     D  +++  VLRM  G  + LF+G +  + ++I+   K  
Sbjct: 2   RIPRIFHPEPLAVNSEVFLDEDAANHVGRVLRMSAGQRLELFDGSNLTFAAEITQADKK- 60

Query: 66  RFKVE-YQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           R KV    S+   ++S +      +  +  ++++ IQKS+E+G+  I P+   +++    
Sbjct: 61  RVKVRVLDSQQDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPL---FSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC    +P I    TLE          ++        
Sbjct: 118 KLDAERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEAADGLKLNLHPRASH 177

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           S N+L +      +  + +LIGPEGG  +EE        F T + LGPR+LR++T A+ A
Sbjct: 178 SINTLPQ-----PVERIRLLIGPEGGLSTEEIAMTAQHGF-TDILLGPRVLRTETTALTA 231

Query: 234 MALVQAICGD 243
           +  +Q   GD
Sbjct: 232 ITALQVRFGD 241


>gi|46198606|ref|YP_004273.1| hypothetical protein TTC0298 [Thermus thermophilus HB27]
 gi|46196229|gb|AAS80646.1| hypothetical conserved protein [Thermus thermophilus HB27]
          Length = 228

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 106/210 (50%), Gaps = 24/210 (11%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF- 86
           +  +L  VLR + GD   +F+G+  E L+++  +G  +R++V  + R   ++  V+ +  
Sbjct: 19  ETRHLVEVLRARVGDRFTVFDGER-EALAEVVDLGPPLRYRV-LEERRPEREVGVEVVLY 76

Query: 87  -SPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---QNTHYNMDRVRTYTISAAEQCDILT 142
            + +K ++L  +++ + E+G   I+P++TR++   +     + R+R   + AA+Q   + 
Sbjct: 77  VALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEMGEGKLRRLRAVALEAAKQSGRVR 136

Query: 143 LPFIYPPTTLEFLLKNWD----HNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
           +P + PP  L+ + +       H        E    E  L            A+ +GPEG
Sbjct: 137 VPEVLPPIPLKAVPQVAQGLVAHVGATARVREVLDPEKPL------------ALAVGPEG 184

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           G+  EE   L +  F TP+SLG RILR++T
Sbjct: 185 GFAEEEVALLEARGF-TPVSLGRRILRAET 213


>gi|319796621|ref|YP_004158261.1| hypothetical protein Varpa_5998 [Variovorax paradoxus EPS]
 gi|315599084|gb|ADU40150.1| protein of unknown function DUF558 [Variovorax paradoxus EPS]
          Length = 246

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 110/216 (50%), Gaps = 17/216 (7%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIFSPIKTN 92
            VLRM+ GD + LF+G  GE+ + I  +G+S +   V      + + +   ++   +  N
Sbjct: 27  QVLRMQPGDALTLFDGAGGEYEATIERMGRSDVSVTVGVHHPVEREATRAVHLAVGMPAN 86

Query: 93  -RLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMDRVRTY----TISAAEQCDILTLPF 145
            R+D++++K+ E+G+ +I+P+ T +   + +    ++ R +     I+A EQC    +P 
Sbjct: 87  ERMDWLVEKATELGVASIQPLATAHGVLRLSGERAEKKRAHWEAIAIAACEQCGRNRVPV 146

Query: 146 IYPPTTLE----FLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP---NVAILIGPEG 198
           I+P  +      ++    D      F          +E   A AH P   +V +L GPEG
Sbjct: 147 IHPVRSFSGNSGWIDAQQDEGATARFVLSLAEGTQGIEAASA-AHAPDNRDVRVLSGPEG 205

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           G  + E++   +  F  P++LG R+LR++TAA+ A+
Sbjct: 206 GLSAAEEQEAIARGF-APVTLGLRVLRAETAALVAL 240


>gi|114331048|ref|YP_747270.1| hypothetical protein Neut_1049 [Nitrosomonas eutropha C91]
 gi|114308062|gb|ABI59305.1| protein of unknown function DUF558 [Nitrosomonas eutropha C91]
          Length = 253

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 117/234 (50%), Gaps = 15/234 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQ 83
           + D  H+   VLR+K+GD ++LF+G  GE+   +  V KS    K+E     + +   + 
Sbjct: 21  NNDTSHHAVQVLRLKQGDPVILFDGTGGEFSGCLVQVRKSACVVKIEQHLPVERESPLML 80

Query: 84  YIFSPIKTN-RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
            +   + TN ++D++IQK+VE G+  I+P+IT  T      +         +   ISA E
Sbjct: 81  TLAQAVCTNEKMDWIIQKAVEQGVIYIQPLITNRTLIRLTGERADKRWQHWQKIIISACE 140

Query: 137 QCDILTLPFIYPPTTL------EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
           QC    +P + P  +L      + L K  + N        +  +   L +L        +
Sbjct: 141 QCGRNRIPQLLPLMSLSHWLEQKLLQKQENSNLSGRDIILSPVARLRLAELSPPESGECI 200

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            +L GPEGG+  EE + +    F+ P+ LG RILR++TAA+AA+A  Q + GD+
Sbjct: 201 TLLTGPEGGFTEEETDAMLHAGFI-PICLGTRILRTETAALAAIAAAQVLWGDY 253


>gi|163816746|ref|ZP_02208109.1| hypothetical protein COPEUT_02936 [Coprococcus eutactus ATCC 27759]
 gi|158448003|gb|EDP24998.1| hypothetical protein COPEUT_02936 [Coprococcus eutactus ATCC 27759]
          Length = 245

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 120/241 (49%), Gaps = 11/241 (4%)

Query: 7   LKRLFVDFP-LCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG-KS 64
           + R FVD     I T  + +G   +++ +VLR+K G+ IL+ +G+  ++  +IS +    
Sbjct: 1   MNRFFVDIDGRDIGTDIEITGGDVNHIKNVLRLKIGEEILVSDGRGRDYTCRISRIDPDK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           +   +E  S +  +      +F    K++++D ++QK VE+G+  I PV T  T      
Sbjct: 61  VVCNIEDISDNFAELPVKVTLFQGYPKSDKMDLIVQKMVELGVCRIVPVFTSRTIVKLDQ 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSEN 176
           +      +R RT   SAA+Q     +P I  P +    L      +  I+  +E  G E 
Sbjct: 121 KKATKKTERYRTIAESAAKQSGRGIVPEITEPVSFAKALDMASELDMNIIPYEEAEGIEE 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S + +  +    ++ I IGPEGG+  EE E   +      ++LG RILR++TA +A MA+
Sbjct: 181 SRQIIANVRGKRSLGIFIGPEGGFAREEVEEAVAAG-AECITLGHRILRTETAGLAVMAI 239

Query: 237 V 237
           +
Sbjct: 240 I 240


>gi|56415032|ref|YP_152107.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363961|ref|YP_002143598.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|229307087|ref|YP_001590023.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|229597264|ref|YP_002047082.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|56129289|gb|AAV78795.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095438|emb|CAR60997.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 16  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 75

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 76  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKKRQQWQK 133

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 134 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LPVER 188

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 189 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|307260690|ref|ZP_07542380.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306869611|gb|EFN01398.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 113/239 (47%), Gaps = 37/239 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM EG+ I+LF+G +  + + +  VGK         S    ++S++  
Sbjct: 21  SEDATNHVGRVLRMTEGEQIILFDGSNHIFHTTLQAVGKKQIIAKIDGSELDNRESNLPI 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQNTHYNMDRVRTYTISAAE 136
               +  + +R+++ IQKSVE+G+  I P+      +    +     + + +   I+A E
Sbjct: 81  HLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIPN 189
           QC    +P I P       L +W            C  ++ + KL       + I  +PN
Sbjct: 141 QCGRNEIPEIRPI----MKLTDW------------CKEQDDMLKLNLHPRAKYTIRQLPN 184

Query: 190 VA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V      +LIG EGG  +EE     +  F T + LG R+LR++TA++AA+  +Q   GD
Sbjct: 185 VPEAGVRLLIGSEGGLSAEEIAMTETQGF-TEVLLGKRVLRTETASLAAITALQVCFGD 242


>gi|205354017|ref|YP_002227818.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205273798|emb|CAR38793.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629130|gb|EGE35473.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 259

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR--T 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        N   N  R +   
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNERLNKRRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|260599273|ref|YP_003211844.1| ribosomal RNA small subunit methyltransferase E [Cronobacter
           turicensis z3032]
 gi|260218450|emb|CBA33577.1| Ribosomal RNA small subunit methyltransferase E [Cronobacter
           turicensis z3032]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 113/246 (45%), Gaps = 14/246 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL + ++     D  +++  VLRM  G  + LF+G +  + ++I+   K  
Sbjct: 2   RIPRIYHPEPLVVGSEIALDEDAANHVGRVLRMSAGQALQLFDGSNQVFAAEITQANKKS 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                  +    ++S +      +  +  ++++ IQKS+E+G+  I P+ +         
Sbjct: 62  VLVNVVSAEEANRESPLFLHLGQVMSRGEKMEFTIQKSIELGVSVITPLFSERCGVKLDE 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N+
Sbjct: 122 ERLNKKLQQWQKIAIAACEQCGRNVVPEIRPAMDLEAWCAEPDTGLKLNLHPRAAHSINT 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +
Sbjct: 182 LPQ-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|290476315|ref|YP_003469219.1| hypothetical protein XBJ1_3337 [Xenorhabdus bovienii SS-2004]
 gi|289175652|emb|CBJ82455.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 123/254 (48%), Gaps = 30/254 (11%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKS 64
            + R++    L ++T+   S +  +++  VLRM  G  + LF+G +  + ++ I    K+
Sbjct: 2   RIPRIYHPERLSVETEIYLSDEAANHVGRVLRMSNGQPLQLFDGSNQVFDAELIEASKKT 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI---------KTNRLDYMIQKSVEMGMGAIRPVITR 115
           I+ ++     +  K SD +   SP+         +  ++++ IQKSVE+G+  I P+++ 
Sbjct: 62  IKVRI-----TDGKLSDHE---SPLNLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSE 113

Query: 116 Y------TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFAD 169
                   +     + + +   ISA EQC    +P I P  +LE      D + ++    
Sbjct: 114 RCGVKLDAERLEKKLQQWKKIVISACEQCGRNCIPEIRPVMSLEAWCAENDGSLKLNLHP 173

Query: 170 ETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
               S N+L        +  + +LIGPEGG  +EE E   +  F T + LGPR+LR++T 
Sbjct: 174 RASQSINTLP-----LPVEKIRLLIGPEGGLSAEEIEMTANHQF-TDILLGPRVLRTETT 227

Query: 230 AVAAMALVQAICGD 243
           A+ A+  +Q   GD
Sbjct: 228 ALTAITALQVRFGD 241


>gi|160940893|ref|ZP_02088233.1| hypothetical protein CLOBOL_05785 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436137|gb|EDP13904.1| hypothetical protein CLOBOL_05785 [Clostridium bolteae ATCC
           BAA-613]
          Length = 249

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 120/226 (53%), Gaps = 12/226 (5%)

Query: 23  KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRFKV-EYQSRSQTKQS 80
           + +G   +++ +VLR+++G+ +L+ +G   ++L +   + G+ +  ++ E +   +   S
Sbjct: 17  RITGSDVNHIKNVLRIRQGEEMLVSDGTGRDYLCQAEEIAGQEVTVRILETEEEGRELPS 76

Query: 81  DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISA 134
            +       K+++++++IQK+VE+G   I PV TR T      +     + R +    SA
Sbjct: 77  RIWLFQGLPKSDKMEFIIQKAVELGAAGIVPVSTRNTVVKLDPKKEEAKVKRWQAIAESA 136

Query: 135 AEQCDILTLPFIYPPTTLEFL---LKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVA 191
           A+Q     +P +    TL+     +++   + +++  +   G + +  +L A     ++A
Sbjct: 137 AKQSKRSLVPRVSGIMTLKEAFDYVESQGFSVRLIPYEHEAGMDGTKTELDAAGPGQDIA 196

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           + IGPEGG+   E E   S   V P+SLG RILR++TA +A ++++
Sbjct: 197 VFIGPEGGFDEREIELALS-KGVRPISLGRRILRTETAGLALLSVL 241


>gi|20807439|ref|NP_622610.1| hypothetical protein TTE0958 [Thermoanaerobacter tengcongensis MB4]
 gi|20515963|gb|AAM24214.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 245

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 120/248 (48%), Gaps = 16/248 (6%)

Query: 7   LKRLFVDFPLCIKTQGK---ASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++++FV+     K +GK     G  +H+L HVLR K GD I++ +  + E L +I  + K
Sbjct: 1   MRKIFVEKG---KIKGKFAYVDGKDFHHLIHVLRYKVGDKIVVSDMAE-EHLGRIEKIEK 56

Query: 64  --SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
             +I F  E    +     +V      +K +++D ++QK  E+G+  I P ++ ++    
Sbjct: 57  DRAILFLEEKMEGNAESPLEVFLFQGILKADKMDLIVQKCTEIGVKRIIPFVSEFSVVDI 116

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
              N    ++R +  +  A +Q     +P I  P + +  ++        +   E    +
Sbjct: 117 KRANIDKKVERWKKISEEACKQSGRNIIPEISAPVSFKEAIEKAMECDLAIIPYEKEEKK 176

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
              E L  +     + I IGPEGG+  +E E   +   V P++LGPRILR++TAA+A  A
Sbjct: 177 RLKEVLKDVEDAKKIGIFIGPEGGFSQKEIEKAINNGIV-PVTLGPRILRAETAAIAVSA 235

Query: 236 LVQAICGD 243
           +V    GD
Sbjct: 236 IVMYQLGD 243


>gi|332162804|ref|YP_004299381.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318604355|emb|CBY25853.1| ribosomal RNA small subunit methyltransferase E [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325667034|gb|ADZ43678.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330858994|emb|CBX69352.1| ribosomal RNA small subunit methyltransferase E [Yersinia
           enterocolitica W22703]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 117/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I  V K  
Sbjct: 2   RIPRIYHPQPLQANTELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIIRVDKKN 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ IQKS+E+G+  I P+   +++     
Sbjct: 62  LIVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVDVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I     L       D + ++        S
Sbjct: 119 LDGERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCTEQDDSLKLNLHPRASNS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----SSLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|32034407|ref|ZP_00134589.1| COG1385: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207721|ref|YP_001052946.1| 16S ribosomal RNA methyltransferase RsmE [Actinobacillus
           pleuropneumoniae L20]
 gi|165975693|ref|YP_001651286.1| 16S ribosomal RNA methyltransferase RsmE [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149504|ref|YP_001968029.1| hypothetical protein APP7_0235 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251645|ref|ZP_07337818.1| hypothetical protein APP6_0849 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303252796|ref|ZP_07338956.1| hypothetical protein APP2_0384 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247218|ref|ZP_07529268.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249446|ref|ZP_07531435.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307251763|ref|ZP_07533666.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307254000|ref|ZP_07535848.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256261|ref|ZP_07538045.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258455|ref|ZP_07540193.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262823|ref|ZP_07544448.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126096513|gb|ABN73341.1| hypothetical protein APL_0233 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875794|gb|ABY68842.1| hypothetical protein APJL_0238 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914635|gb|ACE60887.1| hypothetical protein APP7_0235 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648357|gb|EFL78553.1| hypothetical protein APP2_0384 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302649487|gb|EFL79670.1| hypothetical protein APP6_0849 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306856276|gb|EFM88429.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858520|gb|EFM90587.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860764|gb|EFM92774.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863026|gb|EFM94972.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865225|gb|EFM97124.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867460|gb|EFM99310.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306871838|gb|EFN03557.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 113/239 (47%), Gaps = 37/239 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM EG+ I+LF+G +  + + +  VGK         S    ++S++  
Sbjct: 21  SEDATNHVGRVLRMTEGEQIILFDGSNHIFHATLQAVGKKQIIAKIDGSELDNRESNLPI 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQNTHYNMDRVRTYTISAAE 136
               +  + +R+++ IQKSVE+G+  I P+      +    +     + + +   I+A E
Sbjct: 81  HLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIPN 189
           QC    +P I P       L +W            C  ++ + KL       + I  +PN
Sbjct: 141 QCGRNEIPEIRPIMK----LTDW------------CKEQDDMLKLNLHPRAKYTIRQLPN 184

Query: 190 VA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V      +LIG EGG  +EE     +  F T + LG R+LR++TA++AA+  +Q   GD
Sbjct: 185 VPEAGVRLLIGSEGGLSAEEIAMTETQGF-TEVLLGKRVLRTETASLAAITALQVCFGD 242


>gi|283788532|ref|YP_003368397.1| hypothetical protein ROD_50401 [Citrobacter rodentium ICC168]
 gi|282951986|emb|CBG91713.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 110/245 (44%), Gaps = 18/245 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRF 67
           R++   P+   TQ     D  ++   VLRM  G  + LF+G +  + ++I    K S+  
Sbjct: 5   RIYHPEPVTPGTQISLCEDAANHTGRVLRMGPGQPLQLFDGSNQVFDAEIVLASKKSVEV 64

Query: 68  KV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNT 120
           KV   E   R       +  + S  +  ++++ IQKS+E+G+  I P+ +        N 
Sbjct: 65  KVLRGEIDDRESPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDNE 122

Query: 121 HYNMDRVR--TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
             N  R +     I+A EQC    +P I P   LE      D   ++        S N+L
Sbjct: 123 RLNKKRQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASDSINTL 182

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                   +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  +Q
Sbjct: 183 P-----LPVERVRLLIGPEGGLSAEEIAMTARYQF-TDILLGPRVLRTETTALTAITALQ 236

Query: 239 AICGD 243
              GD
Sbjct: 237 VRFGD 241


>gi|253690071|ref|YP_003019261.1| hypothetical protein PC1_3710 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756649|gb|ACT14725.1| protein of unknown function DUF558 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 244

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 110/228 (48%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
           S D  +++  VLRM  G  + LF+G +  + ++I   GK S+R       + + K+S + 
Sbjct: 22  SDDAANHVGRVLRMNTGQALQLFDGSNHVFDAEIIAAGKKSVRVHF-TAGKLENKESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     +++ +   I+A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERCGVKLDAERMEKKINQWQKIAIAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ     +P + P  TLE      D   ++        S N+L        +  V +LIG
Sbjct: 141 EQSGRNCVPLVRPAMTLEAWCAEQDSALKLNLHPRATQSINTLP-----LPVDRVRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  + E  T+ S    T + LGPR+LR++T A+ AM  +Q   GD
Sbjct: 196 PEGGLTASEI-TMTSEHGFTDILLGPRVLRTETTALTAMTALQVRFGD 242


>gi|197284242|ref|YP_002150114.1| hypothetical protein PMI0341 [Proteus mirabilis HI4320]
 gi|227357855|ref|ZP_03842203.1| protein of hypothetical function DUF558 [Proteus mirabilis ATCC
           29906]
 gi|194681729|emb|CAR40885.1| conserved hypothetical protein [Proteus mirabilis HI4320]
 gi|227161965|gb|EEI46983.1| protein of hypothetical function DUF558 [Proteus mirabilis ATCC
           29906]
          Length = 243

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 115/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKS 64
            + R++   PL   TQ   + +  +++  VLRM +G  + LF+G +  + + I     KS
Sbjct: 2   RIPRIYHPEPLSAGTQTSLAEEAANHVGRVLRMSKGQKLALFDGSNQVFDADIIESSKKS 61

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
           +  ++ E Q   +    D+       +  ++++ IQKSVE+G+  I P+I+         
Sbjct: 62  VIVQINEGQMDDRESPLDLHLGQVLSRGEKMEFTIQKSVELGVNTITPLISERCGVKLDP 121

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  H    ++    ISA EQC    +P + P  +LE      D + ++        S
Sbjct: 122 SRLEKKHQQWQKI---IISACEQCGRNKIPQLMPVMSLEAWCAQTDDSLKLNLHPRASQS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG   EE        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----LPVKKVRLLIGPEGGLSPEEIAMTAKYHF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|238759323|ref|ZP_04620489.1| Ribosomal RNA small subunit methyltransferase E [Yersinia aldovae
           ATCC 35236]
 gi|238702484|gb|EEP95035.1| Ribosomal RNA small subunit methyltransferase E [Yersinia aldovae
           ATCC 35236]
          Length = 261

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 115/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   T+   S +  +++  VLRM EG N+ LF+G +  + ++I    K  
Sbjct: 20  RIPRIYHPQPLQANTELALSDEAANHVGRVLRMMEGQNLQLFDGSNQVFTAEIIRADKKN 79

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 +   + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 80  LIVRIAEGLLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPL---FSERCGVK 136

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I     L       D + ++        S
Sbjct: 137 LDGERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCAEQDDSLKLNLHPRANNS 196

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L      A +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 197 INTLS-----ASLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAI 250

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 251 TALQVRFGD 259


>gi|68248905|ref|YP_248017.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           86-028NP]
 gi|68057104|gb|AAX87357.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae 86-028NP]
          Length = 245

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 123/259 (47%), Gaps = 39/259 (15%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
             KVE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           T+     + + +   I+A EQC   ++P I P   L+    +W            C   +
Sbjct: 121 TERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|229174986|ref|ZP_04302505.1| RNA methyltransferase, RsmE [Bacillus cereus MM3]
 gi|228608447|gb|EEK65750.1| RNA methyltransferase, RsmE [Bacillus cereus MM3]
          Length = 249

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 114/245 (46%), Gaps = 22/245 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDG-----EWLSKISY 60
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK       E  S+  +
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAICSIDEITSE--F 58

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VIT 114
           +  +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++ 
Sbjct: 59  INTAI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVK 115

Query: 115 RYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLL--KNWDHNCQIVFADETC 172
              +     ++R+R     AAEQ     +P ++ P + + LL   N    C + + +E  
Sbjct: 116 WDAKKADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSNEYDVCLVAYEEEAK 175

Query: 173 GSENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
             E S   + L  +     + I+ GPEGG   EE  TL    FV P SLGPRILR++TA 
Sbjct: 176 QGEKSNFAKALTTMKPGQKLLIVFGPEGGLAEEEITTLREHKFV-PCSLGPRILRTETAP 234

Query: 231 VAAMA 235
           + A++
Sbjct: 235 LYALS 239


>gi|227115169|ref|ZP_03828825.1| hypothetical protein PcarbP_19518 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 244

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 112/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQ 83
           S D  +++  VLRM  G ++ LF+G +  + ++I   GK S+R +     + + K+S + 
Sbjct: 22  SDDAANHVGRVLRMTTGQSLQLFDGSNHVFDAEIIAAGKKSVRVRF-TAGKLEDKESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     + + +   I+A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNVITPLLSERCGVKLDAERMEKKISQWQKIAIAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQ     +P + P  TLE      D+  ++        S N+L        +  V +LIG
Sbjct: 141 EQSGRNCVPQVRPAMTLEAWCAEQDNALKLNLHPRATQSINTLP-----LPVARVRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  + E  T+ S    T + LGPR+LR++T A+ AM  +Q   GD
Sbjct: 196 PEGGLTASEI-TMTSEYGFTDILLGPRVLRTETTALTAMTALQVRFGD 242


>gi|15617012|ref|NP_240225.1| hypothetical protein BU410 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681764|ref|YP_002468150.1| 16S rRNA m3U1498 methyltransferase (YggJ) [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
 gi|219682319|ref|YP_002468703.1| 16S rRNA m3U1498 methyltransferase (YggJ) [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|257471466|ref|ZP_05635465.1| 16S rRNA m3U1498 methyltransferase (YggJ) [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|11387295|sp|P57488|RSME_BUCAI RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|25345375|pir||G84977 hypothetical protein [imported] - Buchnera sp. (strain APS)
 gi|10039077|dbj|BAB13111.1| hypothetical protein [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219622052|gb|ACL30208.1| 16S rRNA m3U1498 methyltransferase (YggJ) [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|219624607|gb|ACL30762.1| 16S rRNA m3U1498 methyltransferase (YggJ) [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
 gi|311086144|gb|ADP66226.1| 16S ribosomal RNA methyltransferase RsmE [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
 gi|311086718|gb|ADP66799.1| 16S ribosomal RNA methyltransferase RsmE [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087303|gb|ADP67383.1| 16S ribosomal RNA methyltransferase RsmE [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
 gi|311087813|gb|ADP67892.1| 16S ribosomal RNA methyltransferase RsmE [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 253

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 116/232 (50%), Gaps = 21/232 (9%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S +  HY+  VLRMK  D + +FN     + +KI  + K I     ++   +  +S +  
Sbjct: 30  SDENRHYVTKVLRMKIEDILEIFNNTHYIFFAKIIDISKKIIKIQTFKKILKNLESPLHI 89

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV---------RTYTIS 133
               +  K  ++D+ IQKS+E+G+  I P+   + +N H+   R+             IS
Sbjct: 90  HLGQVISKNEKMDFTIQKSIEIGVKTITPL---FFENDHFQKKRINFSNKIKRWEKIAIS 146

Query: 134 AAEQCDILTLPFI-YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           A  QC+   +P I  P     +   N +++ +I+F  ++  +   L +      I  + I
Sbjct: 147 ACRQCNRNIIPKIKIPMNVFHWCENNQNNDKKIIFHPKSTLTMKCLTE-----PIKYIQI 201

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +IG E G+ ++E + +    F+ P+ LGPRILR++TA+V A+  +Q + GD+
Sbjct: 202 IIGSERGFFNDEFQKIIKYGFI-PIRLGPRILRTETASVVAITALQTMFGDF 252


>gi|145638791|ref|ZP_01794400.1| hypothetical protein CGSHiII_08751 [Haemophilus influenzae PittII]
 gi|145272386|gb|EDK12294.1| hypothetical protein CGSHiII_08751 [Haemophilus influenzae PittII]
 gi|309750281|gb|ADO80265.1| 16S rRNA m3U1498 methyltransferase [Haemophilus influenzae R2866]
          Length = 245

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 123/262 (46%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ I LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCLLSEDAANHVARVLRMTEGEQIELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             KVE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++    
Sbjct: 61  SVKVEILGREVADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC   ++P I P   L+    +W            C 
Sbjct: 118 KLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CA 161

Query: 174 SENSLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGP 221
             +   K  LH  AH        IP   V +LIG EGG  ++E        F T + LG 
Sbjct: 162 ENDGALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGK 220

Query: 222 RILRSDTAAVAAMALVQAICGD 243
           R+LR++TA++AA++ +Q   GD
Sbjct: 221 RVLRTETASLAAISALQICFGD 242


>gi|75911238|ref|YP_325534.1| 16S ribosomal RNA methyltransferase RsmE [Anabaena variabilis ATCC
           29413]
 gi|75704963|gb|ABA24639.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 235

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 13/241 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           S L+R+ +      + Q   +  Q HYL  VLR++EGD  ++ +G    WL++++   + 
Sbjct: 2   SQLQRITIAPSQLQQEQVLLTTQQKHYLKRVLRLREGDRFIVMDGLGKWWLARLTE--EQ 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
            +   E   +++   +    I  P K +  D +++   E+G+  I PV++  T    +  
Sbjct: 60  AQVLEELAVKTELPVAITLMIALP-KGSGFDEVVRSCTELGVACIAPVLSDRTLLNPSPQ 118

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD--HNCQIVFADETCGSENSLEK 180
            ++R R     AAEQ +   +P I  P      + N    H        E    +N L  
Sbjct: 119 KLERWRRIAAEAAEQSERAFVPTILEPVAFSDAVNNVTAFHRYICEARGEYVHLQNLLTD 178

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           +        + I IGPEGG+  +E E   +  F  P+SLG RILR+ TA + A++L+ A 
Sbjct: 179 ISG-----EIVIAIGPEGGWTDKELEEAVTFGF-QPVSLGGRILRAVTAPLVALSLISAA 232

Query: 241 C 241
           C
Sbjct: 233 C 233


>gi|148825417|ref|YP_001290170.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           PittEE]
 gi|229846392|ref|ZP_04466500.1| hypothetical protein CGSHi7P49H1_06965 [Haemophilus influenzae
           7P49H1]
 gi|148715577|gb|ABQ97787.1| hypothetical protein CGSHiEE_01535 [Haemophilus influenzae PittEE]
 gi|229810485|gb|EEP46203.1| hypothetical protein CGSHi7P49H1_06965 [Haemophilus influenzae
           7P49H1]
          Length = 245

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 124/262 (47%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCLLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             KVE   R    K+S+++     +  +  R+++ IQKSVE+G+  I P+   +++    
Sbjct: 61  SVKVEILGRELADKESNLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC   ++P I P   L+    +W            C 
Sbjct: 118 KLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CA 161

Query: 174 SENSLEK--LHAIAH--------IPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGP 221
             +   K  LH  AH        IP+  V +LIG EGG  ++E        F T + LG 
Sbjct: 162 ENDGALKLNLHPRAHYSIKTLPTIPSEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGK 220

Query: 222 RILRSDTAAVAAMALVQAICGD 243
           R+LR++TA++AA+  +Q   GD
Sbjct: 221 RVLRTETASLAAITALQICFGD 242


>gi|300921287|ref|ZP_07137656.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 115-1]
 gi|300411749|gb|EFJ95059.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 115-1]
          Length = 255

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 14  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 73

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 74  VEVKV-LEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 132

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 133 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMVLEAWCAEQDEGLKLNLHPRASNSIN 192

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 193 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 246

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 247 LQVRFGD 253


>gi|261363907|ref|ZP_05976790.1| 16S rRNA methyltransferase RsmE [Neisseria mucosa ATCC 25996]
 gi|288567910|gb|EFC89470.1| 16S rRNA methyltransferase RsmE [Neisseria mucosa ATCC 25996]
          Length = 241

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 113/223 (50%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSDVQYIFSP 88
           +VLR++ G+ ++LFNG    + +++  + K      +  + E  + S  K + VQ + S 
Sbjct: 27  NVLRVRCGEEVVLFNGNGKAYPARLDVLEKRRACAEVLREEETDNESPLKITLVQSVSS- 85

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
               R+D+ +QKSVE+G+ AI+PVI+         +     + R +   +SA EQ     
Sbjct: 86  --GERMDFTLQKSVELGVVAIQPVISERCVVRLSGERADKRVARWQEIVVSACEQSGRNI 143

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI-LIGPEGGYH 201
           +P + P       LK        +       S N  + L A+    +  I ++GPEGG+ 
Sbjct: 144 VPEVRPLLPYREALKQMSSETTKLLM-----SLNRAQSLRAVKPFSDDLIFMVGPEGGWT 198

Query: 202 SEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            EE++      F + ++LG R+LR++TA++AA+A +Q + GD+
Sbjct: 199 DEEEQLAFEAGFQS-VTLGKRVLRTETASLAAIAAMQTLWGDF 240


>gi|148827457|ref|YP_001292210.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           PittGG]
 gi|148718699|gb|ABQ99826.1| hypothetical protein CGSHiGG_04330 [Haemophilus influenzae PittGG]
          Length = 245

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 121/256 (47%), Gaps = 39/256 (15%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+ +        T+ 
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLDTER 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + + +   I+A EQC    +P I P   L+    +W            C   +   
Sbjct: 124 MDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQ----DW------------CAENDGAL 167

Query: 180 K--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
           K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+LR++
Sbjct: 168 KLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTE 226

Query: 228 TAAVAAMALVQAICGD 243
           TA++AA++ +Q   GD
Sbjct: 227 TASLAAISALQICFGD 242


>gi|159030659|emb|CAO88329.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 233

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 109/237 (45%), Gaps = 17/237 (7%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL +DF          + +Q HYL  V+R+K  D  +  NG+   WL++I  +  S    
Sbjct: 4   RLLLDFNTLENGLITLTPEQSHYLKKVVRLKSHDRFIALNGQGQAWLAEI--IDNSAHL- 60

Query: 69  VEYQSRSQTKQSDVQY-IFSPIKTNRLDYMIQKSVEMGMGAIRPVITR--YTQNTHYNMD 125
              ++ ++T +  VQ  +   I  N  D +++ + E+G+  I P++T       +   +D
Sbjct: 61  --LEAINETSELPVQVNLMVAIPKNGFDDIVRAATELGVYRIIPLLTERGLVNPSPQKID 118

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLK---NWDHNCQIVFADETCGSENSLEKLH 182
           R R     A EQ +   +P I  P     +LK   N    C I     T      L +L 
Sbjct: 119 RWRKIAREAVEQSERQIIPIIEEPQPFLAILKRGANPQTTCYIGVTRRTVAP--LLSQLQ 176

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
               I    + IGPEGG+   E E   +  FV P+SLG RILR+ TA + A+A++ A
Sbjct: 177 TSTEI---TMAIGPEGGWTETEIEQAIAADFV-PVSLGKRILRTITAPLVALAIINA 229


>gi|145631448|ref|ZP_01787218.1| hypothetical protein CGSHi22421_06337 [Haemophilus influenzae
           R3021]
 gi|144982985|gb|EDJ90494.1| hypothetical protein CGSHi22421_06337 [Haemophilus influenzae
           R3021]
          Length = 245

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 124/262 (47%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCLLSEDATNHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             KVE   R    K+S+++     +  +  R+++ IQKSVE+G+  I P+   +++    
Sbjct: 61  SVKVEILGRELADKESNLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC   ++P I P   L+    +W            C 
Sbjct: 118 KLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CA 161

Query: 174 SENSLEK--LHAIAH--------IPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGP 221
             +   K  LH  AH        IP+  V +LIG EGG  ++E        F T + LG 
Sbjct: 162 ENDGALKLNLHPRAHYSIKTLPTIPSEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGK 220

Query: 222 RILRSDTAAVAAMALVQAICGD 243
           R+LR++TA++AA+  +Q   GD
Sbjct: 221 RVLRTETASLAAITALQICFGD 242


>gi|229006652|ref|ZP_04164286.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock1-4]
 gi|228754513|gb|EEM03924.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock1-4]
          Length = 249

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 117/243 (48%), Gaps = 18/243 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+         +  GD  H++A V+RM  GD+I    NGK     +++I+  +V 
Sbjct: 1   MQRYFVEEKYVNDASIRIVGDDVHHIARVMRMSVGDHIYCCVNGKTAMCTIAEITSEFVD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  SAI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK-NWDHN-CQIVFADETCGS 174
            +     ++R++     AAEQ     +P ++ P + + LL  N D++ C + + +E    
Sbjct: 118 AKKADKKVERLKKIVKEAAEQSHRSEIPAVHAPASFKQLLAMNSDYDVCLVAYEEEAKQG 177

Query: 175 E--NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           E  N  + L A+     + ++ GPEGG   EE   L    F+ P SLGPRILR++TA + 
Sbjct: 178 EKANFAKALTALERGQKLLVVFGPEGGLSEEEISALREHKFI-PCSLGPRILRTETAPLY 236

Query: 233 AMA 235
           A++
Sbjct: 237 ALS 239


>gi|170765588|ref|ZP_02900399.1| 16S rRNA methyltransferase RsmE [Escherichia albertii TW07627]
 gi|170124734|gb|EDS93665.1| 16S rRNA methyltransferase RsmE [Escherichia albertii TW07627]
          Length = 243

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 115/246 (46%), Gaps = 16/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S+
Sbjct: 3   IPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSV 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
             KV  + R    +S +      +  +  ++++ IQKS+E+G+  I P+ +         
Sbjct: 63  EVKV-LEGRLDDHESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDN 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +  +  + + +   I+A EQC    +P I P  +LE      D   ++        S N+
Sbjct: 122 ERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMSLEAWCAEQDEGLKLNLHPRASNSINT 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +
Sbjct: 182 LP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|221069844|ref|ZP_03545949.1| protein of unknown function DUF558 [Comamonas testosteroni KF-1]
 gi|220714867|gb|EED70235.1| protein of unknown function DUF558 [Comamonas testosteroni KF-1]
          Length = 246

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 115/222 (51%), Gaps = 23/222 (10%)

Query: 34  HVLRMKEGDNILLFNGK------DGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQYIF 86
            VLR + GD I LF G+       GE+ + I+ +G+S +  +V+  S ++ + +   ++ 
Sbjct: 27  QVLRHQPGDIITLFEGQTGNGFTGGEFQATITRMGRSDVGVRVDSHSPAEREAARAVHLV 86

Query: 87  SPIKTN-RLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCD 139
             +  N R+D++++K+ E+G+ +I+PV+   +            ++R ++  +SA EQC 
Sbjct: 87  VGMPANERMDWLVEKATELGVASIQPVMAARSVLKLKGDRADKKIERWQSIAVSACEQCG 146

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADET----CGSENSLEKLHAIAHIPNVAILIG 195
              +P I+ P +L     +W  + Q   AD         E +     A  +   V +L G
Sbjct: 147 RNQVPVIHAPLSL----ADWLRSKQAPAADAARLVLSLREGNQPLRIAAGNAHAVWVLHG 202

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           PEGG  ++E++      +  P SLG R+LR++TA+VA ++L+
Sbjct: 203 PEGGLTAQEEDWALEQGW-KPASLGSRVLRAETASVATLSLL 243


>gi|297621017|ref|YP_003709154.1| putative RNA methyltransferase [Waddlia chondrophila WSU 86-1044]
 gi|297376318|gb|ADI38148.1| putative RNA methyltransferase [Waddlia chondrophila WSU 86-1044]
          Length = 241

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 115/236 (48%), Gaps = 14/236 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R ++D PL + ++    G + H+LAHV R + G+ + L NGK    ++++  + K+    
Sbjct: 5   RFYLDSPLELDSRIAIGGQELHHLAHVSRARAGEEVELINGKGTLAVAEVLEIKKNEASL 64

Query: 69  VEYQSRSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQN---THYNM 124
           + + + S+   +    I   I + NRLD +++K  E+GM  +R    + ++        +
Sbjct: 65  LIHSTISEKPSAFPIIIAQAIPRPNRLDTIVEKCTELGMDELRLFPGKLSEKKDLKESQL 124

Query: 125 DRVRTYTISAAEQCDILTLPFI--YPPTTLEFLLKNW-DHNCQIVFADETCGSENSLEKL 181
            R+    ISAA+Q   L +P I  YPP      +  W   +  + F D +  +    ++ 
Sbjct: 125 ARLTKIAISAAKQSGRLFIPSITFYPP------ISKWPPSDIPLYFGDLSDNAPLFFKRW 178

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +       +A +IGPE G H EE   L  L  +  + L   ILR+DTA + A++L+
Sbjct: 179 NTSPPKQGIAFVIGPESGLHEEEVLQLEKLHAIG-VKLHQNILRTDTAPLTALSLI 233


>gi|114319523|ref|YP_741206.1| hypothetical protein Mlg_0361 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225917|gb|ABI55716.1| 16S rRNA m(3)U-1498 methyltransferase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 248

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 115/252 (45%), Gaps = 28/252 (11%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           R+ VD PL          +   +L    R++ GD ++LF+G+ GE+ +++  +  +  R 
Sbjct: 5   RIHVDTPLAAGATLTLPAETTQHL-KAFRLRPGDELVLFDGRGGEYRARLEALERREARL 63

Query: 68  KV----EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVIT--------- 114
            +      +  S    + VQ +    +  R+D+ +QK+VE+G+  I PV T         
Sbjct: 64  ALLGHHPVERESPLALTLVQGV---ARGERMDFTVQKAVELGVRRIVPVFTDNGVVRLEA 120

Query: 115 RYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFL---LKNWDHNCQIVFADET 171
           R  +    +  RV    ++A EQC    +P + PP  L  +   L   +    +V    T
Sbjct: 121 RRREKRRQHWQRV---AVAACEQCGRNRVPEVAPPRPLAEVWPELAGGEAGQGLVL---T 174

Query: 172 CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            G  +      A   +    +LIGPEGG  S+ +          P+ LGPRILR++TA +
Sbjct: 175 PGGRSLRALADAHPELRRAWLLIGPEGGL-SDAEVARACEAGAEPVGLGPRILRTETAGI 233

Query: 232 AAMALVQAICGD 243
            A+A +Q + GD
Sbjct: 234 TALAALQLLHGD 245


>gi|323452130|gb|EGB08005.1| hypothetical protein AURANDRAFT_14390 [Aureococcus anophagefferens]
          Length = 223

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 96/209 (45%), Gaps = 10/209 (4%)

Query: 28  QYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV---GKSIRFKVEYQSRSQTKQSDVQY 84
           Q+ Y+A V+R++EGD +  F    GEW   +      G ++   V+ +     +   +  
Sbjct: 5   QHRYVATVMRLREGDALRCFGAAMGEWACAVETTTRRGTTVAAAVQTRPPPGDETPRLDL 64

Query: 85  IFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM--DRVRTYTISAAEQCDILT 142
            F+P++  R   +I+K+VE+G   + PV T   +          +    + AAEQC+ L 
Sbjct: 65  YFAPLRKKRTSLLIEKAVELGATRLAPVKTERVERASLAALGAGIHASAVEAAEQCERLR 124

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCG-SENSLEKLHAIAHIPNVAILIGPEGGYH 201
           +P +     L   L +       V A+   G S   L+ L         A+L+GPEGG+ 
Sbjct: 125 VPVVEDVVDLASPLGDLPL---FVCAERADGASPRLLDALLGAELGDGAALLVGPEGGFS 181

Query: 202 SEEKETLH-SLPFVTPLSLGPRILRSDTA 229
             +   +  S P  T +SLG  ILR++TA
Sbjct: 182 DADLAAVRASNPDATFVSLGAGILRAETA 210


>gi|212638681|ref|YP_002315201.1| hypothetical protein Aflv_0838 [Anoxybacillus flavithermus WK1]
 gi|212560161|gb|ACJ33216.1| Uncharacterized protein conserved in bacteria [Anoxybacillus
           flavithermus WK1]
          Length = 252

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 113/244 (46%), Gaps = 15/244 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           L+R FV     +      SGD  H++  V+RM EGD +L  N +    L +I  +    +
Sbjct: 4   LQRYFVRNEQIVGDHVMISGDDVHHIGRVMRMNEGDRLLCCNERSETMLCEIEQISNDFV 63

Query: 66  RFKVEYQSRSQTKQSDVQYIFSP-IKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R ++     +  +     Y+ S  +K ++ + ++QK  E+G     P+IT  +      +
Sbjct: 64  RCRIIQWIEANVELPVHVYVASGLLKGDKYELVLQKGTELGAKGFLPLITSRSIVKWDEK 123

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQ---IVFADETC-GS 174
                ++R +     AAEQ     +P +Y P T+  L+  W H+     I + +E   G 
Sbjct: 124 KGDKKVERWQKIVKEAAEQSHRAYMPSVYAPMTIRELIA-WAHDIHYKCIAYEEEAKEGH 182

Query: 175 ENSLEK-LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
             S    L  +    ++ I+ GPEGG   +E   L    FV   SLGPRILR++TA + A
Sbjct: 183 HRSFAHLLQTMNKEDSLLIVFGPEGGLSEQEVALLKEHGFVA-CSLGPRILRAETAPLYA 241

Query: 234 MALV 237
           ++ V
Sbjct: 242 LSAV 245


>gi|81242430|gb|ABB63140.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 252

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 117/247 (47%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 11  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 70

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ ++       
Sbjct: 71  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSKRCGVKLD 129

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 130 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 189

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 190 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 243

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 244 LQVRFGD 250


>gi|160895341|ref|ZP_02076112.1| hypothetical protein CLOL250_02900 [Clostridium sp. L2-50]
 gi|156863034|gb|EDO56465.1| hypothetical protein CLOL250_02900 [Clostridium sp. L2-50]
          Length = 248

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 123/241 (51%), Gaps = 11/241 (4%)

Query: 7   LKRLFVDFPLCIKTQG-KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG--K 63
           + R FVDF   +  +    +G+  +++ +VLR+K  D I++ +G+  ++  +IS +   K
Sbjct: 1   MNRFFVDFDGRVFDKSIDITGEDVNHIKNVLRLKVNDEIIISDGRGRDYRCQISVMDHEK 60

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            +   ++        ++++       K ++++++IQK+VE+G+  I PV+T+ T      
Sbjct: 61  VVADILDVCDNFAELETEITLFQGFPKADKMEWIIQKTVELGVTRIVPVMTKRTVVKLDA 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSEN 176
           +      +R +   ++AA+Q     +P +  P T  E L    + +  ++  +E  G   
Sbjct: 121 KKAGKKTERYQAIALAAAKQSGRGVIPEVTAPVTWKEALAMAKELDMNMIPYEEAEGVAY 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S E   +I    ++ I IGPEGG+  EE      +     ++LG RILR++TA +A M++
Sbjct: 181 SKEVFASIKGKKSLGIFIGPEGGFAGEEVVAATDMG-AKMVTLGHRILRTETAGMAVMSI 239

Query: 237 V 237
           +
Sbjct: 240 I 240


>gi|161950046|ref|YP_404631.2| 16S ribosomal RNA methyltransferase RsmE [Shigella dysenteriae
           Sd197]
 gi|309785226|ref|ZP_07679857.1| RNA methyltransferase family protein [Shigella dysenteriae 1617]
 gi|308926346|gb|EFP71822.1| RNA methyltransferase family protein [Shigella dysenteriae 1617]
          Length = 243

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 117/247 (47%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ ++       
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSKRCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|145640243|ref|ZP_01795827.1| hypothetical protein CGSHiR3021_09300 [Haemophilus influenzae
           R3021]
 gi|145274829|gb|EDK14691.1| hypothetical protein CGSHiR3021_09300 [Haemophilus influenzae
           22.4-21]
          Length = 245

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 122/259 (47%), Gaps = 45/259 (17%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++     +D
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGVKLD 120

Query: 126 RVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
             R            I+A EQC   ++P I P   L+    +W            C   +
Sbjct: 121 AERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|194431744|ref|ZP_03064035.1| 16S rRNA methyltransferase RsmE [Shigella dysenteriae 1012]
 gi|194420100|gb|EDX36178.1| 16S rRNA methyltransferase RsmE [Shigella dysenteriae 1012]
 gi|320181049|gb|EFW55970.1| Ribosomal RNA small subunit methyltransferase E [Shigella boydii
           ATCC 9905]
 gi|332086875|gb|EGI92011.1| RNA methyltransferase family protein [Shigella boydii 5216-82]
 gi|332087723|gb|EGI92850.1| RNA methyltransferase family protein [Shigella dysenteriae 155-74]
          Length = 243

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 117/246 (47%), Gaps = 16/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S+
Sbjct: 3   IPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSV 62

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
           + KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        +
Sbjct: 63  KVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDS 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N+
Sbjct: 122 ERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEHDEGLKLNLHPRASNSINT 181

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +
Sbjct: 182 LP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITAL 235

Query: 238 QAICGD 243
           Q   GD
Sbjct: 236 QVRFGD 241


>gi|323162608|gb|EFZ48455.1| RNA methyltransferase family protein [Escherichia coli E128010]
          Length = 243

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|194436810|ref|ZP_03068910.1| 16S rRNA methyltransferase RsmE [Escherichia coli 101-1]
 gi|194424292|gb|EDX40279.1| 16S rRNA methyltransferase RsmE [Escherichia coli 101-1]
          Length = 243

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        I  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPIERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|160931277|ref|ZP_02078678.1| hypothetical protein CLOLEP_00114 [Clostridium leptum DSM 753]
 gi|156869755|gb|EDO63127.1| hypothetical protein CLOLEP_00114 [Clostridium leptum DSM 753]
          Length = 242

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 113/228 (49%), Gaps = 14/228 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEW---LSKISYVGKSIRFKVEYQSRSQTKQSD 81
           +G    ++   LRMK GD + L + +  ++   + ++S    ++    ++Q  ++   S 
Sbjct: 17  TGPDAAHMCRSLRMKPGDTVTLCDTQGFDYQCVVQRLSPEEAALTIIDKHQCENEPSLSV 76

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPV-----ITRYT-QNTHYNMDRVRTYTISAA 135
           + Y   P K  ++D+++QK+VE+G+  I PV     ++R   + +    DR +   + AA
Sbjct: 77  ILYQGLP-KGEKMDWIVQKAVELGVSQIVPVRMERCVSRPDGKASQKKTDRWQKIAVEAA 135

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           +QC    LP + PP      L         +F  E  G   S+ +L        V++LIG
Sbjct: 136 KQCGRGILPQVCPPADFHQALIQAAQAEVFLFCYE--GGGESVSRL-ITQKTKTVSVLIG 192

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG+   E E       V P++LG RILR++TA +AA++++    G+
Sbjct: 193 PEGGFSLPEAEAARKAGGV-PVTLGKRILRTETAPLAALSVIMYASGN 239


>gi|261493725|ref|ZP_05990243.1| hypothetical protein COK_2126 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494547|ref|ZP_05991031.1| hypothetical protein COI_0333 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309796|gb|EEY11015.1| hypothetical protein COI_0333 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310615|gb|EEY11800.1| hypothetical protein COK_2126 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 225

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 113/239 (47%), Gaps = 37/239 (15%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRMK+G+ I+LF+G +  + + +  V K         S    ++S++  
Sbjct: 3   SEDAANHVGRVLRMKQGEQIILFDGSNHVFHATLQAVEKKQIIAKIDSSELDDRESNLPI 62

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQNTHYNMDRVRTYTISAAE 136
               +  + +R+++ IQKSVE+G+  I P+      +    +     + + +   I+A E
Sbjct: 63  HLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACE 122

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL-------HAIAHIPN 189
           QC    +P I P       L +W            C  ++ + KL       + I  +PN
Sbjct: 123 QCGRNEIPEIRPIMK----LTDW------------CKEQDDMLKLNLHPRAKYTIRELPN 166

Query: 190 VA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V      +LIG EGG  +EE     S  F T + LG R+LR++TA++AA+  +Q   GD
Sbjct: 167 VPKAGVRLLIGSEGGLSAEEIAMTESEGF-TEVLLGKRVLRTETASLAAITALQVCFGD 224


>gi|167042827|gb|ABZ07545.1| putative protein of unknown function (DUF558) [uncultured marine
           microorganism HF4000_ANIW137I15]
          Length = 261

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 34  HVLRMKEGDNILLFNGKDGEW---LSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI- 89
             +R K GD I + +G+  E+   L+++++ G + R +     R +  +  V        
Sbjct: 27  RAMRHKRGDVIRVSDGEFTEYEVELTELTHQGAAGRIR----GRKEIPEDRVVIRLGQAV 82

Query: 90  -KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCD-IL 141
            K  +LD ++QK+VE+G+  I P+    +      +     + R R    +A +QC+ + 
Sbjct: 83  PKGEKLDGVVQKAVELGVHFIHPIFAERSVPRLDERRAADRLKRWRRVAEAARKQCERVR 142

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK-LHAIAHIPNVAILIGPEGGY 200
            +    P + L FL ++ D + ++V  +    S   L K L     I +VA+L+GPEGG+
Sbjct: 143 PMEVAAPGSLLSFLDESEDADLKVVLHER---STVGLRKILSDTRDIRSVALLVGPEGGF 199

Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
              E +T  +  F+ P  LG RILR++TA +AA+A+++ + GD
Sbjct: 200 SETEVQTARTAGFI-PCGLGTRILRTETAPIAAIAILEYVLGD 241


>gi|197263143|ref|ZP_03163217.1| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|200388493|ref|ZP_03215105.1| protein YggJ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205357558|ref|ZP_02571479.2| protein YggJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|16421647|gb|AAL21969.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197241398|gb|EDY24018.1| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|199605591|gb|EDZ04136.1| protein YggJ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205331209|gb|EDZ17973.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261248225|emb|CBG26062.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|301159649|emb|CBW19168.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914116|dbj|BAJ38090.1| 16S rRNA methyltransferase RsmE [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225767|gb|EFX50821.1| Ribosomal RNA small subunit methyltransferase E [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323131450|gb|ADX18880.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332989961|gb|AEF08944.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 259

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 32  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 91

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRT 129
                 +  + S  +  ++++ IQKS+E+G+  I P+ +        ++  +    + + 
Sbjct: 92  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKRQQWQK 149

Query: 130 YTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN 189
             I+A EQC    +P I PP  LE      D   ++        S N+L        +  
Sbjct: 150 IAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LPVER 204

Query: 190 VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 205 VRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 257


>gi|145636562|ref|ZP_01792230.1| hypothetical protein CGSHiHH_08792 [Haemophilus influenzae PittHH]
 gi|145270387|gb|EDK10322.1| hypothetical protein CGSHiHH_08792 [Haemophilus influenzae PittHH]
          Length = 245

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 122/259 (47%), Gaps = 45/259 (17%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++     +D
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGVKLD 120

Query: 126 RVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
             R            I+A EQC   ++P I P   L+    +W            C   +
Sbjct: 121 AERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|119945034|ref|YP_942714.1| hypothetical protein Ping_1288 [Psychromonas ingrahamii 37]
 gi|119863638|gb|ABM03115.1| hypothetical protein DUF558 [Psychromonas ingrahamii 37]
          Length = 242

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 114/246 (46%), Gaps = 15/246 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R +    L + T+   S D   ++ HVLR++ G  I+LFNG  GE  + ++   K  
Sbjct: 2   RIPRFYDPQTLTVATEVNLSKDAIQHI-HVLRLRPGAQIILFNGLGGEVQATLTSAQKRS 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
              +         +S +      +  + +R++++IQK+VE+G+  I P+++         
Sbjct: 61  CTALINSFNQTDNESPLHLHLGQVISRGDRMEFVIQKAVELGVNEITPLLSERCGVKLDD 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           Q       + +   ++A EQ     +P I+    L    ++ +   ++        S N+
Sbjct: 121 QRMAKKQQQWQKIALAACEQSGRNIIPVIHETEALTTWCESAEQATKLTLHPRAKYSINT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           L        I  + +LIGPEGG   +E     +L F   L LGPRILR++TAA++A+  +
Sbjct: 181 LP-----PEIKRIRLLIGPEGGLSDQEVTLTETLNFTETL-LGPRILRTETAALSAITAL 234

Query: 238 QAICGD 243
           Q   GD
Sbjct: 235 QCRFGD 240


>gi|254360572|ref|ZP_04976721.1| hypothetical protein MHA_0127 [Mannheimia haemolytica PHL213]
 gi|153091112|gb|EDN73117.1| hypothetical protein MHA_0127 [Mannheimia haemolytica PHL213]
          Length = 243

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 119/258 (46%), Gaps = 37/258 (14%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL        S D  +++  VLRMK+G+ I+LF+G +  + + +  V K  
Sbjct: 2   RIPRIYQPQPLAGLQSCVLSEDAANHVGRVLRMKQGEQIILFDGSNHVFHATLQAVEKKQ 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYT 117
                  S    ++S++      +  + +R+++ IQKSVE+G+  I P+      +    
Sbjct: 62  IIAKIDSSELDDRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLND 121

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     + + +   I+A EQC    +P I P       L +W            C  ++ 
Sbjct: 122 ERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMK----LTDW------------CKEQDD 165

Query: 178 LEKL-------HAIAHIPNVA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
           + KL       + I  +PNV      +LIG EGG  +EE     S  F T + LG R+LR
Sbjct: 166 MLKLNLHPRAKYTIRELPNVPKAGVRLLIGSEGGLSAEEIAMTESEGF-TEVLLGKRVLR 224

Query: 226 SDTAAVAAMALVQAICGD 243
           ++TA++AA+  +Q   GD
Sbjct: 225 TETASLAAITALQVCFGD 242


>gi|161353586|ref|NP_462010.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|267995259|gb|ACY90144.1| hypothetical protein STM14_3738 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
          Length = 243

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 109/237 (45%), Gaps = 24/237 (10%)

Query: 20  TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKV---EYQSRS 75
           TQ     D  +++  VLRM  G  + LF+G +  + ++I S   KS+  +V   E   R 
Sbjct: 16  TQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKKSVEVQVMKGEIDDRE 75

Query: 76  QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR------- 128
                 +  + S  +  ++++ IQKS+E+G+  I P+   +++     +D  R       
Sbjct: 76  SPLHIHLGQVMS--RGEKMEFTIQKSIELGVSLITPL---FSERCGVKLDSERLNKKRQQ 130

Query: 129 --TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
                I+A EQC    +P I PP  LE      D   ++        S N+L        
Sbjct: 131 WQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASINTLP-----LP 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 186 VERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|331678938|ref|ZP_08379612.1| 16S rRNA methyltransferase RsmE [Escherichia coli H591]
 gi|332280360|ref|ZP_08392773.1| conserved hypothetical protein [Shigella sp. D9]
 gi|81246842|gb|ABB67550.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|331073768|gb|EGI45089.1| 16S rRNA methyltransferase RsmE [Escherichia coli H591]
 gi|332102712|gb|EGJ06058.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 252

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 11  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 70

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 71  VEVKV-LEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 129

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 130 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 189

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 190 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 243

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 244 LQVRFGD 250


>gi|156932614|ref|YP_001436530.1| hypothetical protein ESA_00396 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530868|gb|ABU75694.1| hypothetical protein ESA_00396 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 114/250 (45%), Gaps = 22/250 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL +  +     D  +++  VLRM  G  + LF+G +  + ++I+   K  
Sbjct: 4   RIPRIYHPEPLVVGREIALDEDAANHVGRVLRMSAGQALQLFDGSNHVFAAEITQASKK- 62

Query: 66  RFKVEYQSRSQTKQSDVQYI-FSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
              V   SR +  +    ++    +  +  ++++ IQKS+E+G+  I P+   +++    
Sbjct: 63  SVLVNVVSREEANRESPLFLHLGQVMSRGEKMEFTIQKSIELGVSVITPL---FSERCGV 119

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC    +P I P   LE      D   ++        
Sbjct: 120 KLDEERLNKKLQQWQKIAIAACEQCGRNVVPEIRPAMELEAWCAEPDSGLKLNLHPRAAH 179

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           S N+L +      +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A
Sbjct: 180 SINTLPQ-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTA 233

Query: 234 MALVQAICGD 243
           +  +Q   GD
Sbjct: 234 ITALQVRFGD 243


>gi|325266078|ref|ZP_08132764.1| 16S rRNA methyltransferase RsmE [Kingella denitrificans ATCC 33394]
 gi|324982716|gb|EGC18342.1| 16S rRNA methyltransferase RsmE [Kingella denitrificans ATCC 33394]
          Length = 241

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 113/222 (50%), Gaps = 18/222 (8%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSDVQYIFSP 88
           HVLR++ GD I+LF+G+     + +  V K     +I   +E  S S  +   +Q + S 
Sbjct: 26  HVLRLQAGDEIVLFDGQGMRVAATLQQVEKRKAACTIDSFLESDSESPLRIHLIQAVSS- 84

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
               R+D+ +QKSVE+G+ +I PV++         +     + R +   +SA EQC    
Sbjct: 85  --GERMDFTLQKSVELGVASITPVLSERCVVRLQGERADKRVQRWQEIAVSACEQCGRDI 142

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           +P + P   L   L+       +        +++  EK  A    P V +LIGPEGG+ +
Sbjct: 143 VPPVRPILRLADYLRQAAAEDGLKLLMSLQNAQSLREKQPA--QRP-VYLLIGPEGGWTA 199

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            E++      F   ++LG RILR++TA++AA+A +Q + GD+
Sbjct: 200 AEEQAAVQAGF-EAITLGKRILRTETASLAAIAAMQTLWGDF 240


>gi|238795147|ref|ZP_04638737.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           intermedia ATCC 29909]
 gi|238725546|gb|EEQ17110.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           intermedia ATCC 29909]
          Length = 243

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 116/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I    K  
Sbjct: 2   RIPRIYHPQPLQANTELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIVRSDKKS 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 62  LLVRLGEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I     L       D + ++        S
Sbjct: 119 LDGERLAKKLQQWQKIAIAACEQCGRNRIPEIRSAMQLSDWCAEQDDSLKLNLHPRASNS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        + NV +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----PTLNNVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|161984861|ref|YP_409378.2| 16S ribosomal RNA methyltransferase RsmE [Shigella boydii Sb227]
 gi|187732729|ref|YP_001881719.1| 16S ribosomal RNA methyltransferase RsmE [Shigella boydii CDC
           3083-94]
 gi|191167926|ref|ZP_03029729.1| 16S rRNA methyltransferase RsmE [Escherichia coli B7A]
 gi|193063533|ref|ZP_03044622.1| 16S rRNA methyltransferase RsmE [Escherichia coli E22]
 gi|193067437|ref|ZP_03048405.1| 16S rRNA methyltransferase RsmE [Escherichia coli E110019]
 gi|194426231|ref|ZP_03058786.1| 16S rRNA methyltransferase RsmE [Escherichia coli B171]
 gi|209920405|ref|YP_002294489.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli SE11]
 gi|218696544|ref|YP_002404211.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli 55989]
 gi|256019252|ref|ZP_05433117.1| 16S ribosomal RNA methyltransferase RsmE [Shigella sp. D9]
 gi|260845616|ref|YP_003223394.1| hypothetical protein ECO103_3526 [Escherichia coli O103:H2 str.
           12009]
 gi|260857079|ref|YP_003230970.1| hypothetical protein ECO26_4045 [Escherichia coli O26:H11 str.
           11368]
 gi|260869633|ref|YP_003236035.1| hypothetical protein ECO111_3694 [Escherichia coli O111:H- str.
           11128]
 gi|293449276|ref|ZP_06663697.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B088]
 gi|300824847|ref|ZP_07104950.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 119-7]
 gi|301306391|ref|ZP_07212460.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 124-1]
 gi|301327362|ref|ZP_07220612.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 78-1]
 gi|307310433|ref|ZP_07590081.1| protein of unknown function DUF558 [Escherichia coli W]
 gi|309794035|ref|ZP_07688460.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 145-7]
 gi|331669689|ref|ZP_08370535.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA271]
 gi|187429721|gb|ACD08995.1| 16S rRNA methyltransferase RsmE [Shigella boydii CDC 3083-94]
 gi|190902011|gb|EDV61757.1| 16S rRNA methyltransferase RsmE [Escherichia coli B7A]
 gi|192930810|gb|EDV83415.1| 16S rRNA methyltransferase RsmE [Escherichia coli E22]
 gi|192959394|gb|EDV89829.1| 16S rRNA methyltransferase RsmE [Escherichia coli E110019]
 gi|194415539|gb|EDX31806.1| 16S rRNA methyltransferase RsmE [Escherichia coli B171]
 gi|209913664|dbj|BAG78738.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218353276|emb|CAU99232.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|257755728|dbj|BAI27230.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760763|dbj|BAI32260.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765989|dbj|BAI37484.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|291322366|gb|EFE61795.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B088]
 gi|300522685|gb|EFK43754.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 119-7]
 gi|300838386|gb|EFK66146.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 124-1]
 gi|300846046|gb|EFK73806.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 78-1]
 gi|306909328|gb|EFN39823.1| protein of unknown function DUF558 [Escherichia coli W]
 gi|308122442|gb|EFO59704.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 145-7]
 gi|315062252|gb|ADT76579.1| 16S rRNA methyltransferase [Escherichia coli W]
 gi|315256838|gb|EFU36806.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 85-1]
 gi|320174058|gb|EFW49228.1| Ribosomal RNA small subunit methyltransferase E [Shigella
           dysenteriae CDC 74-1112]
 gi|320184293|gb|EFW59105.1| Ribosomal RNA small subunit methyltransferase E [Shigella flexneri
           CDC 796-83]
 gi|320202610|gb|EFW77180.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           EC4100B]
 gi|323168002|gb|EFZ53691.1| RNA methyltransferase family protein [Shigella sonnei 53G]
 gi|323180406|gb|EFZ65958.1| RNA methyltransferase family protein [Escherichia coli 1180]
 gi|323183517|gb|EFZ68914.1| RNA methyltransferase family protein [Escherichia coli 1357]
 gi|323377164|gb|ADX49432.1| protein of unknown function DUF558 [Escherichia coli KO11]
 gi|323946556|gb|EGB42579.1| RsmE family protein RNA methyltransferase [Escherichia coli H120]
 gi|324119741|gb|EGC13621.1| RsmE family protein RNA methyltransferase [Escherichia coli E1167]
 gi|331063357|gb|EGI35270.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA271]
 gi|332091330|gb|EGI96418.1| RNA methyltransferase family protein [Shigella boydii 3594-74]
          Length = 243

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|28211650|ref|NP_782594.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium tetani E88]
 gi|28204092|gb|AAO36531.1| conserved surface protein [Clostridium tetani E88]
          Length = 250

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 115/231 (49%), Gaps = 18/231 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSD 81
           +   ++  VLR+   D +++ N +  E+L +ISY+ K     +I+ K++  + S  +   
Sbjct: 21  EDVKHIYKVLRLTTEDEVIINNCEGEEFLGEISYIDKKEVIVNIKEKLDINNESSIQV-- 78

Query: 82  VQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN-----MDRVRTYTISAA 135
             Y+F  + K N++D ++QK+ E+G+  I PVIT       Y      +DR+    I ++
Sbjct: 79  --YLFQGMPKANKMDLIVQKNCELGVREITPVITERVVVKQYGGEYKKLDRLEKIAIESS 136

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIV--FADETCGSENSLEKLHAIAHIPNVAIL 193
           +QC    +P +  P   + LL+       IV  + ++       L        I  + ++
Sbjct: 137 KQCKRTLIPKVNNPVEFKDLLEELKIMDLIVVPYENQQGFGMKKLITKIEKNKIIKIGVV 196

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           IGPEGG+  +E E L  +     ++LGPRILR++TA   A++L+    GD 
Sbjct: 197 IGPEGGFEEDEIEELEKIG-ANIITLGPRILRTETAGFTAVSLLMYELGDL 246


>gi|271502142|ref|YP_003335168.1| hypothetical protein Dd586_3632 [Dickeya dadantii Ech586]
 gi|270345697|gb|ACZ78462.1| protein of unknown function DUF558 [Dickeya dadantii Ech586]
          Length = 244

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 112/228 (49%), Gaps = 16/228 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQS-RSQTKQSDVQ 83
           S D  +++  VLRM  G  + LF+G +  + ++I   GK    +V Y + +++ ++S + 
Sbjct: 22  SEDAANHVGRVLRMSAGQALQLFDGSNQVFEAEIVQAGKK-SVRVRYATGQTEDRESPLH 80

Query: 84  YIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAA 135
                +  +  ++++ IQKS+E+G+  I P+++         +     + + +   I+A 
Sbjct: 81  LHLGQVMSRGEKMEFTIQKSIELGVNIITPLLSERCGVKLDGERLEKKIAQWQKIAIAAC 140

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195
           EQC    +P I P  TLE      D+  ++          N+L        +  + +LIG
Sbjct: 141 EQCGRNRVPDIRPVQTLESWCAESDNGLKLNLHPRASQHINTLP-----LPVSRIRLLIG 195

Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           PEGG  ++E     +  F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 196 PEGGLSADEIAMTATQGF-TDILLGPRVLRTETTALTAITALQVRFGD 242


>gi|324005502|gb|EGB74721.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 57-2]
          Length = 261

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 20  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 79

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 80  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 138

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 139 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 198

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 199 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 252

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 253 LQVRFGD 259


>gi|301027303|ref|ZP_07190649.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 69-1]
 gi|300395109|gb|EFJ78647.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 69-1]
          Length = 255

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 14  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 73

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 74  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 132

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 133 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 192

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 193 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 246

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 247 LQVRFGD 253


>gi|300995473|ref|ZP_07181121.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 200-1]
 gi|300304835|gb|EFJ59355.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 200-1]
          Length = 254

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 13  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 72

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 73  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 131

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 132 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 191

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 192 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 245

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 246 LQVRFGD 252


>gi|222034641|emb|CAP77383.1| UPF0088 protein yggJ [Escherichia coli LF82]
 gi|312947477|gb|ADR28304.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O83:H1
           str. NRG 857C]
          Length = 243

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 118/247 (47%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E   + +L   T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEI-AMTALYQFTDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|94501841|ref|ZP_01308353.1| hypothetical protein RED65_14462 [Oceanobacter sp. RED65]
 gi|94426062|gb|EAT11058.1| hypothetical protein RED65_14462 [Oceanobacter sp. RED65]
          Length = 241

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 115/227 (50%), Gaps = 23/227 (10%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEY---QSRSQTKQSDVQYIF 86
           H++  VLRM+ G  + +FNG    +    + +  + R KV+    +S + + +S +    
Sbjct: 26  HHVGKVLRMEAGRQLKVFNGSGHRYFD--ATIVHADRKKVQVRLGESHASSTESPLSIHL 83

Query: 87  SPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRT-------YTISAAEQ 137
             +  K +++++ IQK+VE+G+  I P+ + +  +   N +R+           ISA EQ
Sbjct: 84  GQVMSKGDKMEFTIQKAVELGVTDITPLWSEHC-DVKLNQERLEKKHKQWLGIIISACEQ 142

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPE 197
                +P ++P   +E  L N + + + +        +   E L +     +VAI +GPE
Sbjct: 143 SGRDVIPHLHPTIKIEDWLANMETDVKWLL-------DPGAEPLQSKVAPKSVAIAVGPE 195

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GG+   E +      F + L +GPR+LR++TAA+ A+ ++Q+  GD+
Sbjct: 196 GGFSEGEVKLAQQQGFQSQL-IGPRVLRTETAALTAITILQSRWGDF 241


>gi|224369186|ref|YP_002603350.1| hypothetical protein HRM2_20880 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691903|gb|ACN15186.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 250

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 117/252 (46%), Gaps = 23/252 (9%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R ++        +   +G +  +L  VLR+  GD + L +G+     ++I  +  +  
Sbjct: 1   MRRFYIKTDSICNGRAVITGQEARHLGTVLRLGPGDRVELVDGRGTIARAEIETLSHNTA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                 S S   +S V    +   +K  ++D +++   E+G+    P  +  +      +
Sbjct: 61  VFTILDSSSPGAESPVHITLAQGMLKDKKMDMLVRHLTELGICQWIPFYSSRSIPKPDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK-NWDHNCQIVFADETCGSENS 177
             +  M+R       A +QC    LP I  P   + LLK + D++ +I F       EN+
Sbjct: 121 RIYSRMERWNKIAREALKQCGRSMLPLIEDPIPFDQLLKTSTDYDGKIAFW------ENA 174

Query: 178 LEKLHAIAHIPN------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
              +H I   P+      + +LIGPEGG+ S E +      F +  SLGPRILR++TA++
Sbjct: 175 TAPIHTI-QTPSMEPAKKIIVLIGPEGGFSSFEIDAARENGFSS-CSLGPRILRAETASL 232

Query: 232 AAMALVQAICGD 243
            A ALVQ + GD
Sbjct: 233 TAAALVQYLFGD 244


>gi|215488244|ref|YP_002330675.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266316|emb|CAS10747.1| 16S rRNA methyltransferase [Escherichia coli O127:H6 str. E2348/69]
          Length = 243

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVISRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|237706401|ref|ZP_04536882.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|254037995|ref|ZP_04872053.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|331643639|ref|ZP_08344770.1| 16S rRNA methyltransferase RsmE [Escherichia coli H736]
 gi|331648701|ref|ZP_08349789.1| 16S rRNA methyltransferase RsmE [Escherichia coli M605]
 gi|331654458|ref|ZP_08355458.1| 16S rRNA methyltransferase RsmE [Escherichia coli M718]
 gi|331674427|ref|ZP_08375187.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA280]
 gi|12517492|gb|AAG58077.1|AE005525_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26109775|gb|AAN81980.1|AE016766_68 Hypothetical protein yggJ [Escherichia coli CFT073]
 gi|882475|gb|AAA69113.1| ORF_o252 [Escherichia coli str. K-12 substr. MG1655]
 gi|13363294|dbj|BAB37245.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91073902|gb|ABE08783.1| hypothetical protein UTI89_C3335 [Escherichia coli UTI89]
 gi|209760100|gb|ACI78362.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760102|gb|ACI78363.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760104|gb|ACI78364.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760106|gb|ACI78365.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|226839619|gb|EEH71640.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226899441|gb|EEH85700.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|281602283|gb|ADA75267.1| hypothetical protein SFxv_3218 [Shigella flexneri 2002017]
 gi|331037110|gb|EGI09334.1| 16S rRNA methyltransferase RsmE [Escherichia coli H736]
 gi|331042448|gb|EGI14590.1| 16S rRNA methyltransferase RsmE [Escherichia coli M605]
 gi|331047840|gb|EGI19917.1| 16S rRNA methyltransferase RsmE [Escherichia coli M718]
 gi|331068521|gb|EGI39916.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA280]
          Length = 252

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 11  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 70

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 71  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 129

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 130 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 189

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 190 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 243

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 244 LQVRFGD 250


>gi|194290708|ref|YP_002006615.1| 16S ribosomal RNA methyltransferase rsme [Cupriavidus taiwanensis
           LMG 19424]
 gi|193224543|emb|CAQ70554.1| conserved hypothetical protein, DUF558 [Cupriavidus taiwanensis LMG
           19424]
          Length = 253

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 111/233 (47%), Gaps = 30/233 (12%)

Query: 33  AHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKT- 91
           A VLR+  GD I LF+G+ G   + +  +GK         + ++    D      P +  
Sbjct: 30  AQVLRLAPGDAITLFDGRGGSHAATLVELGK-------RHALARIGAHDAAEAEPPFRVT 82

Query: 92  --------NRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQ 137
                   +++D++I+K+VE+G+ AI+P      V+    +         +    +A EQ
Sbjct: 83  LAQGLAGGDKMDWLIEKAVELGVAAIQPLQASRSVVRLSGERAQKRQSHWQALVQAACEQ 142

Query: 138 CDILTLPFIYPPTTLEFLL----KNWDHNCQIVFADETCGSENSL--EKLHAIAHIPNVA 191
           C    LP +   T L+  L    ++ +   +++ +     +  +L  E+  A+     V 
Sbjct: 143 CGRNRLPAVAEVTNLDTWLARVAQSGNGGTRLLLSPRAAQALPALVAERREAL-LADGVT 201

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +LIGPEGG   EE++      F T +SLGPRILR++TA +A +A + A+ G +
Sbjct: 202 LLIGPEGGLAPEEEQAALQAGF-TGVSLGPRILRTETAGLACLATLNALLGGF 253


>gi|146312989|ref|YP_001178063.1| 16S ribosomal RNA methyltransferase RsmE [Enterobacter sp. 638]
 gi|145319865|gb|ABP62012.1| 16S rRNA m(3)U-1498 methyltransferase [Enterobacter sp. 638]
          Length = 243

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 108/229 (47%), Gaps = 18/229 (7%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKV---EYQSRSQTKQS 80
           S D  +++  VLRM  G  + LF+G +  + ++I+   K S++  +   E   R      
Sbjct: 21  SDDAANHVGRVLRMGAGQAVQLFDGSNQVFDAEITRADKKSVQVSILRGEVDDRESPLHI 80

Query: 81  DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISA 134
            +  + S  +  ++++ IQKS+E+G+  I P+ +         +  +  + + +   I+A
Sbjct: 81  HLGQVMS--RGEKMEFTIQKSIELGVSLITPLFSERCGVKLDAERLNKKIQQWQKIAIAA 138

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194
            EQC    +P I PP  LE      +   ++        S N+L        +  V +LI
Sbjct: 139 CEQCGRNRIPEIRPPMDLEAWCAEEESGLKLNLHPRASASINTLP-----LPVERVRLLI 193

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 194 GPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|305666561|ref|YP_003862848.1| hypothetical protein FB2170_09846 [Maribacter sp. HTCC2170]
 gi|88708830|gb|EAR01065.1| hypothetical protein FB2170_09846 [Maribacter sp. HTCC2170]
          Length = 235

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 108/221 (48%), Gaps = 12/221 (5%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S ++ +++  VLR KE D +L+ NGK   + +KI         K + Q  S TK+    Y
Sbjct: 19  SPEESNHIIKVLRKKEDDILLITNGKGYMFEAKIILANAK---KCKAQITSTTKKHRKMY 75

Query: 85  IF----SPIKTN-RLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCD 139
            F    +P K+N R ++ ++K+ E+G+  I P+I   ++      +R+     SA +Q  
Sbjct: 76  WFHLVVAPTKSNDRFEWFLEKATEIGVDEITPIICDNSERKIIKPERMEKVLQSAMKQSL 135

Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGG 199
              LP + P  + +  + N       +     C  E  LE    +A   +V +LIGPEG 
Sbjct: 136 QAYLPKLNPAVSYKEFMGNSREGLLFI---AHCDEEEKLELKRRVAPDKDVTVLIGPEGD 192

Query: 200 YHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           +  +E E+ +   ++ P+SLG   LR++TAA+ A   V  I
Sbjct: 193 FSRKEIESAYENGYL-PVSLGRNRLRTETAAIVACTTVNLI 232


>gi|188496461|ref|ZP_03003731.1| 16S rRNA methyltransferase RsmE [Escherichia coli 53638]
 gi|218701656|ref|YP_002409285.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli IAI39]
 gi|254162856|ref|YP_003045964.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli B str.
           REL606]
 gi|301027729|ref|ZP_07191039.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 196-1]
 gi|331684573|ref|ZP_08385165.1| 16S rRNA methyltransferase RsmE [Escherichia coli H299]
 gi|188491660|gb|EDU66763.1| 16S rRNA methyltransferase RsmE [Escherichia coli 53638]
 gi|218371642|emb|CAR19481.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|242378472|emb|CAQ33256.1| 16S rRNA m[3]U1498 methyltransferase monomer, subunit of 16S rRNA
           m[3]U1498 methyltransferase [Escherichia coli BL21(DE3)]
 gi|253974757|gb|ACT40428.1| hypothetical protein ECB_02776 [Escherichia coli B str. REL606]
 gi|253978923|gb|ACT44593.1| hypothetical protein ECD_02776 [Escherichia coli BL21(DE3)]
 gi|299879165|gb|EFI87376.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 196-1]
 gi|309703301|emb|CBJ02637.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|323936051|gb|EGB32346.1| RsmE family protein RNA methyltransferase [Escherichia coli E1520]
 gi|323966463|gb|EGB61896.1| RsmE family protein RNA methyltransferase [Escherichia coli M863]
 gi|323971707|gb|EGB66935.1| RsmE family protein RNA methyltransferase [Escherichia coli TA007]
 gi|323978759|gb|EGB73840.1| RsmE family protein RNA methyltransferase [Escherichia coli
           TW10509]
 gi|327251714|gb|EGE63400.1| RNA methyltransferase family protein [Escherichia coli STEC_7v]
 gi|331078188|gb|EGI49394.1| 16S rRNA methyltransferase RsmE [Escherichia coli H299]
 gi|332344845|gb|AEE58179.1| RNA methyltransferase [Escherichia coli UMNK88]
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|322834233|ref|YP_004214260.1| hypothetical protein Rahaq_3541 [Rahnella sp. Y9602]
 gi|321169434|gb|ADW75133.1| protein of unknown function DUF558 [Rahnella sp. Y9602]
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 105/227 (46%), Gaps = 14/227 (6%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQY 84
           S D  +++  VLRM+ G  I LF+G +  + + I+ V K        Q      +S +  
Sbjct: 21  SEDAANHVGRVLRMQPGQAIQLFDGSNQVFEASITQVDKKSVSVSLNQGVLADNESPLNL 80

Query: 85  IFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAE 136
               +  +  ++++ IQKS+E+G+  I P+ +         +     + + +   I+A E
Sbjct: 81  HLGQVISRGEKMEFTIQKSIELGVNTITPLFSERCGVKLDGERLEKKLQQWQKIAIAACE 140

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC    +P I P   LE      D + ++        S N+L        + +V +LIGP
Sbjct: 141 QCGRNRIPEIRPAMQLEAWCNEQDDSLKLNLHPRASHSINTLP-----LPVSHVRLLIGP 195

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           EGG  +EE        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 196 EGGLSAEEIAMTSGYGF-TDILLGPRVLRTETTALTAITALQVRFGD 241


>gi|238785646|ref|ZP_04629623.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           bercovieri ATCC 43970]
 gi|238713425|gb|EEQ05460.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           bercovieri ATCC 43970]
          Length = 253

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 116/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   ++   S +  +++  VLRM EG ++ LF+G +  + +KI    K  
Sbjct: 12  RIPRIYHPQPLQANSELALSDEAANHVGRVLRMAEGQSLQLFDGSNQVFDAKIIRADKKS 71

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 72  LVVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPL---FSERCGVK 128

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC   T+P I     L       D + ++        S
Sbjct: 129 LDGERLAKKIQQWQKIAIAACEQCGRNTIPEIRAAMQLADWCAEQDDSLKLNLHPRASNS 188

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 189 INTLP-----PSLNKVRLLIGPEGGLSADEITMTSRLGF-TDILLGPRVLRTETTALTAI 242

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 243 TALQVRFGD 251


>gi|218550193|ref|YP_002383984.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia fergusonii
           ATCC 35469]
 gi|218357734|emb|CAQ90378.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPDPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|145632547|ref|ZP_01788281.1| hypothetical protein CGSHi3655_01994 [Haemophilus influenzae 3655]
 gi|144986742|gb|EDJ93294.1| hypothetical protein CGSHi3655_01994 [Haemophilus influenzae 3655]
          Length = 245

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 122/259 (47%), Gaps = 45/259 (17%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++     +D
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGVKLD 120

Query: 126 RVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
             R            I+A EQC   ++P I P   L+    +W            C   +
Sbjct: 121 AERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|30064262|ref|NP_838433.1| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 2a str.
           2457T]
 gi|38704129|ref|NP_311849.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. Sakai]
 gi|56480218|ref|NP_708711.2| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 2a str.
           301]
 gi|89109723|ref|AP_003503.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|90111515|ref|NP_417421.4| 16S rRNA m(3)U1498 methyltransferase, SAM-dependent [Escherichia
           coli str. K-12 substr. MG1655]
 gi|110643095|ref|YP_670825.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli 536]
 gi|110806854|ref|YP_690374.1| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 5 str.
           8401]
 gi|117625173|ref|YP_854161.1| hypothetical protein APECO1_3575 [Escherichia coli APEC O1]
 gi|157156709|ref|YP_001464298.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli E24377A]
 gi|157162405|ref|YP_001459723.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli HS]
 gi|161367531|ref|NP_289518.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           EDL933]
 gi|161486126|ref|NP_755407.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli CFT073]
 gi|162138377|ref|YP_542314.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UTI89]
 gi|168747562|ref|ZP_02772584.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753898|ref|ZP_02778905.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760088|ref|ZP_02785095.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766953|ref|ZP_02791960.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773415|ref|ZP_02798422.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781805|ref|ZP_02806812.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785804|ref|ZP_02810811.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC869]
 gi|168797521|ref|ZP_02822528.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC508]
 gi|170018813|ref|YP_001723767.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli ATCC
           8739]
 gi|170082498|ref|YP_001731818.1| hypothetical protein ECDH10B_3121 [Escherichia coli str. K-12
           substr. DH10B]
 gi|191171800|ref|ZP_03033346.1| 16S rRNA methyltransferase RsmE [Escherichia coli F11]
 gi|195937084|ref|ZP_03082466.1| 16S rRNA m3U1498 methyltransferase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807472|ref|ZP_03249809.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813470|ref|ZP_03254799.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818613|ref|ZP_03258933.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396394|ref|YP_002272426.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4115]
 gi|217326972|ref|ZP_03443055.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           TW14588]
 gi|218555505|ref|YP_002388418.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli IAI1]
 gi|218559937|ref|YP_002392850.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli S88]
 gi|218691070|ref|YP_002399282.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli ED1a]
 gi|218706461|ref|YP_002413980.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UMN026]
 gi|238902068|ref|YP_002927864.1| hypothetical protein BWG_2668 [Escherichia coli BW2952]
 gi|253772216|ref|YP_003035047.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254794898|ref|YP_003079735.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. TW14359]
 gi|256024545|ref|ZP_05438410.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia sp. 4_1_40B]
 gi|261226258|ref|ZP_05940539.1| hypothetical protein EscherichiacoliO157_16928 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256484|ref|ZP_05949017.1| hypothetical protein EscherichiacoliO157EcO_11691 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284267|ref|YP_003501085.1| hypothetical protein G2583_3605 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406453|ref|ZP_06650379.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1412]
 gi|293412306|ref|ZP_06655029.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B354]
 gi|293416207|ref|ZP_06658847.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B185]
 gi|298382190|ref|ZP_06991787.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1302]
 gi|300947676|ref|ZP_07161845.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 116-1]
 gi|306812150|ref|ZP_07446348.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli NC101]
 gi|307139631|ref|ZP_07498987.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli H736]
 gi|312964791|ref|ZP_07779031.1| RNA methyltransferase family protein [Escherichia coli 2362-75]
 gi|331664529|ref|ZP_08365435.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA143]
 gi|84027952|sp|P0AGL8|RSME_ECOL6 RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|84027953|sp|P0AGL7|RSME_ECOLI RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|84027954|sp|P0AGL9|RSME_SHIFL RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|30042519|gb|AAP18243.1| hypothetical protein S3141 [Shigella flexneri 2a str. 2457T]
 gi|56383769|gb|AAN44418.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|85675756|dbj|BAE77009.1| hypothetical protein [Escherichia coli str. K12 substr. W3110]
 gi|87082186|gb|AAC75983.2| 16S rRNA m(3)U1498 methyltransferase, SAM-dependent [Escherichia
           coli str. K-12 substr. MG1655]
 gi|110344687|gb|ABG70924.1| hypothetical protein YggJ [Escherichia coli 536]
 gi|110616402|gb|ABF05069.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115514297|gb|ABJ02372.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157068085|gb|ABV07340.1| conserved hypothetical protein TIGR00046 [Escherichia coli HS]
 gi|157078739|gb|ABV18447.1| conserved hypothetical protein TIGR00046 [Escherichia coli E24377A]
 gi|169753741|gb|ACA76440.1| protein of unknown function DUF558 [Escherichia coli ATCC 8739]
 gi|169890333|gb|ACB04040.1| predicted protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187770823|gb|EDU34667.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017770|gb|EDU55892.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000650|gb|EDU69636.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358446|gb|EDU76865.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363856|gb|EDU82275.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369285|gb|EDU87701.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373969|gb|EDU92385.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC869]
 gi|189379845|gb|EDU98261.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC508]
 gi|190907835|gb|EDV67428.1| 16S rRNA methyltransferase RsmE [Escherichia coli F11]
 gi|208727273|gb|EDZ76874.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734747|gb|EDZ83434.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738736|gb|EDZ86418.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157794|gb|ACI35227.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4115]
 gi|217319339|gb|EEC27764.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           TW14588]
 gi|218362273|emb|CAQ99894.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218366706|emb|CAR04463.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218428634|emb|CAR09563.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218433558|emb|CAR14461.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|238863019|gb|ACR65017.1| predicted protein [Escherichia coli BW2952]
 gi|253323260|gb|ACT27862.1| protein of unknown function DUF558 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254594298|gb|ACT73659.1| predicted protein [Escherichia coli O157:H7 str. TW14359]
 gi|260448011|gb|ACX38433.1| protein of unknown function DUF558 [Escherichia coli DH1]
 gi|284922889|emb|CBG35978.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290764140|gb|ADD58101.1| hypothetical protein G2583_3605 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291426459|gb|EFE99491.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1412]
 gi|291432396|gb|EFF05378.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B185]
 gi|291469077|gb|EFF11568.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B354]
 gi|294490749|gb|ADE89505.1| conserved hypothetical protein TIGR00046 [Escherichia coli IHE3034]
 gi|298277330|gb|EFI18846.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1302]
 gi|300452722|gb|EFK16342.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 116-1]
 gi|305854188|gb|EFM54626.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli NC101]
 gi|307554928|gb|ADN47703.1| 16S rRNA methyltransferase RsmE [Escherichia coli ABU 83972]
 gi|307625480|gb|ADN69784.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UM146]
 gi|312290347|gb|EFR18227.1| RNA methyltransferase family protein [Escherichia coli 2362-75]
 gi|313647996|gb|EFS12442.1| RNA methyltransferase family protein [Shigella flexneri 2a str.
           2457T]
 gi|315137543|dbj|BAJ44702.1| hypothetical protein ECDH1ME8569_2846 [Escherichia coli DH1]
 gi|315614893|gb|EFU95531.1| RNA methyltransferase family protein [Escherichia coli 3431]
 gi|320189294|gb|EFW63953.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. EC1212]
 gi|320195065|gb|EFW69694.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           WV_060327]
 gi|320640592|gb|EFX10131.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. G5101]
 gi|320656635|gb|EFX24531.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662154|gb|EFX29555.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667230|gb|EFX34193.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. LSU-61]
 gi|323188660|gb|EFZ73945.1| RNA methyltransferase family protein [Escherichia coli RN587/1]
 gi|323941968|gb|EGB38147.1| RsmE family protein RNA methyltransferase [Escherichia coli E482]
 gi|323951616|gb|EGB47491.1| RsmE family protein RNA methyltransferase [Escherichia coli H252]
 gi|323957330|gb|EGB53052.1| RsmE family protein RNA methyltransferase [Escherichia coli H263]
 gi|323960761|gb|EGB56382.1| RsmE family protein RNA methyltransferase [Escherichia coli H489]
 gi|324115039|gb|EGC09004.1| RsmE family protein RNA methyltransferase [Escherichia fergusonii
           B253]
 gi|325498503|gb|EGC96362.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia fergusonii
           ECD227]
 gi|326338967|gb|EGD62782.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. 1044]
 gi|326343152|gb|EGD66920.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. 1125]
 gi|330908981|gb|EGH37495.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           AA86]
 gi|331058460|gb|EGI30441.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA143]
 gi|332752989|gb|EGJ83373.1| RNA methyltransferase family protein [Shigella flexneri 4343-70]
 gi|332765363|gb|EGJ95581.1| ribosomal RNA small subunit methyltransferase E [Shigella flexneri
           2930-71]
 gi|332999693|gb|EGK19278.1| RNA methyltransferase family protein [Shigella flexneri VA-6]
 gi|333000409|gb|EGK19992.1| RNA methyltransferase family protein [Shigella flexneri K-218]
 gi|333000605|gb|EGK20183.1| RNA methyltransferase family protein [Shigella flexneri K-272]
 gi|333015165|gb|EGK34508.1| RNA methyltransferase family protein [Shigella flexneri K-304]
 gi|333015286|gb|EGK34628.1| RNA methyltransferase family protein [Shigella flexneri K-227]
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|298490147|ref|YP_003720324.1| hypothetical protein Aazo_0765 ['Nostoc azollae' 0708]
 gi|298232065|gb|ADI63201.1| protein of unknown function DUF558 ['Nostoc azollae' 0708]
          Length = 235

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 117/241 (48%), Gaps = 13/241 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           S L+R+ ++     ++Q   +  Q HYL  VLR ++GD  +  +G    WL+++  +G+ 
Sbjct: 2   SQLQRITINPSQLQESQLLLTPQQQHYLLRVLRSRDGDKFIAMDGISKWWLAQL--IGEQ 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHY 122
            +     +  ++   S    +  P K N  D +++ S E+G+  I P+++  T  + +  
Sbjct: 60  GQILEPLEVTTELPVSITLMVALP-KGNGCDDIVRCSTELGVTCILPILSDRTLLKPSPQ 118

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
            ++R R   + AAEQ +   +P I  P      +    + C  +     C +  +   L 
Sbjct: 119 KLERWRRIALEAAEQSERAFVPTILEPVAFRTAI----NECASIH-RYICEARGNYPHLT 173

Query: 183 AIAH--IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
            +++     + I IGPEGG+  +E E      F  P+SLG RILR+ TA + A++L+ A 
Sbjct: 174 TVSNKFSSEIIIAIGPEGGWTDQELEIALESGF-QPISLGRRILRAVTAPIVALSLIAAA 232

Query: 241 C 241
           C
Sbjct: 233 C 233


>gi|85059999|ref|YP_455701.1| hypothetical protein SG2021 [Sodalis glossinidius str. 'morsitans']
 gi|84780519|dbj|BAE75296.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 114/245 (46%), Gaps = 14/245 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++   PL + T      D  H+++ VLRM     I LF+G +  + ++++ V K   
Sbjct: 3   IPRIYHPAPLTVGTVLALGDDAAHHVSRVLRMTVDAPIALFDGSNHVFAARLTRVDKKGV 62

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                 ++ + ++S +      +  +  ++++ IQKS+E+G+  I P+ +         +
Sbjct: 63  EATVLATQMEDRESLLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSARCGVKLEGE 122

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + +     I A EQC    L  I P  TLE      +   ++        ++ S+
Sbjct: 123 RLEKKLQQWHKIAIGACEQCGRNRLAEIRPAMTLEAWCAEQEAGLKLNLHPR---AQQSI 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L   AH   + +LIGPEGG  +EE     +  F T + LGPR+LR++T A+ A+  +Q
Sbjct: 180 NTLPLPAH--GIRLLIGPEGGLSAEEIALTANYGF-TDILLGPRVLRTETTALTAITALQ 236

Query: 239 AICGD 243
              GD
Sbjct: 237 VRFGD 241


>gi|34495822|ref|NP_900037.1| hypothetical protein CV_0367 [Chromobacterium violaceum ATCC 12472]
 gi|34101677|gb|AAQ58045.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 241

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 128/248 (51%), Gaps = 18/248 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R ++D  L +  Q  +  D       VLR+  GD I LFNG+ GE+ + +S V K   
Sbjct: 1   MPRFYLDADLAVGQQ-LSLPDAVVRHVQVLRLNAGDAITLFNGRGGEYQAALSAVMKRDA 59

Query: 67  FKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRP------VITRYTQ 118
             V  +    ++++ +    +      +++++ +QK VEMG+   +P      V+    +
Sbjct: 60  HCVIERFDDVSRETPLWLGLAQGISGGDKMEFTLQKGVEMGVSVFQPIAAGRSVVKLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENS 177
                + R +   +SA EQ    T+P + P  TL E+L +  + + +++       S   
Sbjct: 120 RADKRVARWQEIVVSACEQSGRNTVPQVLPILTLNEWLAQRQEADIRLIL------SPRG 173

Query: 178 LEKLHAIAHIPNVAILI-GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
              L  +A  P  + L+ GPEGG+ ++E++   +  + TPL LGPRILR++TAA+AA+A 
Sbjct: 174 DRSLAQLAERPARSWLMAGPEGGFSAQEEDAALAAGW-TPLKLGPRILRTETAALAAVAA 232

Query: 237 VQAICGDW 244
           +QA+ GD+
Sbjct: 233 MQAVWGDY 240


>gi|309972536|gb|ADO95737.1| 16S rRNA m3U1498 methyltransferase [Haemophilus influenzae R2846]
          Length = 245

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 123/262 (46%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             KVE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++    
Sbjct: 61  SVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC   ++P I P   L+    +W            C 
Sbjct: 118 KLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CA 161

Query: 174 SENSLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGP 221
             +   K  LH  AH        IP   V +LIG EGG  ++E        F T + LG 
Sbjct: 162 ENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGK 220

Query: 222 RILRSDTAAVAAMALVQAICGD 243
           R+LR++TA++AA++ +Q   GD
Sbjct: 221 RVLRTETASLAAISALQICFGD 242


>gi|170682172|ref|YP_001745107.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli SMS-3-5]
 gi|170519890|gb|ACB18068.1| 16S rRNA methyltransferase RsmE [Escherichia coli SMS-3-5]
          Length = 243

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 2   RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNRVFDAEITSASKKS 61

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 62  VEVKV-LEGQLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|319775828|ref|YP_004138316.1| RNA methyltransferase [Haemophilus influenzae F3047]
 gi|319896636|ref|YP_004134829.1| RNA methyltransferase [Haemophilus influenzae F3031]
 gi|329123672|ref|ZP_08252232.1| 16S rRNA methyltransferase RsmE [Haemophilus aegyptius ATCC 11116]
 gi|317432138|emb|CBY80489.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae F3031]
 gi|317450419|emb|CBY86635.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae F3047]
 gi|327469871|gb|EGF15336.1| 16S rRNA methyltransferase RsmE [Haemophilus aegyptius ATCC 11116]
          Length = 245

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 122/259 (47%), Gaps = 45/259 (17%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCYLSEDATNHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++     +D
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGVKLD 120

Query: 126 RVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
             R            I+A EQC   ++P I P   L+    +W            C   +
Sbjct: 121 AERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|229031960|ref|ZP_04187946.1| RNA methyltransferase, RsmE [Bacillus cereus AH1271]
 gi|228729350|gb|EEL80341.1| RNA methyltransferase, RsmE [Bacillus cereus AH1271]
          Length = 249

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 116/244 (47%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK     + +I+  ++ 
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TAI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK---NWDHNCQIVFADETCG 173
            +     ++R+R     AAEQ     +P ++ P + + LL     +D  C + + +E   
Sbjct: 118 AKKADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYD-VCLVAYEEEAKQ 176

Query: 174 SENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S   + L  +     + I+ GPEGG   EE  TL    FV P SLGPRILR++TA +
Sbjct: 177 GEKSNFAKALTTMKPGQKLLIVFGPEGGLAEEEITTLREHKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|157693044|ref|YP_001487506.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus pumilus
           SAFR-032]
 gi|157681802|gb|ABV62946.1| hypothetical protein BPUM_2277 [Bacillus pumilus SAFR-032]
          Length = 256

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 115/246 (46%), Gaps = 16/246 (6%)

Query: 7   LKRLFVDF---PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F+D     +  K      G+  H+L++V+RMK G  IL       E LSKI  + K
Sbjct: 1   MQRYFIDLTKEEVIAKGAIVIKGEDVHHLSNVMRMKAGQEILCLTTDGFEALSKIDTITK 60

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPV-----ITRY 116
                      +Q ++  V+   +    K ++L+ +IQK  E+G  A  P      IT+ 
Sbjct: 61  EEVLCHLEGWTNQDRELPVRVTIASGLPKGDKLELIIQKGTELGASAFIPFQAARSITKL 120

Query: 117 TQ-NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFL--LKNWDHNCQIVFADETCG 173
            Q  +H   DR       AAEQ     +P +YP +T + L  L +    C + + + +  
Sbjct: 121 DQKKSHKKRDRWEKIAKEAAEQSYRNIIPHVYPVSTFKELTQLASEFDKCVVAYEESSKE 180

Query: 174 SENSLEK--LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S  +  L  +     + ++ GPEGG   +E E L +L  V    LGPRILR++TA +
Sbjct: 181 GEQSRFQTVLQQMKGGQTLLVVFGPEGGLAEKEIEALETLGAVI-CGLGPRILRTETAPL 239

Query: 232 AAMALV 237
            A++ +
Sbjct: 240 YALSAI 245


>gi|300940772|ref|ZP_07155318.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 21-1]
 gi|300454472|gb|EFK17965.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 21-1]
          Length = 253

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 109/226 (48%), Gaps = 16/226 (7%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQSDVQYI 85
           D  +++  VLRM  G  + LF+G +  + ++I+   K S+  KV  + +   ++S +   
Sbjct: 33  DAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSVEVKV-LEGQLDDRESPLHIH 91

Query: 86  FSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMDRVRTYTISAAEQ 137
              +  +  ++++ IQKS+E+G+  I P+ +        ++  +  + + +   I+A EQ
Sbjct: 92  LGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACEQ 151

Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPE 197
           C    +P I P   LE      D   ++        S N+L        +  V +LIGPE
Sbjct: 152 CGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSINTLP-----LPVERVRLLIGPE 206

Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GG  ++E        F T + LGPR+LR++T A+ A+  +Q   GD
Sbjct: 207 GGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITALQVRFGD 251


>gi|315295635|gb|EFU54958.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 16-3]
          Length = 253

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 116/247 (46%), Gaps = 16/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64
            + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K S
Sbjct: 12  RIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKS 71

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           +  KV  + +   ++S +      +  +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 72  VEVKV-LEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 130

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 131 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 190

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 191 TLP-----LPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 244

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 245 LQVRFGD 251


>gi|325290539|ref|YP_004266720.1| Ribosomal RNA small subunit methyltransferase E [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965940|gb|ADY56719.1| Ribosomal RNA small subunit methyltransferase E [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 245

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 110/234 (47%), Gaps = 24/234 (10%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS------IRFKVEYQSRSQTKQ 79
           G++ H+L  VLR+  G+ IL F+     W   I  + K       IR ++  ++ ++ K 
Sbjct: 18  GEELHHLTRVLRLGPGEEILGFDHSGRLWRGAIREINKEQAVCSVIRAEIP-ETEAKVK- 75

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTIS 133
             V  I    K  +++ +IQK  E+GM  + P+ TR +            +DR R     
Sbjct: 76  --VYLIVGLSKGEKMELVIQKGTELGMTGLIPLRTRRSVMKLEGTKAEERVDRWRKIAGE 133

Query: 134 AAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAIL 193
           A +QC  +  P + P    + L      + Q +   E   + +    L +      +A++
Sbjct: 134 AVKQCGRVIQPAVAPVLDWQDLPAYLPADTQWLIPFEGEKTVSLKACLKSFDPSLPMALI 193

Query: 194 IGPEGGYHSEE----KETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           IGPEGG+  +E    KE L +      +SLG RILR++TAA+AA+ +V A  GD
Sbjct: 194 IGPEGGFEPQEVLWAKEKLGA----KSISLGSRILRAETAAIAALTIVLAFYGD 243


>gi|296112908|ref|YP_003626846.1| putative RNA methyltransferase [Moraxella catarrhalis RH4]
 gi|295920602|gb|ADG60953.1| putative RNA methyltransferase [Moraxella catarrhalis RH4]
 gi|326567975|gb|EGE18072.1| ribosomal RNA small subunit methyltransferase E [Moraxella
           catarrhalis BC1]
 gi|326577430|gb|EGE27314.1| ribosomal RNA small subunit methyltransferase E [Moraxella
           catarrhalis O35E]
          Length = 247

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 30/246 (12%)

Query: 7   LKRLFVDFPLCIKTQGK--ASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
           + R FVD PL     G+  A  D   H+   VLR   GD   LF+G  GE+   ++++  
Sbjct: 1   MPRFFVDTPLTTNLIGQIIALPDHVTHHWCKVLRASVGDCAFLFDGMGGEYTVTLTHIHK 60

Query: 63  KSIRFKVEYQ---SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           KS   K++     +R+   ++ +  + S  + +R+DY IQK+ EMG+  I  + +   Q 
Sbjct: 61  KSASVKIDAYHPINRTPPFRASIGLVMS--RGDRMDYAIQKATEMGVHCIHLLTSDRCQ- 117

Query: 120 THYNMDR-------VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
            H   DR        ++  ++A EQC +  +P          LL  W  NCQ        
Sbjct: 118 AHLKYDRDFKKLTHWQSVAVAACEQCGMNIIPN----IIAPILLDEWVANCQDELKLVLA 173

Query: 173 GSEN--SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
            SEN  +  KL     +P N+++LIG EGG    E +      FV P  +G R+LR++TA
Sbjct: 174 LSENNPTFNKL-----VPKNISLLIGAEGGLSPREIDLAIHHGFV-PWRIGERVLRTETA 227

Query: 230 AVAAMA 235
            V A++
Sbjct: 228 PVVALS 233


>gi|171060614|ref|YP_001792963.1| 16S ribosomal RNA methyltransferase RsmE [Leptothrix cholodnii
           SP-6]
 gi|170778059|gb|ACB36198.1| protein of unknown function DUF558 [Leptothrix cholodnii SP-6]
          Length = 247

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 108/238 (45%), Gaps = 14/238 (5%)

Query: 9   RLFVDFPLCIKTQ-GKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IR 66
           RLFVD PL         +G   H    VLRM+ G+ +++FNG+ GEW  +I+ +G+S ++
Sbjct: 4   RLFVDTPLQAGLDLSLPAGAARHV--QVLRMQPGEELIVFNGQGGEWRVRIARMGRSEVQ 61

Query: 67  FKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
             VE +    +     V  +       R D++I+K+ E+G   I P +   +      + 
Sbjct: 62  VLVEQFVDVDRELALHVTLVAGMPANERFDWLIEKATELGAAEIVPTMCERSVLRLSGER 121

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +  +   ISAA+QC    +P I    +L         +  +     +      L 
Sbjct: 122 AQKKREHWQGIAISAAQQCGRTRVPHIAAVRSLSEERAGESADTPVTQLLLSLADAQPLG 181

Query: 180 KLHAIAHIPNVAILI--GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           +  A        + I  GPEGG+ +E +E L       P SLGPR+LRS+TA +A ++
Sbjct: 182 RRLAARADTGAPLRIYSGPEGGF-TEAEERLLRQGGAQPTSLGPRVLRSETAPLAVLS 238


>gi|145634697|ref|ZP_01790406.1| hypothetical protein CGSHiAA_05711 [Haemophilus influenzae PittAA]
 gi|145268242|gb|EDK08237.1| hypothetical protein CGSHiAA_05711 [Haemophilus influenzae PittAA]
          Length = 245

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 123/262 (46%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             KVE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++    
Sbjct: 61  SVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGV 117

Query: 123 NMDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
            +D  R            I+A EQC   ++P I P   L+    +W            C 
Sbjct: 118 KLDAERMDKKIQQWQKIAIAACEQCGRNSVPDIRPLMKLQ----DW------------CA 161

Query: 174 SENSLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGP 221
             +   K  LH  AH        IP   V +LIG EGG  ++E        F T + LG 
Sbjct: 162 ENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGK 220

Query: 222 RILRSDTAAVAAMALVQAICGD 243
           R+LR++TA++AA++ +Q   GD
Sbjct: 221 RVLRTETASLAAISALQICFGD 242


>gi|127514152|ref|YP_001095349.1| hypothetical protein Shew_3224 [Shewanella loihica PV-4]
 gi|126639447|gb|ABO25090.1| protein of unknown function DUF558 [Shewanella loihica PV-4]
          Length = 243

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 107/233 (45%), Gaps = 38/233 (16%)

Query: 31  YLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRFKVEYQSRSQTKQSDVQYIFSPI 89
           ++  VLRM  G+ + LFNG    +L++I +   K++  +V     +   +S +      +
Sbjct: 27  HVGRVLRMGAGEQLELFNGDGHNYLTEIVTASKKNVEVRV-LSKEANDNESPLNLHLGQV 85

Query: 90  --KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDIL 141
             + +R+D+ +QKSVE+G+  I P+ +         +     + + +   ISA EQ    
Sbjct: 86  ISRGDRMDFTLQKSVELGVNTITPLFSERCGVKLTGERLEKKIQQWQKIVISACEQSGRS 145

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA-----------IAHIPNV 190
           T+P + P   L                D+ CG      KL+            +   P V
Sbjct: 146 TVPEVRPAMQL----------------DDWCGEATQALKLNLHPRADHGINGLVMETPRV 189

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            +LIGPEGG   +E     +  F T + LGPR+LR++TAA+ A++ +Q   GD
Sbjct: 190 RLLIGPEGGLSPQEIAMTETHAF-TDVLLGPRVLRTETAALTAISALQLKFGD 241


>gi|320529958|ref|ZP_08031034.1| RNA methyltransferase, RsmE family [Selenomonas artemidis F0399]
 gi|320137755|gb|EFW29661.1| RNA methyltransferase, RsmE family [Selenomonas artemidis F0399]
          Length = 248

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 124/249 (49%), Gaps = 26/249 (10%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW----LSKISYVG 62
           ++RLF  +P  +  + + +G   H+LA V+R + GD + +  G DG      ++ ++   
Sbjct: 1   MRRLF--YPGELTPEIRITGGDAHHLARVMRAQLGD-VHVVAGADGRAARMTVTAVARDA 57

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVIT-----RY- 116
            ++R    Y       +++V  + + +K  + D+++QK+VE+G  A+ P++T     RY 
Sbjct: 58  VTLRLD-SYVEDDAPARAEVILVQALLKGEKTDFIVQKAVELGAAALHPIVTEHVVVRYD 116

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD----HNCQIVFADETC 172
            +       R +     AA+QC  L+L  + P   ++ +L + +     +  ++F    C
Sbjct: 117 AKKAAAKTARWQKIADEAAKQCGRLSLMHVAPVGAIDSILGDVEIFGGVDTTVIF----C 172

Query: 173 GSENSLEKLHAIAHI---PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
                ++ + A+        V +++G EGG+   E   L +     P+SLG  ILR++TA
Sbjct: 173 YEGERMQSMRAVLRTVMSARVVLIVGAEGGFSPTEAARL-TAAGAQPVSLGHLILRAETA 231

Query: 230 AVAAMALVQ 238
           A+AA+ +VQ
Sbjct: 232 AIAALTVVQ 240


>gi|311108286|ref|YP_003981139.1| methyltransferase [Achromobacter xylosoxidans A8]
 gi|310762975|gb|ADP18424.1| RNA methyltransferase family protein [Achromobacter xylosoxidans
           A8]
          Length = 243

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 110/228 (48%), Gaps = 10/228 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R F D PL    +        H+   VLR++ G+ + LFNG+ GE+ + +   GK+   +
Sbjct: 5   RFFCDIPLTAGARVALPDALAHHALRVLRLRAGEAVALFNGQGGEYPATLEVDGKAGFAQ 64

Query: 69  V-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTHYNMD 125
           + ++  R       +  +      +++D++++K+VE+G   + P+  + +  Q +   +D
Sbjct: 65  LGQFLPREAELAGRITLVQGLPSGDKMDWVVEKAVELGAARVCPIAAQRSVLQLSGPRLD 124

Query: 126 RVRTY----TISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
           +   +      SA+EQC    L  +  P TL   L+      +++   E   S++    L
Sbjct: 125 KRVAHWQRIAQSASEQCGRNRLMAVDAPFTLADWLQQPADGLRLMCHPEA--SDDLAGAL 182

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
            A+ ++  + +L+GPEGG+  +E         V  +  GPR+LR++TA
Sbjct: 183 RAVPNLQALTLLVGPEGGWSDKELAQAREA-GVQAVRFGPRVLRTETA 229


>gi|118444754|ref|YP_878563.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium novyi NT]
 gi|118135210|gb|ABK62254.1| conserved hypothetical protein TIGR00046 [Clostridium novyi NT]
          Length = 251

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 108/229 (47%), Gaps = 11/229 (4%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-IRFKVEYQSRSQTKQSDVQ 83
            G+   ++  VLR+KEGD + + +    E+L  I Y+ KS +  K+  +     +     
Sbjct: 19  EGEDVKHIYKVLRLKEGDKVNINDCNGKEFLGTIDYIDKSKVEVKLLEELEINNEPPIEV 78

Query: 84  YIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-------HYNMDRVRTYTISAA 135
           Y++  + K +++D ++QK  E+G+  I PV+T    ++          +DR       A 
Sbjct: 79  YLYQGLPKASKMDLIVQKCTELGIREITPVVTGRVASSINDIKRESKKLDRWNRIAFEAC 138

Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI-AHIPNVAILI 194
           +Q     +P +     ++ L +       IV   E   +    + +  +   +  V I+I
Sbjct: 139 KQNKRTLIPKVNDIMNMDELKEQLKEMDLIVVPYENAENYGIKQMIKNVTGEVKKVGIII 198

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           GPEGG+  EE E L ++     ++LGPRILR++TA    +AL+    GD
Sbjct: 199 GPEGGFEQEEIEELKNME-AQIVTLGPRILRTETAGFTCLALLMYELGD 246


>gi|326566657|gb|EGE16798.1| ribosomal RNA small subunit methyltransferase E [Moraxella
           catarrhalis 12P80B1]
          Length = 241

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 30/246 (12%)

Query: 7   LKRLFVDFPLCIKTQGK--ASGDQY-HYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
           + R FVD PL     G+  A  D   H+   VLR   GD   LF+G  GE+   ++++  
Sbjct: 1   MPRFFVDTPLTTNLIGQIIALPDHVTHHWCKVLRASVGDCAFLFDGMGGEYTVTLTHIHK 60

Query: 63  KSIRFKVEYQ---SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           KS   K++     +R+   ++ +  + S  + +R+DY IQK+ EMG+  I  + +   Q 
Sbjct: 61  KSASVKIDAYHPINRTPPFRASIGLVMS--RGDRMDYAIQKATEMGVHCIHLLTSDRCQ- 117

Query: 120 THYNMDR-------VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
            H   DR        ++  ++A EQC +  +P          LL  W  NCQ        
Sbjct: 118 AHLKYDRDFKKLTHWQSVAVAACEQCGMNIIPN----IIAPILLDEWVANCQDELKLVLA 173

Query: 173 GSEN--SLEKLHAIAHIP-NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
            SEN  +  KL     +P N+++LIG EGG    E +      FV P  +G R+LR++TA
Sbjct: 174 LSENNPTFNKL-----VPKNISLLIGAEGGLSPREIDLAIHHGFV-PWRIGERVLRTETA 227

Query: 230 AVAAMA 235
            V A++
Sbjct: 228 PVVALS 233


>gi|114561729|ref|YP_749242.1| hypothetical protein Sfri_0543 [Shewanella frigidimarina NCIMB 400]
 gi|114333022|gb|ABI70404.1| protein of unknown function DUF558 [Shewanella frigidimarina NCIMB
           400]
          Length = 246

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 102/225 (45%), Gaps = 12/225 (5%)

Query: 27  DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYIF 86
           D   ++  VLRM  GD I LFNG   ++L++I    K           +   +S +    
Sbjct: 24  DGVAHIGRVLRMGMGDQISLFNGDGNDYLAEIIETSKKSIAVTVLSCEANNSESPLDLHL 83

Query: 87  SPI--KTNRLDYMIQKSVEMGMGAIRPV------ITRYTQNTHYNMDRVRTYTISAAEQC 138
             +  + +R+++ +QKSVE+G+  I P+      +    +     + + +   ISA EQ 
Sbjct: 84  GQVISRGDRMEFTVQKSVELGVTTITPLFSDRCGVKLSGERLEKKLQQWQKIVISACEQS 143

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEG 198
               +P + P  TL    +      ++          N L+ L    H   V +LIGPEG
Sbjct: 144 GRSIVPIVRPAMTLAQWCEESTEALKLNLHPRASHGINGLQ-LSGQHH--KVRLLIGPEG 200

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           G   EE     +  F T + LGPR+LR++TA++ A+  +Q   GD
Sbjct: 201 GLSDEEIAMTETQHF-TDILLGPRVLRTETASLTAITALQVKFGD 244


>gi|229129591|ref|ZP_04258560.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-Cer4]
 gi|229152513|ref|ZP_04280704.1| RNA methyltransferase, RsmE [Bacillus cereus m1550]
 gi|228630944|gb|EEK87582.1| RNA methyltransferase, RsmE [Bacillus cereus m1550]
 gi|228653859|gb|EEL09728.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-Cer4]
          Length = 249

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 115/244 (47%), Gaps = 20/244 (8%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNI-LLFNGKDGEW-LSKIS--YVG 62
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK     + +I+  ++ 
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRP------VITRY 116
            +I   VE+   S      V       K ++L+ + QK  E+G  A  P      ++   
Sbjct: 61  TAI---VEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWD 117

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLK---NWDHNCQIVFADETCG 173
            +     ++R+R     AAEQ     +P ++ P + + LL     +D  C + + +E   
Sbjct: 118 AKKADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYD-TCLVAYEEEAKQ 176

Query: 174 SENS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
            E S   + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA +
Sbjct: 177 GEKSNFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPL 235

Query: 232 AAMA 235
            A++
Sbjct: 236 YALS 239


>gi|150015721|ref|YP_001307975.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902186|gb|ABR33019.1| protein of unknown function DUF558 [Clostridium beijerinckii NCIMB
           8052]
          Length = 255

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 112/243 (46%), Gaps = 22/243 (9%)

Query: 19  KTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-----IRFKVEYQS 73
           +T+GK  GD   ++  VLR+ EG+ ++L N +  E+L +I  + KS     I  +++  +
Sbjct: 13  ETEGKILGDDVKHIYKVLRLSEGEEVVLNNCEGIEYLGEIETITKSEVIVKIIKRLDINN 72

Query: 74  RSQTKQSDVQYIFSPI-KTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVR 128
            S+ K     ++F  + K  ++D ++QK  E+G+    PV T       +     +DR+ 
Sbjct: 73  ESKVK----VHLFQGLPKGQKMDLIVQKGTELGVSEFIPVTTARVDVKLKGEFKKLDRLN 128

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC---GSENSLEKLHA-- 183
              + A +Q     +P +         +        I+   E     G +  + KL    
Sbjct: 129 RIALEACKQSKRSVIPQVKEVIDFNEAINELKKMDLIIVPYENAEDFGIKTLVRKLERDS 188

Query: 184 --IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
             +  I NV ILIGPEGG+   E + L        ++LG RILR++TA   A AL+Q   
Sbjct: 189 VDLDTINNVGILIGPEGGFEESEIDDLKE-QGAYIVTLGNRILRTETAGFTATALIQYEL 247

Query: 242 GDW 244
           GD 
Sbjct: 248 GDL 250


>gi|91776603|ref|YP_546359.1| hypothetical protein Mfla_2251 [Methylobacillus flagellatus KT]
 gi|91710590|gb|ABE50518.1| 16S rRNA m(3)U-1498 methyltransferase [Methylobacillus flagellatus
           KT]
          Length = 245

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 122/232 (52%), Gaps = 21/232 (9%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS--IRFKVEYQ---SRSQTKQ 79
           +G+   + +  LRM+ GD+ +LFNG    +LS+++ + K   I   +E Q   + S  K 
Sbjct: 21  AGNAASHASKALRMQVGDHAILFNGDGHNYLSRLTSIRKQEVIAEVLEAQPCPTESPLKI 80

Query: 80  SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTIS 133
           +  Q I S    +R+D+ IQK+VEMG+ +I+P+ ++ +      +      +  +   IS
Sbjct: 81  TLAQAISS---GDRMDFTIQKAVEMGVSSIQPIFSQRSIVKLTGERAEKRREHWQNVAIS 137

Query: 134 AAEQCDILTLPFIYPPTTL-EFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAI 192
           A EQ     +P + P   L E+L +    +  I  A    G+  +L +L +     ++ +
Sbjct: 138 ACEQSGRAYIPPVAPAINLSEWLAQKPGADAYITLAP---GAPLTLPQLTSPTR--HICL 192

Query: 193 LIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           LIGPEGG    E        F T + +GPRILR++TAA+AA+A +Q + GD+
Sbjct: 193 LIGPEGGLADHEIALAAQHGF-TLVRMGPRILRTETAAIAAIASMQTLWGDF 243


>gi|255065808|ref|ZP_05317663.1| 16S rRNA methyltransferase RsmE [Neisseria sicca ATCC 29256]
 gi|255050126|gb|EET45590.1| 16S rRNA methyltransferase RsmE [Neisseria sicca ATCC 29256]
          Length = 241

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 114/226 (50%), Gaps = 27/226 (11%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK-----SIRFKVEYQSRSQTKQSDVQYIFSP 88
           +VLR++ G+ ++LFNG    + +++  + K      +  + E  + S  K + VQ + S 
Sbjct: 27  NVLRVRCGEEVVLFNGNGKAYPARLDVLEKRRACAEVLREEEADNESPLKITLVQSVSS- 85

Query: 89  IKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDILT 142
               R+D+ +QKSVE+G+ AI+PVI+         +     + R +   +SA EQ     
Sbjct: 86  --GERMDFTLQKSVELGVVAIQPVISERCVVRLSGERADKRVARWQEIVVSACEQSGRNI 143

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP----NVAILIGPEG 198
           +P + P       LK          + ET     SL +  ++  +     ++  ++GPEG
Sbjct: 144 VPEVRPLLPYREALKQ--------MSSETTKLLMSLNRAQSLRTVKPFSDDLIFMVGPEG 195

Query: 199 GYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           G+  EE+       F + ++LG R+LR++TA++AA+A +Q + GD+
Sbjct: 196 GWTDEEERMAFEAGFQS-VTLGKRVLRTETASLAAIAAMQTLWGDF 240


>gi|302874303|ref|YP_003842936.1| hypothetical protein Clocel_1419 [Clostridium cellulovorans 743B]
 gi|307689431|ref|ZP_07631877.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium cellulovorans
           743B]
 gi|302577160|gb|ADL51172.1| protein of unknown function DUF558 [Clostridium cellulovorans 743B]
          Length = 248

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 115/230 (50%), Gaps = 16/230 (6%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVE----YQSRSQTKQSD 81
           G+   ++  VLR+K GD + + +    E+ +K++ + K    K E      S +++    
Sbjct: 20  GEDVKHIYKVLRLKVGDIVNINDCNGTEYNAKLTSIDKK-EVKAEIIETLDSNNESPIKI 78

Query: 82  VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVIT-RYTQNTH--YNMDRVRTYTISAAEQC 138
           V Y   P K  ++DY++QK  E+G+ A  PV T R   NT     +DR+      AA+Q 
Sbjct: 79  VLYQGMP-KATKMDYIVQKGTEVGINAFIPVNTERVVVNTSEFKKLDRLNRIAKEAAKQS 137

Query: 139 DILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN----SLEKLHAIAHIPNVAILI 194
               +P ++ P   E LLK  +    IV   E   +EN    +L K      + +VAI+I
Sbjct: 138 KRTIIPKVHEPIEFEELLKELEEYSLIVVPYEN--AENFGIKNLAKGVKKEEVDSVAIII 195

Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           GPEGG+   E E L S+     ++LGPRILR++TA V   +L+    GD 
Sbjct: 196 GPEGGFEDSEIERLKSIN-AHIVTLGPRILRTETAGVVCASLIMYELGDM 244


>gi|119899122|ref|YP_934335.1| 16S ribosomal RNA methyltransferase RsmE [Azoarcus sp. BH72]
 gi|119671535|emb|CAL95448.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 243

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 107/222 (48%), Gaps = 10/222 (4%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVE-YQSRSQTKQSDVQYIFSP 88
           H+   VLRM++G+ I+LF+G   E  + +   GKS    +  Y+   +    D+  + + 
Sbjct: 25  HHATRVLRMRDGEPIVLFDGSGAEAEATLVLRGKSAAALISAYREVDRESPLDLVLVQAL 84

Query: 89  IKTNRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQCDILT 142
              +++D+++QK+VE+G  A++P      V+    +      +  +   + A EQ     
Sbjct: 85  ATGDKMDWIVQKAVELGARAVQPIQAERSVLRLAGERATRRREHWQQVAVGACEQSGRNR 144

Query: 143 LPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHS 202
           +P +    +L+  L     +   V       +   L  L   A    + +L+GPEGG+  
Sbjct: 145 IPEVGEILSLQAYLAAAREDRATVRCVLDPAAAQGLSALPRPAG--ALHLLVGPEGGWSD 202

Query: 203 EEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           +E     +    TP+ LGPR+LR++TA +A +A +QA  GD+
Sbjct: 203 DELAACAA-AHCTPVGLGPRVLRTETAGLAMLAALQARWGDF 243


>gi|221632371|ref|YP_002521592.1| hypothetical protein trd_0341 [Thermomicrobium roseum DSM 5159]
 gi|221155488|gb|ACM04615.1| conserved hypothetical protein TIGR00046 [Thermomicrobium roseum
           DSM 5159]
          Length = 265

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 113/225 (50%), Gaps = 26/225 (11%)

Query: 30  HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG--KSIRFKVEYQSRSQTKQSDVQYIFS 87
           H L  VLR++ GD +LL +G+  ++++++  +   +++   V+ Q         +  + +
Sbjct: 28  HQLVRVLRLRPGDRVLLCDGRAIDFVAELIELDPERTVAVLVDAQPARPLPPPPIVLLQA 87

Query: 88  PIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISAAEQCDIL 141
            ++ +  D +++K+ E+G+  I P+ T+ T      ++    + R +   + A+EQC   
Sbjct: 88  LLRHDHFDLVVEKATELGIVRIVPLHTQRTVVHLALRDVTQRLARWQRIAMEASEQCGRG 147

Query: 142 TLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP-----NVAILIGP 196
           TLP I  P+TL+  L        +VF +          +  AIAH        V + +GP
Sbjct: 148 TLPEIDTPSTLDRALATVRTARLLVFWEAP--------EAEAIAHASFSPDQTVTVAVGP 199

Query: 197 EGGYHSEEKETL--HSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           EGG+ +EE      H   F    SLGP ILR++TAA++ +A VQA
Sbjct: 200 EGGWTAEEIALFRRHGAEF---RSLGPLILRAETAAISGIAAVQA 241


>gi|78188184|ref|YP_378522.1| 16S ribosomal RNA methyltransferase RsmE [Chlorobium
           chlorochromatii CaD3]
 gi|78170383|gb|ABB27479.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 247

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 19/229 (8%)

Query: 21  QGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SIRFKVEYQSRSQTKQ 79
           Q    G+++H+L  VLR +EG+ IL+ +G       +I+ + K  ++ ++   +  +   
Sbjct: 17  QVSIEGEEFHHLVRVLRKREGELILVTDGNGLRCEVRIASISKHDVQGEIISTTTIEPPS 76

Query: 80  SDVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTI 132
           + V    S +K   R ++ ++K+ E+G+  I P++T  T         H  + R RT  +
Sbjct: 77  TRVTVALSLLKNPQRFEWFLEKATELGISTIIPMVTARTVVQPSNDRVHNKLKRWRTIVL 136

Query: 133 SAAEQCDILTLPFIYPPTTLEFLLK--NWDHNCQIVFADETCGSENSLEKLHAIAHIPNV 190
           SAA Q     LP +  P     +L    +D  C    A        S   LH      N+
Sbjct: 137 SAARQSKRYYLPQVVEPQRFSDVLNRSGYDERCMPFEAA------TSSPTLHCAGK--NI 188

Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
             LIG EGG+ +EE +   +    T +SLG  ILR++TAA+ A+A V++
Sbjct: 189 LFLIGGEGGFSAEEVQQAEATGCRT-MSLGTTILRAETAALFAVAYVRS 236


>gi|301169013|emb|CBW28610.1| predicted protein [Haemophilus influenzae 10810]
          Length = 245

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 121/259 (46%), Gaps = 45/259 (17%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K    K
Sbjct: 5   RIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK-SVK 63

Query: 69  VEYQSRS-QTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           VE   R    K+S ++     +  +  R+++ IQKSVE+G+  I P+   +++     +D
Sbjct: 64  VEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPL---WSERCGVKLD 120

Query: 126 RVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
             R            I+A EQC    +P I P   L+    +W            C   +
Sbjct: 121 AERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQ----DW------------CAEND 164

Query: 177 SLEK--LHAIAH--------IP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRIL 224
              K  LH  AH        IP   V +LIG EGG  ++E        F T + LG R+L
Sbjct: 165 GALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVL 223

Query: 225 RSDTAAVAAMALVQAICGD 243
           R++TA++AA++ +Q   GD
Sbjct: 224 RTETASLAAISALQICFGD 242


>gi|39995554|ref|NP_951505.1| 16S ribosomal RNA methyltransferase RsmE [Geobacter sulfurreducens
           PCA]
 gi|39982317|gb|AAR33778.1| conserved hypothetical protein TIGR00046 [Geobacter sulfurreducens
           PCA]
 gi|298504560|gb|ADI83283.1| 16S rRNA (3-methyl-U1498)-methyltransferase [Geobacter
           sulfurreducens KN400]
          Length = 260

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 114/230 (49%), Gaps = 17/230 (7%)

Query: 26  GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQTKQSDVQYI 85
           GD + ++A  LR+K    ++L +GK+ E    I+ +G+     V    R Q +  D   +
Sbjct: 20  GDLFRHMARSLRLKIDTEVILADGKEAECTGVITAMGRD-SLTVTISERRQIR-GDGDGL 77

Query: 86  FSPI-----KTNRLDYMIQKSVEMGMGAIRPVITRYT------QNTHYNMDRVRTYTISA 134
           +  +     K ++++ ++QKS E+G+  + P +   +      +     + R +     A
Sbjct: 78  WLTLCQGLPKGDKMELILQKSTELGVSEVVPFLAERSVPRISPEREQERLRRWQRVAEEA 137

Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN-VAIL 193
           A Q     +P +     L   ++  DH+ +++  ++      +L  + A A  P  +A++
Sbjct: 138 ARQAGCPAVPRVQLARGLTEAVRGTDHDLKLLLWEDE--RTTTLAGVLAAAQTPKRIAVV 195

Query: 194 IGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +GPEGG+ + E        FV P++LG RILR++TA +A +A++Q + GD
Sbjct: 196 VGPEGGFTAAEAAEAREAGFV-PVTLGRRILRTETAGIALVAILQYLYGD 244


>gi|332971497|gb|EGK10447.1| 16S rRNA methyltransferase RsmE [Kingella kingae ATCC 23330]
          Length = 240

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 109/221 (49%), Gaps = 17/221 (7%)

Query: 34  HVLRMKEGDNILLFNGKDGEWLSKISYVGK---SIRFKVEYQSRSQTKQSDVQYIFSPIK 90
            VLR+  GD+++LF+G+     + ++ +GK   +       Q  S++  S +  + +   
Sbjct: 26  QVLRLNVGDDLILFDGRGKRVHATLTELGKRKAACTLAPTEQINSESALS-IHLLQAISS 84

Query: 91  TNRLDYMIQKSVEMGMGAIRP------VITRYTQNTHYNMDRVRTYTISAAEQCDILTLP 144
             R+D+ IQKSVE+G+ +I P      V+    +     + R +   ISA EQC    +P
Sbjct: 85  GERMDFTIQKSVELGVASITPIWSERCVVKLQGERADKRVQRWQDIAISACEQCGRDIVP 144

Query: 145 FIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN-VAILIGPEGGYHSE 203
            + P    +  +K        +       S    + L A+   P  V ++IGPEGG+ + 
Sbjct: 145 EVRPIVRFDDYIKQMPREQLHLLM-----SLQQAKSLQAMQPAPQTVYLMIGPEGGWTAA 199

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           E++      F   + LG R+LR++TA++AA+A +Q + GD+
Sbjct: 200 EEQAALDAGF-QAIVLGKRVLRTETASLAAIAAMQTLWGDF 239


>gi|224541750|ref|ZP_03682289.1| hypothetical protein CATMIT_00922 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525354|gb|EEF94459.1| hypothetical protein CATMIT_00922 [Catenibacterium mitsuokai DSM
           15897]
          Length = 244

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 116/226 (51%), Gaps = 19/226 (8%)

Query: 24  ASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RFKVEYQSRSQTKQSDV 82
           A    Y ++  V+RM++G++++  +      L +I  + + + + K E Q  ++    +V
Sbjct: 18  ADDSMYKHMTKVMRMEKGEHVICIDEDKHVCLCEIIDLKQGLLQIKEELQENNEL-DVEV 76

Query: 83  QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTHYNMDRVRTYTIS--AAE 136
             ++   K+++ +++IQK+ E+G+  I P+    +      T +N  + R   I+  A+E
Sbjct: 77  TLVYGLPKSDKFEFVIQKATELGVTRIVPLRASRSIVKMDETRFNKKKERFVRIAQEASE 136

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN-----SLEKLHAIAHIPNVA 191
           QC    +P I PP  L  L         + + +E+   E+     +L+ LH      ++ 
Sbjct: 137 QCHRQIVPEITPPIQLSQLKDYLSEVNVVAYEEESKNGEHHAFTKALDALHT-----SIT 191

Query: 192 ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           I++GPEGG+  +E E +  +  V P S+G RILRS+TA +  ++++
Sbjct: 192 IIVGPEGGFDLQEVEKMQVMG-VVPCSIGNRILRSETAPLYMLSVI 236


>gi|86607114|ref|YP_475877.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus sp.
           JA-3-3Ab]
 gi|86555656|gb|ABD00614.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
          Length = 272

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 102/234 (43%), Gaps = 18/234 (7%)

Query: 5   SHLKRLFVDFPLCIKTQG--KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           S L RL +D P      G  + +G Q HYL  V R+K GD  L+ +G    WL+     G
Sbjct: 11  SSLPRLAID-PAQRDAGGVLRLTGPQEHYLQRVRRLKPGDPFLVLDGSGKLWLAHWQPQG 69

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNT 120
             +  +VE   R       +    + +K    D + ++  E+G   I P++T  T  +  
Sbjct: 70  SQVMGEVEALPRELPVY--LHLGLAVVKGPGFDEVFRQVTELGAARITPLLTERTVVEPG 127

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN---- 176
               +R +     AAEQC+ L  P + PPT       +W    +  +       EN    
Sbjct: 128 WGRRERWQKIVQEAAEQCERLRWPQVDPPTP----WTSWLAELKADWWGIAVARENAPLL 183

Query: 177 --SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
             +L KL      P +A+ IGPEGG+   E+    +   V P+SLG  ILRS T
Sbjct: 184 LQALPKLRLSERDPVLAVAIGPEGGWTEAERRQAEAHGGV-PVSLGTTILRSTT 236


>gi|123443620|ref|YP_001007592.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090581|emb|CAL13450.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 243

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 117/249 (46%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL   ++   S +  +++  VLRM EG ++ LF+G +  + ++I  V K  
Sbjct: 2   RIPRIYHPQPLQANSELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIIRVDKKN 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + + + ++S +      +  +  ++++ +QKS+E+G+  I P+   +++     
Sbjct: 62  LIVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVDVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P I     L       D + ++        S
Sbjct: 119 LDGERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCAAQDDSLKLNLHPRASNS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----SSLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|188534950|ref|YP_001908747.1| Conserved hypothetical protein YggJ [Erwinia tasmaniensis Et1/99]
 gi|188029992|emb|CAO97876.1| Conserved hypothetical protein YggJ [Erwinia tasmaniensis Et1/99]
          Length = 243

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 114/249 (45%), Gaps = 20/249 (8%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++   PL    +   S +  +++  VLRM  G  + LF+G D  + ++I+   K  
Sbjct: 2   RIPRIYHPAPLDAGNEIALSEEAANHVGRVLRMGPGQRLELFDGTDLTFAAEITQADKKN 61

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                + +R  +++S +      +  +  ++++ IQK+VE+G+  I P+   +++     
Sbjct: 62  VHVRIHTARDDSRESPLHLHLGQVMSRGEKMEFTIQKAVELGVNVITPL---FSERCGVK 118

Query: 124 MDRVR---------TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
           +D  R            I+A EQC    +P +    TLE      D   ++        S
Sbjct: 119 LDAERLAKKIQQWQKIAIAACEQCGRNRIPEVRQAMTLEAWCAEQDRGLKLNLHPRADHS 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 179 INTLP-----LPVERVRLLIGPEGGLSADEISMTARYGF-TDILLGPRVLRTETTALTAI 232

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 233 TALQVRFGD 241


>gi|16272258|ref|NP_438470.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae Rd
           KW20]
 gi|260581228|ref|ZP_05849047.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae RdAW]
 gi|1176097|sp|P44627|RSME_HAEIN RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|1573272|gb|AAC21968.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092153|gb|EEW76097.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae RdAW]
          Length = 245

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 122/262 (46%), Gaps = 45/262 (17%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI    K  
Sbjct: 2   RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKK- 60

Query: 66  RFKVEYQSRS-QTK