PSIBLAST alignment of GI: 254781160 and protein with PDB id: 1nxz

>gi|29726851|pdb|1NXZ|A Chain A, X-Ray Crystal Structure Of Protein Yggj_haein Of Haemophilus Influenzae. Northeast Structural Genomics Consortium Target Ir73. Length = 246
>gi|29726852|pdb|1NXZ|B Chain B, X-Ray Crystal Structure Of Protein Yggj_haein Of Haemophilus Influenzae. Northeast Structural Genomics Consortium Target Ir73 Length = 246
 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 111/247 (44%), Gaps = 15/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLR  EG+ + LF+G +  + +KI       
Sbjct: 1   RIPRIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIE-SNKK 59

Query: 66  RFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
             KVE    +   +     +       +  R ++ IQKSVE+G+  I P+ +        
Sbjct: 60  SVKVEILGRELADKESHLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLD 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 120 AERXDKKIQQWQKIAIAACEQCGRNIVPEIRPLXKLQDWCAENDGALKLNLHPRAHYSIK 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++ 
Sbjct: 180 TLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQICFGD 241