BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498
methyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (245 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040837|gb|ACT57633.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 245

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 245/245 (100%), Positives = 245/245 (100%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY
Sbjct: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT
Sbjct: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
           HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK
Sbjct: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI
Sbjct: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240

Query: 241 CGDWY 245
           CGDWY
Sbjct: 241 CGDWY 245


>gi|297183994|gb|ADI20114.1| uncharacterized protein conserved in bacteria [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 243

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 100/245 (40%), Positives = 139/245 (56%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M I S + RLFVD PL          DQ +YL +V+R+  GD I +FNGKDGEW    + 
Sbjct: 1   MNIRSKI-RLFVDTPLGEGQSILLDRDQANYLFNVMRLNIGDYISVFNGKDGEWQADVLH 59

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              +      +YQS  Q    D+  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGILVAKYQSMQQLNPPDLWLLFAPIKKTRTDFIVEKATEMGVSRIFPVNTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R+++++I AAEQC    +P +   + L  +LK+W  +  ++F DE    E    
Sbjct: 120 DRIKQSRLQSHSIEAAEQCGGTYVPPVDELSKLTSILKDWPKDRCLIFCDENKVGE--AV 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           K    +     AILIGPEGG+   E + L SL FVT +SLGPRILR+DTA VAA+A+ Q 
Sbjct: 178 KTFKSSVCDKWAILIGPEGGFSKNEIKYLKSLEFVTSISLGPRILRADTAVVAALAIWQK 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 EIGDW 242


>gi|254720129|ref|ZP_05181940.1| 16S ribosomal RNA methyltransferase RsmE [Brucella sp. 83/13]
          Length = 248

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 116/245 (47%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTDRIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAM LVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMVLVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|319405184|emb|CBI78789.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 247

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 122/245 (49%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  LKRLFV   L +  +    G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+ +
Sbjct: 1   MRANYKLKRLFVRQLLALNEEIVIEGQQASYLVHVLRMKEGTEILLFNGQDGEWLAKLIF 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K I   ++ +Q R QT  SD+ Y F+P+K  RLDYMIQK+VEMG+  + PVIT++TQ 
Sbjct: 61  IKKKIVVARLIHQERPQTTHSDLFYCFAPLKHMRLDYMIQKAVEMGVSVLYPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP   P  +LE  L+NWD    + F DE   S N + 
Sbjct: 121 TRINMARIEANIIEASEQCGILSLPKCAPAVSLETFLENWDKTRALFFCDELNESYNPIS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                   P + +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DTAAVAA+ LV A
Sbjct: 181 LFKKHGTNP-LGVLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADTAAVAALTLVNA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TMGDW 244


>gi|148253212|ref|YP_001237797.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium sp. BTAi1]
 gi|146405385|gb|ABQ33891.1| hypothetical protein BBta_1682 [Bradyrhizobium sp. BTAi1]
          Length = 250

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 105/237 (44%), Positives = 150/237 (63%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            RL+VD PL      +   DQ +YL +VLR+  G  +L+FNG+DGEW   I    +    
Sbjct: 9   PRLYVDAPLQHGAHVELDRDQSNYLGNVLRLGAGGRVLVFNGRDGEWQGLIGGRKRPDSL 68

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +E+++R Q + +D+ Y+F+P+K  RLDYM+QK+VEMG+ ++ PVITR+TQ +  N +R+
Sbjct: 69  TIEHRTRPQDRLADLAYVFAPLKHARLDYMVQKAVEMGVSSLAPVITRHTQVSRVNGERM 128

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC IL+L  +  P +LE  L     +  +VF DE     + L+ L   +  
Sbjct: 129 RANVIEAAEQCGILSLAEVREPVSLERFLAQRPPDRLLVFCDEAADVADPLQALRGGSDY 188

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +LIGPEGG+ SEE+E L   P V  ++LGPRILR+DTA VAA+AL+QA  GDW
Sbjct: 189 AGIDLLIGPEGGFASEERELLLRQPLVLRVALGPRILRADTAGVAALALIQATLGDW 245


>gi|144898953|emb|CAM75817.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 245

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 102/239 (42%), Positives = 152/239 (63%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-SI 65
           + RLFV   L   +      DQ HYLA+V+R+K G+++ LFNG+DGEWL ++  V K S+
Sbjct: 1   MIRLFVANDLSADSLIGLDKDQSHYLANVMRVKAGEDVALFNGRDGEWLGRLDKVAKASV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +V+ QSR QT + D+  + +PIK + +D + +K+ E+G+ A+ PV T  T  +  N D
Sbjct: 61  TLQVQSQSRPQTPEPDLWLLAAPIKKDCIDLVAEKATELGISALWPVFTHRTVMSRVNTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+    + AAEQC+ L++P +  PT L   L  WD    +VF DE+ G     + LH++ 
Sbjct: 121 RLAANMVEAAEQCERLSVPEMREPTDLAKALAGWDAARPLVFLDESGGGAPITQALHSLQ 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P +A+L GPEGG+   E+  L  LPF  P+SLGPRILR++TAA+AA+++VQA+ GDW
Sbjct: 181 PGP-LAVLTGPEGGFDDSERAMLARLPFAVPVSLGPRILRAETAAIAALSVVQALLGDW 238


>gi|49473945|ref|YP_031987.1| hypothetical protein BQ02980 [Bartonella quintana str. Toulouse]
 gi|49239448|emb|CAF25798.1| hypothetical protein BQ02980 [Bartonella quintana str. Toulouse]
          Length = 244

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I+  LKRLF+  PL +  + K  G +  YL HVLRM+EG  ILLFNG+DGEWL+K+  
Sbjct: 1   MHINYKLKRLFIRQPLVLNEEIKIEGQKASYLIHVLRMQEGAEILLFNGQDGEWLAKLIT 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K     K+ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKRFVVVKLIHQERLQTAPSNLIYCFAPLKNARLDYMVQKAVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  N  R+    + A+EQC IL+LP   P  +L  LL  WD    + F DE     N L 
Sbjct: 121 TRINRTRMEANVVEASEQCGILSLPECVPAVSLVELLACWDETQPLFFCDEAHKLHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L          +LIGPEGG+  EE+  L    FV P+ LGPRILR+DTAAV A+AL+ A
Sbjct: 181 LLKKHEMTVP-GVLIGPEGGFSKEERSFLKKHSFVIPIPLGPRILRADTAAVVALALLNA 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|167644342|ref|YP_001682005.1| 16S ribosomal RNA methyltransferase RsmE [Caulobacter sp. K31]
 gi|167346772|gb|ABZ69507.1| protein of unknown function DUF558 [Caulobacter sp. K31]
          Length = 238

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 97/239 (40%), Positives = 136/239 (56%), Gaps = 3/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLFV  PL +      + DQ  YL  V+R+  GD IL+FNG+DGEW   ++  GK   
Sbjct: 1   MIRLFVPHPLKVGAGVAPTVDQSRYLTAVMRLNVGDEILVFNGQDGEWRCGLTEAGKRGC 60

Query: 67  F-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             + E Q+R Q    D+  + + +K  R++ +++K+ E+G   +R   TR T      + 
Sbjct: 61  LLRCEEQTREQDHAPDLDLVVAMVKRGRVETIVEKAAELGARRVRLTQTRRTNVDFLKLG 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+    I AAEQ   L +P I  P  L+ +L  WD   ++VF DE   +   +E +    
Sbjct: 121 RLDAIAIEAAEQTGRLDVPVIDDPMKLDKILDTWDPARRLVFCDEGGDARTMIEAVT--G 178

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+  EE++ L SLPFV P+SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 179 TGAPAAILIGPEGGFAPEERKRLRSLPFVIPVSLGPRILRADTAAIAAMTLWQAAAGDW 237


>gi|297568502|ref|YP_003689846.1| protein of unknown function DUF558 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924417|gb|ADH85227.1| protein of unknown function DUF558 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 242

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 115/243 (47%), Gaps = 5/243 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-I 65
           ++R F+D       +   +G   H+L HVLR+  G+ + LF+G+   + + I ++     
Sbjct: 1   MRRFFIDPEAIQGREASLTGSDAHHLQHVLRLTPGERVELFDGRGTVYQAAIDHIEPGLT 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY--- 122
           R  +   S +   +  +    + +K  ++D ++QK  E+G+ ++RP  +++T        
Sbjct: 61  RLTLLSSSDTPPDRLAIHLGQAMLKGKKMDLVVQKCTELGVRSLRPYTSQHTTTPPPGAE 120

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
            + R +     + +QC+    P  +PP T   LL +       +   E   +        
Sbjct: 121 KLARWQRIIHESCKQCNQPWPPSCHPPQTFAELLADAADFDLRLICWEEPEAPPLSNIAE 180

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
            +    +V +LIGPEGG+  EE +      F+  + LG RILR++TA++  +AL+Q I  
Sbjct: 181 QLGAPASVLVLIGPEGGFSREEIDLARQAGFI-VIGLGRRILRAETASIVIIALLQYIFN 239

Query: 243 DWY 245
           D Y
Sbjct: 240 DLY 242


>gi|265985135|ref|ZP_06097870.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839033|ref|ZP_07471853.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264663727|gb|EEZ33988.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405856|gb|EFM62115.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 242

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 115/239 (48%), Positives = 154/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAM LVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMVLVQAVLGDW 238


>gi|254293386|ref|YP_003059409.1| 16S ribosomal RNA methyltransferase RsmE [Hirschia baltica ATCC
           49814]
 gi|254041917|gb|ACT58712.1| protein of unknown function DUF558 [Hirschia baltica ATCC 49814]
          Length = 256

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 90/253 (35%), Positives = 138/253 (54%), Gaps = 12/253 (4%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S + RLFV   L +      + +Q +YL  VLR+ + D + +FNG+DGEW + ++ V +
Sbjct: 1   MSTIPRLFVKADLTLGAPIALTSEQANYLFRVLRLSKNDAVRVFNGRDGEWRASVTEVMR 60

Query: 64  S-IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           S     +E     Q    D+Q +F+P+K    D++++K+ E+G+  I+PVIT+ TQ +  
Sbjct: 61  SAGFLCLEELIVPQAVIGDLQLLFAPLKKTCTDFVVEKATELGVTMIQPVITKRTQTSTV 120

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE--- 179
            + R+      AAEQ + L +P +  P  L   L  WD N ++VF DE            
Sbjct: 121 RVSRLEKIVEEAAEQTERLDIPLVQEPIQLLEALGKWDKNRRLVFCDEAGDDPTENWGGD 180

Query: 180 KLHAIAHIPNV--------AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
              A   +  +        AILIGPEGG+  EE++ L    +V P++LGPRILR++TAAV
Sbjct: 181 VGRARPMMEAISELKDGLAAILIGPEGGFSPEERKYLRQQDYVIPVTLGPRILRAETAAV 240

Query: 232 AAMALVQAICGDW 244
           +A+ L QA  GDW
Sbjct: 241 SALTLWQAARGDW 253


>gi|114570791|ref|YP_757471.1| 16S ribosomal RNA methyltransferase RsmE [Maricaulis maris MCS10]
 gi|114341253|gb|ABI66533.1| protein of unknown function DUF558 [Maricaulis maris MCS10]
          Length = 254

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 137/249 (55%), Gaps = 12/249 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLF+D PL        + +  HYL +V+R  EGD + +FNG+DGEW + I     K   
Sbjct: 5   PRLFIDAPLSASAAIPLAREDAHYLINVMRRGEGDVVRVFNGRDGEWSAVIAHASRKGAG 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V  Q+R Q    D+  +F+P++ ++ + +++K+ E+G   I PV+T  TQ+     +R
Sbjct: 65  LTVADQTRPQQGVPDLWLMFAPVRRSKTELIVEKATELGAAVIAPVVTERTQSDRIKFER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE------- 179
           ++  T  AAEQ + L LP +     L  +L NW  +  ++F DE+    ++         
Sbjct: 125 LQAITKEAAEQTERLDLPELRTSEKLAAVLDNWPDDRLLIFCDESGDEADAAWGGARGRG 184

Query: 180 ----KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
                  A A     AILIGPEGG+   E++ L SL  V P++LGPRILR++TAA+AA+ 
Sbjct: 185 QPMAAALAGAGDRPAAILIGPEGGFSPAERDRLRSLQHVVPVTLGPRILRAETAAIAALT 244

Query: 236 LVQAICGDW 244
           + Q+ CGDW
Sbjct: 245 IWQSTCGDW 253


>gi|75676748|ref|YP_319169.1| hypothetical protein Nwi_2564 [Nitrobacter winogradskyi Nb-255]
 gi|74421618|gb|ABA05817.1| Conserved hypothetical protein 46 [Nitrobacter winogradskyi Nb-255]
          Length = 257

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 104/245 (42%), Positives = 147/245 (60%), Gaps = 1/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           + I     RL+VD PL    +   + +Q +YL +VLR+  G N+L+FNG+DGEW + IS 
Sbjct: 4   LDIDFRSPRLYVDAPLAAGNRVPLNRNQGNYLGNVLRLGTGTNVLVFNGRDGEWRAAISG 63

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
             +    ++   +R Q    DV Y F+P+K  RLDYM+QK+VEMG  A++PV+TR+TQ  
Sbjct: 64  RKRPEHLEIVAATRKQDHLRDVHYAFAPLKHARLDYMVQKAVEMGASALQPVLTRFTQVG 123

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
             N +R+R   I AAEQC IL+L  +  P  L+  L        +VF DE   + N +  
Sbjct: 124 RVNGERMRANVIEAAEQCGILSLAAVEEPAQLDRWLGRRAGERLLVFCDEAASTANPVRA 183

Query: 181 LHA-IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           L    +    + +L+GPEGG+   E+E L + P +  LSLGPRILR+DTAAVA +ALVQ 
Sbjct: 184 LETVRSVARGIDVLVGPEGGFADNERENLLNQPNILRLSLGPRILRADTAAVAVLALVQT 243

Query: 240 ICGDW 244
           + GDW
Sbjct: 244 VLGDW 248


>gi|295687718|ref|YP_003591411.1| hypothetical protein Cseg_0273 [Caulobacter segnis ATCC 21756]
 gi|295429621|gb|ADG08793.1| protein of unknown function DUF558 [Caulobacter segnis ATCC 21756]
          Length = 238

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 133/239 (55%), Gaps = 3/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLFV   L        + DQ  YL  V+R+  GD +LLFNG+DGEW + I    K   
Sbjct: 1   MIRLFVPNDLSAGAGVVPTVDQSRYLTSVMRLSVGDEVLLFNGRDGEWRASIVEATKRGC 60

Query: 67  F-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             K + Q+R      D+  I + +K  R++ +++K+ E+G   +R  ITR T      + 
Sbjct: 61  LLKADVQTRPMDTGPDLDLIVAMVKRGRVETIVEKAAELGARRVRLTITRRTNVDFVKLG 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+    + AAEQ   L +P I  P  L+ +L  WD   ++VF DE   +  ++E L    
Sbjct: 121 RLDAIAMEAAEQTGRLDVPEIVDPEKLDKILDGWDPTRRLVFCDEGGDARPAIEALA--G 178

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+  EE+E L  L FVTP+SLGPRILR+DTAA++AM L QA  GDW
Sbjct: 179 TGAPAAILIGPEGGFAPEERERLRGLSFVTPVSLGPRILRADTAAISAMTLWQASAGDW 237


>gi|260431629|ref|ZP_05785600.1| surface protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415457|gb|EEX08716.1| surface protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 241

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 97/237 (40%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF- 67
           RL+VD PL        + +Q HYL  V+R+  G  + LFNG+DGEWL++++  GK     
Sbjct: 6   RLYVDHPLGAGQSVPLTREQAHYLFGVMRLAVGGQVALFNGRDGEWLAEVAEAGKRGGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  SCLEQTRPLQLPPDLWLLFAPIKKARTDFIVEKAAEMGAAKIMPVQTAFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ LL NW    Q++F DE      S  +L A    
Sbjct: 126 QAHAVEAAEQCGGTFVPEVCDLQRLDKLLDNWPDGRQLMFCDEAE--AGSALRLAAQDKG 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E++ L  LPF   +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 184 RPWAILIGPEGGFSDAERQRLKDLPFTHVVSLGPRILRADTAAVAAMTLWQQALGDW 240


>gi|126727781|ref|ZP_01743611.1| hypothetical protein RB2150_10474 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702908|gb|EBA02011.1| hypothetical protein RB2150_10474 [Rhodobacterales bacterium
           HTCC2150]
          Length = 246

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 134/240 (55%), Gaps = 4/240 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIRF 67
           RL+ D PL          DQ HYL  V+R K GD + LFNG+DGEW  K+          
Sbjct: 6   RLYTDHPLAQGHNIPLERDQAHYLFGVMRRKLGDEVELFNGRDGEWRGKVVHANKHRGIL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +V +Q+R      D+  +F+PIK  R D++++K+ EMG   I PV+T YT +     +++
Sbjct: 66  EVTHQTRPLQMPPDLWLMFAPIKKARTDFIVEKATEMGAARIVPVMTEYTNSDRVRQEKM 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS---LEKLHAI 184
           + + + AAEQC    +P +     L+ +L NW    Q++F DE      +     KL A+
Sbjct: 126 QIHAVEAAEQCGGTYVPEVAELQKLDRMLDNWPDGRQLLFCDEGLIGRPTGLDQSKLTAV 185

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                 AILIGPEGG+  +E+  L SL FVT  SLGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 186 NKTGPWAILIGPEGGFSEKERNRLASLDFVTTQSLGPRILRADTAAVAALTLWQRELGDW 245


>gi|259415138|ref|ZP_05739060.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259349048|gb|EEW60802.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 246

 Score =  168 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 129/241 (53%), Gaps = 5/241 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF- 67
           RL+VD PL          DQ HYL  V+R+  G  + LFNG+DGEW ++++   K     
Sbjct: 6   RLYVDHPLGAGQTVPLDRDQAHYLFGVMRLAVGARVALFNGRDGEWQAEVAEASKRSGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  TCVEQSKPLQLPPDLWLIFAPIKKARTDFIVEKAAEMGAARILPVATDFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL +W  + Q++F DE    +            
Sbjct: 126 QAHAVEAAEQCGGTYVPEVADLQKLSALLDHWPEDRQLMFCDEAEVGQRLFLDAVQSEKP 185

Query: 188 P----NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           P    + AILIGPEGG+   E++ L ++     +SLGPRILR+DTAAVAAM L Q   GD
Sbjct: 186 PTASGSWAILIGPEGGFSDAERKRLQAMQQAHVVSLGPRILRADTAAVAAMTLWQRALGD 245

Query: 244 W 244
           W
Sbjct: 246 W 246


>gi|197104001|ref|YP_002129378.1| hypothetical protein PHZ_c0535 [Phenylobacterium zucineum HLK1]
 gi|196477421|gb|ACG76949.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 239

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 93/239 (38%), Positives = 137/239 (57%), Gaps = 3/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           + RLFV   L    +      Q  YLA V+R K GD + +FNG+DGEW + ++ V  +++
Sbjct: 1   MIRLFVTHDLSAGAELALDEGQSRYLAAVMRAKAGDELRVFNGRDGEWRALVAAVGKRAV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +V   +R Q    D+  + + +K   L+ +++K+ E+G   IRPV+T  T   H  ++
Sbjct: 61  TLQVIDPARPQAPGPDLDLVVALVKRAPLETIVEKAAELGARRIRPVVTERTNADHTRVE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R     A+EQ   L +P +  P  LE LL  W+   +++F DE   +   LE L   A
Sbjct: 121 RLRAIATEASEQTGRLDVPEVTEPVKLERLLAEWEPGRRLLFCDEAGDARPVLEALEGAA 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+   E+E L +LP+  P SLGPRILR+DTAA++A+AL QA  GDW
Sbjct: 181 GP--WAILIGPEGGFSPREREALRALPYAVPASLGPRILRADTAAISALALWQAAAGDW 237


>gi|16127645|ref|NP_422209.1| hypothetical protein CC_3415 [Caulobacter crescentus CB15]
 gi|221236464|ref|YP_002518901.1| 16S ribosomal RNA methyltransferase RsmE [Caulobacter crescentus
           NA1000]
 gi|13425129|gb|AAK25377.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965637|gb|ACL96993.1| surface protein [Caulobacter crescentus NA1000]
          Length = 238

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 132/239 (55%), Gaps = 3/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLFV   L        + DQ  YL  V+R+  G  +LLFNG+DGEW + +    K   
Sbjct: 1   MIRLFVPNDLSAGAGVVPTVDQSRYLTSVMRLSVGAELLLFNGRDGEWRATLVEATKRGC 60

Query: 67  F-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             K E Q+R  T   D+  I + +K  R++ +++K+ E+G   +R  ITR T      + 
Sbjct: 61  LLKAEEQTRPMTLGPDLDLIVAMVKRGRVETIVEKAAELGARRVRLTITRRTNVDFVKLG 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+    + AAEQ   L +P +  P  L+ +L  WD   ++VF DE   +   +E L    
Sbjct: 121 RLDAIAMEAAEQTGRLDVPEVADPEKLDKILDAWDPARRLVFCDEGGDARPMIEALSGTT 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+  EE+E L  L FVTP+SLGPRILR+DTAA++AM L QA  GDW
Sbjct: 181 GPA--AILIGPEGGFAPEERERLRGLAFVTPVSLGPRILRADTAAISAMTLWQAAAGDW 237


>gi|85708013|ref|ZP_01039079.1| hypothetical protein NAP1_02220 [Erythrobacter sp. NAP1]
 gi|85689547|gb|EAQ29550.1| hypothetical protein NAP1_02220 [Erythrobacter sp. NAP1]
          Length = 253

 Score =  167 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 118/238 (49%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNG-KDGEWLSKISYVGKSIR 66
            RLFV+  L         G+Q HYL  V+R+  GD ++L +               + + 
Sbjct: 13  PRLFVEDELGDGRIFALEGNQAHYLGKVMRVSPGDTVILCDNITGEWAARVGQVEKRRVD 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V    R + +  D+    + +K +R D++++K+ E+G   I+P+ITR       NM+R
Sbjct: 73  LTVTDHLRPRGEVPDLWLCPALLKKDRFDFVLEKATELGSARIQPMITRRCVADKLNMER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
            R     AAEQC    LP I  P  L+ LL +W     I FADE  G   +        H
Sbjct: 133 ARIIATEAAEQCARTALPDIAEPVKLDALLADWPSERAIFFADEEGGEHAAD---AFCFH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E+  + + P    +SLGPRILR +TAA+AA+++  A  GDW
Sbjct: 190 EGPAAILIGPEGGFDDAERAAIRAHPQARAISLGPRILRGETAAIAALSVWMAEAGDW 247


>gi|85714212|ref|ZP_01045200.1| hypothetical protein NB311A_14712 [Nitrobacter sp. Nb-311A]
 gi|85698659|gb|EAQ36528.1| hypothetical protein NB311A_14712 [Nitrobacter sp. Nb-311A]
          Length = 256

 Score =  167 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 104/244 (42%), Positives = 148/244 (60%), Gaps = 1/244 (0%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
            I     RL+VD PL    +   + +Q +YL +VLR+  G N+L+FNG+DGEW + I   
Sbjct: 10  NIDFRSPRLYVDAPLAAGCRIPLNRNQGNYLGNVLRLGTGTNVLVFNGRDGEWRAAIFGR 69

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            +    ++   +R Q +  DV+Y F+P+K  RLDYM+QK+VEMG+ A++P++TR+TQ   
Sbjct: 70  KRLENLEIVAATRKQDQLPDVRYAFAPLKHARLDYMVQKAVEMGVCALQPLLTRFTQVGR 129

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
            N +R+R   I AAEQC IL+L  +  P +L+  L        +VF DE   + N L  L
Sbjct: 130 VNGERMRANVIEAAEQCGILSLAAVEEPASLDQWLGRRGPERLLVFCDEAASTANPLRTL 189

Query: 182 H-AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
             A      + +L+GPEGG+  +E+  L   P V  LSLGPRILR+DTAAVA +ALVQ +
Sbjct: 190 EPARRVAQGIDVLVGPEGGFAEDERVNLLKQPNVLRLSLGPRILRADTAAVAVLALVQTV 249

Query: 241 CGDW 244
            GDW
Sbjct: 250 LGDW 253


>gi|149913421|ref|ZP_01901954.1| hypothetical protein RAZWK3B_08971 [Roseobacter sp. AzwK-3b]
 gi|149812541|gb|EDM72370.1| hypothetical protein RAZWK3B_08971 [Roseobacter sp. AzwK-3b]
          Length = 241

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 98/237 (41%), Positives = 134/237 (56%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF- 67
           RL+V+ PL        + DQ HYL  V+R   GD +L FNG+DGEWL  +    K     
Sbjct: 7   RLYVEHPLGEGQTVPLNRDQAHYLFAVMRRGAGDALLAFNGRDGEWLVTVQEASKKGGVL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +VE Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 67  RVEKQTAPQRNPPDLWVLFAPIKKARTDFIVEKAAEMGAARILPVQTDFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + I AAEQC    +P +     L+ LL++W    Q++F DE         +       
Sbjct: 127 QAHAIEAAEQCGGTYVPEVADLQKLDQLLQDWPEGRQLMFCDEALA---GAAQNLGAVGG 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P  AILIGPEGG+   E+  LH+LPF  P+SLGPRILR+DTAAVAAM + Q   GDW
Sbjct: 184 PAWAILIGPEGGFSEAERARLHALPFAHPVSLGPRILRADTAAVAAMTVWQMALGDW 240


>gi|89070197|ref|ZP_01157525.1| hypothetical protein OG2516_16646 [Oceanicola granulosus HTCC2516]
 gi|89044213|gb|EAR50364.1| hypothetical protein OG2516_16646 [Oceanicola granulosus HTCC2516]
          Length = 237

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 95/242 (39%), Positives = 139/242 (57%), Gaps = 6/242 (2%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S + RL+VD PL          +Q HYL  V+R+ EG  +LLFNG+DGEW ++++  GK
Sbjct: 1   MSRI-RLYVDHPLGAGQTVPLIREQAHYLFGVMRLGEGAEVLLFNGRDGEWSARVAEAGK 59

Query: 64  SI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
                    Q+R      D+  +F+P+K  R D++++K+VEMG   + PV T +T +   
Sbjct: 60  RGGTLACAAQTRPLAPPPDLWLLFAPVKKARTDFIVEKAVEMGAARLCPVQTEFTNSERI 119

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
             DR++ + + AAEQC   T+P +     L+ LL  WD + +I+  DET   +++     
Sbjct: 120 RRDRLQAHAVEAAEQCGATTVPEVADLARLDRLLDGWDPSRRIMLCDETRAGDDAALPAE 179

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
                   AILIGPEGG+   E+  L +LPF  P++LGPRILR+DTAAVAA+ L Q   G
Sbjct: 180 PGPW----AILIGPEGGFSDAERARLAALPFTRPVALGPRILRADTAAVAALTLWQTQLG 235

Query: 243 DW 244
           DW
Sbjct: 236 DW 237


>gi|163738856|ref|ZP_02146269.1| hypothetical protein RGBS107_08461 [Phaeobacter gallaeciensis
           BS107]
 gi|161387661|gb|EDQ12017.1| hypothetical protein RGBS107_08461 [Phaeobacter gallaeciensis
           BS107]
          Length = 242

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 131/237 (55%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+ PL          DQ HYL  V+R   G  +LLFNG+DGEW ++++   K     
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQTVGAQLLLFNGEDGEWRAEVAEASKRSGVL 65

Query: 69  VEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ICQEQTRPLVLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL +W    Q++F DE      +L      A  
Sbjct: 126 QAHAVEAAEQCGGTYVPEVADLQKLSRLLDHWPEERQLMFCDEAEVGS-ALALASETAAQ 184

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AI+IGPEGG+   E++ LH+LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 185 APWAIVIGPEGGFSEAERKRLHALPQSHVVSLGPRILRADTAAVAALTVWQQRYGDW 241


>gi|163741896|ref|ZP_02149286.1| hypothetical protein RG210_04985 [Phaeobacter gallaeciensis 2.10]
 gi|161385069|gb|EDQ09448.1| hypothetical protein RG210_04985 [Phaeobacter gallaeciensis 2.10]
          Length = 242

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 131/237 (55%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+ PL          DQ HYL  V+R   G  +LLFNG+DGEW ++++   K     
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQTVGAQLLLFNGEDGEWRAEVAEASKRSGVL 65

Query: 69  VEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q+R      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ICQEQTRPLVLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  +L +W    Q++F DE      +L      A  
Sbjct: 126 QAHAVEAAEQCGGTYVPEVVDLQKLSRVLDHWPEERQLMFCDEAEVGS-ALALARDTAVQ 184

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AI+IGPEGG+   E++ LH+LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 185 APWAIVIGPEGGFSEAERKRLHALPQSHVVSLGPRILRADTAAVAALTVWQQRYGDW 241


>gi|192360419|ref|YP_001980593.1| hypothetical protein CJA_0070 [Cellvibrio japonicus Ueda107]
 gi|190686584|gb|ACE84262.1| conserved hypothetical protein TIGR00046 [Cellvibrio japonicus
           Ueda107]
          Length = 241

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 68/248 (27%), Positives = 117/248 (47%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ +  L    + +      H+L+ VLRM+ G  ++LFNG  GE+ + I  + K 
Sbjct: 1   MRIPRIYTNQTLLTGNKVQLEESASHHLSKVLRMQPGRELVLFNGAGGEFAATIDEISKR 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   +   ++     ++      +  R ++++QK+ E+G+  I P++T  T     
Sbjct: 61  HVTASIAAHNPHNRESPLQLELAIGISRGERFEWVLQKATELGVTKITPLMTERTEVKVS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     M+R +   ISA EQC    LP +  P  +   LK  D   + V          
Sbjct: 121 GERQEKIMERWQHILISACEQCQRNLLPQLSAPVPITDWLKTVDAELRFVLHHRDS---- 176

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             + L A     + A+LIGPEGG   +E        F   L+LGPR+LR++TA +AA+++
Sbjct: 177 --QTLPADKKPHSAALLIGPEGGLSDDEIALAKQQEFA-ALTLGPRVLRTETAPIAAISV 233

Query: 237 VQAICGDW 244
           VQ + GD+
Sbjct: 234 VQYLWGDF 241


>gi|89091936|ref|ZP_01164891.1| hypothetical protein MED92_07211 [Oceanospirillum sp. MED92]
 gi|89083671|gb|EAR62888.1| hypothetical protein MED92_07211 [Oceanospirillum sp. MED92]
          Length = 242

 Score =  165 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 118/247 (47%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R +   PL  K++ + S +   +++  LRMK GD ++LFNG   E+L+++S V K 
Sbjct: 1   MRIPRFYDPQPLSEKSEIQLSDEVVQHVSRALRMKVGDQLILFNGNGVEYLAELSQVEKR 60

Query: 65  I--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 VE    +      V    S  +  R+DY +QKS EMG+  I P+ +        
Sbjct: 61  KASAHIVETIQSNSETPLTVHIGQSLSRGERMDYAVQKSTEMGVHQITPLFSERCEVKLP 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     ++  +   ISA EQ   +  P I  P  L+  L   D   ++V    +     
Sbjct: 121 EERQAKRINHWQQIAISACEQSGRVNPPLIAKPENLKSWLAQQDAELKLVLHHHSE---- 176

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L  +    +VA+LIGPEGG   +E E      F  PL+LGPR++R++TA VAA+ L
Sbjct: 177 --MPLQEMKPPSSVALLIGPEGGLTEDEVELAQEFGF-KPLTLGPRVMRTETAPVAALTL 233

Query: 237 VQAICGD 243
           +  + GD
Sbjct: 234 LNYLWGD 240


>gi|149202038|ref|ZP_01879011.1| hypothetical protein RTM1035_11963 [Roseovarius sp. TM1035]
 gi|149144136|gb|EDM32167.1| hypothetical protein RTM1035_11963 [Roseovarius sp. TM1035]
          Length = 243

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 132/245 (53%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK      RL+V+ PL        +  Q HYL  V+R   GD +LLF+G+ GEW + +  
Sbjct: 1   MKAAK--IRLYVEHPLGEGQTIPLTQPQAHYLFGVMRQGVGDAVLLFDGRHGEWRADVIE 58

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK     +V  Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T  
Sbjct: 59  AGKRGGVLQVAEQTAPQRDPPDLWLLFAPIKKARTDFIVEKAAEMGAARIIPVQTEFTNA 118

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++ + + AAEQC    +P +     L+ +L +W  + Q++F DE     ++  
Sbjct: 119 ERIRQDRLQAHAVEAAEQCGGTFVPEVGDLHRLDRMLADWPKDRQLMFCDEGLAG-HAAT 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
               +      AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAAM L Q 
Sbjct: 178 LAGDLPRGAPWAILIGPEGGFSEAERARLAALPQAHAVSLGPRILRADTAAVAAMTLWQR 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 ALGDW 242


>gi|146276272|ref|YP_001166431.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554513|gb|ABP69126.1| protein of unknown function DUF558 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 257

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 93/250 (37%), Positives = 138/250 (55%), Gaps = 14/250 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+VD PL      + + DQ HYL  V+R+  G  +LLFNG+DGEW ++++  GK     
Sbjct: 7   RLYVDQPLGPGQPVRLTQDQAHYLFGVMRLARGAAVLLFNGRDGEWRAEVTEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+    +  D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  TCAAQTAPLRRPPDLWLMFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-------------CGS 174
           + + + AAEQC    +P +     L+ LL  W  + +I++ DE                 
Sbjct: 127 QAHAVEAAEQCGGTYVPEVAELAALDRLLSGWPADRRIMWCDENLLGARAGLLEGAGAIE 186

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E+  +       AILIGPEGG+  +E+  L  +P V P+SLGPRILR+DTAAVAA+
Sbjct: 187 ARGFEEAPSQPSPGPWAILIGPEGGFSEDEQARLRRMPQVVPVSLGPRILRADTAAVAAL 246

Query: 235 ALVQAICGDW 244
            L Q++ GDW
Sbjct: 247 TLWQSVLGDW 256


>gi|307296237|ref|ZP_07576064.1| protein of unknown function DUF558 [Sphingobium chlorophenolicum
           L-1]
 gi|306878039|gb|EFN09262.1| protein of unknown function DUF558 [Sphingobium chlorophenolicum
           L-1]
          Length = 248

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RL V+  L         G+  HYL  V+R+K  D +LLF+G+ GEW +K   + K    
Sbjct: 13  PRLHVETLLGEGVAVPVDGNPAHYLISVMRVKPDDIVLLFDGRSGEWAAKARDIRKRDLV 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+++     D     +PIK  R+D + +K+ E+G+  ++PV+TR       N DR
Sbjct: 73  LEVVSQTKAPENVPDFWLCCAPIKKGRIDLIAEKACELGVAKLQPVLTRRAVVDKLNFDR 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +  + + AAEQC    LP +     L+ L+++W  +  + FADET G   +       AH
Sbjct: 133 LHAHLVEAAEQCGRTALPDLSEMVKLDALIRDWPDDRWLFFADETGGEPLADTLK---AH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               A LIGPEGG+   E+E +  +    P+SLGPRILR++TAA+AA +    I GDW
Sbjct: 190 PGPAAFLIGPEGGFDPAEREAIRGVAKAVPVSLGPRILRAETAAIAATSAWMTINGDW 247


>gi|302381943|ref|YP_003817766.1| hypothetical protein Bresu_0829 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192571|gb|ADL00143.1| protein of unknown function DUF558 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 237

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 139/239 (58%), Gaps = 5/239 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           + RL V  PL        + DQ  YL  V+R+K GD++L+FNG+DGEW + +  +  K +
Sbjct: 1   MIRLHVTQPLAPGAAVAPTLDQSRYLTQVMRLKLGDDLLVFNGRDGEWRATLVEILKKGV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             + E Q R Q    D++ I + +K +R++ +++K+ E+G   +R  IT+ T   H  +D
Sbjct: 61  ILRAEDQVRPQAYGPDLELIVAVVKKSRVETIVEKAAELGAARVRLTITQRTNVDHVRLD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+    I AAEQ   L +P +  P  L  LL  WD + +++F DET           A+ 
Sbjct: 121 RLDAIAIEAAEQTGRLDVPTVDDPQKLGALLDGWDPSRRLMFCDETG----GAPVASAVT 176

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+  EE++ L +LPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 177 ESGPWAILIGPEGGFSPEERDRLRALPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 235


>gi|99078057|ref|YP_611315.1| 16S ribosomal RNA methyltransferase RsmE [Ruegeria sp. TM1040]
 gi|99035195|gb|ABF62053.1| protein of unknown function DUF558 [Ruegeria sp. TM1040]
          Length = 246

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 130/241 (53%), Gaps = 5/241 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF- 67
           RL+VD PL          DQ HYL  V+R+     + LFNG+DGEW ++++  GK     
Sbjct: 6   RLYVDHPLGAGQTVPLDRDQAHYLFGVMRLSVAARVALFNGRDGEWQAEVAEAGKRGGVL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  ACLEQSKPLQLPPDLWLIFAPIKKARTDFIVEKAAEMGAARILPVATEFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL +W    Q++F DE    +     +  +   
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLPSLLDHWPAERQLMFCDEAEIGQRLFLDVAQVEGS 185

Query: 188 PN----VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
                  AILIGPEGG+   E++ LH++P    +SLGPRILR+DTAAVAA+ L Q   GD
Sbjct: 186 AGAAGPWAILIGPEGGFSDAERKRLHAMPQAHVVSLGPRILRADTAAVAALTLWQQRLGD 245

Query: 244 W 244
           W
Sbjct: 246 W 246


>gi|85703484|ref|ZP_01034588.1| hypothetical protein ROS217_22122 [Roseovarius sp. 217]
 gi|85672412|gb|EAQ27269.1| hypothetical protein ROS217_22122 [Roseovarius sp. 217]
          Length = 243

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 132/245 (53%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK      RL+++ PL        S  Q HYL  V+R   GD +L+FNG+ GEW +++  
Sbjct: 1   MKAAK--IRLYLEHPLGEGQTIPLSQPQAHYLFGVMRQGVGDAVLVFNGEAGEWRAEVIE 58

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK     ++  Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +
Sbjct: 59  AGKRGGILQIAEQTAPQRDPPDLWLMFAPIKKARTDFIVEKAAEMGAARIIPVQTEFTNS 118

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++ + + AAEQC    +P +     L+ +L +W    Q++F DE      +  
Sbjct: 119 ERIRQDRLQAHAVEAAEQCGGTYVPEVSDLHRLDRMLADWPEARQVMFCDEALAG-CAEG 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
               +      AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAAM L Q 
Sbjct: 178 LGRDLPRGAPWAILIGPEGGFSEAERARLAALPQAHAVSLGPRILRADTAAVAAMTLWQN 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 SLGDW 242


>gi|90020116|ref|YP_525943.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
 gi|89949716|gb|ABD79731.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
          Length = 241

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 119/247 (48%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+++D P+         G   HYL  VLRM+ G  ++LFNGK GE+ + I   GK 
Sbjct: 1   MRIPRIYIDKPITANANLDLDGPTAHYLLKVLRMESGRELILFNGKGGEYSAVIESAGKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
             F    ++ +R        +      + +R+D+++QK+ E+G+  I P+    ++    
Sbjct: 61  NVFCKVGKHNTRESESSLQTELAIGISRGDRMDWVLQKATELGVSRIIPLFADRSEVKLK 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  M   +   ISA EQC   TLP + P   L+  L +     + V    T     
Sbjct: 121 GERLEKKMQHWQQILISACEQCTRNTLPTLLPACPLDEYLASTQAEQKFVLHHRT----- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             +KL  I    + A+LIGPEGG    E +      F   L+LGPRILR++TA +AA+++
Sbjct: 176 -HKKLRDITKPKSAALLIGPEGGLTDNEIQNAERKGF-NALALGPRILRTETAPIAALSI 233

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 234 LQFVWGD 240


>gi|90426187|ref|YP_534557.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisB18]
 gi|90108201|gb|ABD90238.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisB18]
          Length = 251

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 101/244 (41%), Positives = 146/244 (59%), Gaps = 2/244 (0%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           I     RL+VD  L    Q   + +Q +YL +VLR+  G  +L+FNG+DGEW + I    
Sbjct: 4   IEFRSPRLYVDADLSAGLQVPLTREQGNYLGNVLRLSAGAAVLVFNGRDGEWQAMIGAGK 63

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +  R  +  ++R+Q    DV Y+F+P+K  RLDYM+QK++EMG  A++PV+TR+TQ T  
Sbjct: 64  RVDRLDILSRARAQDGLPDVTYVFAPLKHARLDYMVQKAIEMGACALQPVLTRFTQVTRV 123

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
           N +R+R   I AAEQC IL++  +  P  LE  L   D    +VF DE     + +  L 
Sbjct: 124 NTERMRANVIEAAEQCGILSIAAVEEPLKLERYLSTRDTGRLLVFCDEAAEVADPVAALG 183

Query: 183 AIAHIPN--VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                 +  + ++IGPEGG+  EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQ +
Sbjct: 184 GARERASAGIDVVIGPEGGFAEEERALLLRQPNILRLALGPRIMRADTAAVAALTLVQTV 243

Query: 241 CGDW 244
            GDW
Sbjct: 244 LGDW 247


>gi|254475767|ref|ZP_05089153.1| conserved hypothetical protein TIGR00046 [Ruegeria sp. R11]
 gi|214030010|gb|EEB70845.1| conserved hypothetical protein TIGR00046 [Ruegeria sp. R11]
          Length = 242

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 129/237 (54%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V+ PL          DQ HYL  V+R   G  + LFNG+DGEW ++I+  GK     
Sbjct: 6   RLYVEHPLGAGQSVPLDRDQAHYLFGVMRQAVGGQVSLFNGRDGEWRAEIAEAGKRNGLL 65

Query: 69  VEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V   QSR      D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  VCQEQSRPLMLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTDFTNSDRIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  +L  W    Q++F DE      +L    A    
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLSRVLDQWPQERQLMFCDEAEVGT-ALTLAAADHAK 184

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AI+IGPEGG+   E++ LH LP    +SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 185 APWAIVIGPEGGFSEAERKRLHGLPQSHVVSLGPRILRADTAAVAALTIWQQAYGDW 241


>gi|332799054|ref|YP_004460553.1| Ribosomal RNA small subunit methyltransferase E [Tepidanaerobacter
           sp. Re1]
 gi|332696789|gb|AEE91246.1| Ribosomal RNA small subunit methyltransferase E [Tepidanaerobacter
           sp. Re1]
          Length = 252

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV   L I  Q   SG+  H++  VLR + GD I + +G + E +  I  +     
Sbjct: 1   MSRFFVFQDLNINDQITISGEDAHHIIRVLRYQTGDVIHISDGANTESIGVILDIDTQGP 60

Query: 67  ---FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH-- 121
               K+  +++ ++    +       K  + D+++QK+ E+G+    P+IT+ T      
Sbjct: 61  SVKLKIIEKNKVESISPYITLFQGLPKGEKFDWILQKNTEIGVSEFIPIITQRTVVNISP 120

Query: 122 ----YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
               +  +R       AA+QC  + +P I    + +  L+        +   E     + 
Sbjct: 121 SKLGHRKNRWGKIVKEAAKQCMRMDIPKIGDVLSFDLALQEIKKYSLCIIPWENEKEISI 180

Query: 178 LEKLHAIAHIPN---VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              +  +    +   +A+ IG EGG+  +E E   +   V P+SLGPRILR++TA + A 
Sbjct: 181 RHIIKDMNENKSISKIAVFIGSEGGFSKDEVEKAKAAGAV-PVSLGPRILRTETAGIVAC 239

Query: 235 ALVQAICGD 243
           +++    GD
Sbjct: 240 SVLMYEIGD 248


>gi|84499775|ref|ZP_00998063.1| hypothetical protein OB2597_07590 [Oceanicola batsensis HTCC2597]
 gi|84392919|gb|EAQ05130.1| hypothetical protein OB2597_07590 [Oceanicola batsensis HTCC2597]
          Length = 241

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 128/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           RL+VD  L        + DQ HYL  V+RM  GD + LFNG+ GEW +++     ++   
Sbjct: 7   RLYVDHALGEGQTVPLARDQAHYLFGVMRMGVGDAVALFNGRAGEWRAEVVEAGKRAGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   QS  Q    D+   F+PIK  R D++++K+ EMG   I PV T +T +    +DR+
Sbjct: 67  ECVGQSAPQMDPPDLWLAFAPIKKARTDFIVEKATEMGARRILPVQTDFTNSERVRIDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +  P  L  LL  W    Q++F DE      +     + A  
Sbjct: 127 QAHCVEAAEQCGGTFVPEVAEPVKLGTLLSGWPEGRQLMFCDEALAGGPAALPTRSDAPW 186

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+  L  +    P++LGPR+LR+DTAAVAA+ L Q   GDW
Sbjct: 187 ---AILIGPEGGFSEAERARLRGMDQAHPVALGPRVLRADTAAVAALTLWQDRLGDW 240


>gi|312114482|ref|YP_004012078.1| hypothetical protein Rvan_1732 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219611|gb|ADP70979.1| protein of unknown function DUF558 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 242

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 141/241 (58%), Gaps = 2/241 (0%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             ++R+FV   L    +      Q HYL +VLR+ EG  +L F+G  GEW +KI    KS
Sbjct: 1   MAMQRIFVANKLDPDGEIALDTAQAHYLLNVLRLSEGAEVLTFDGTSGEWRAKIVKARKS 60

Query: 65  -IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
               ++  + R QT  + + Y F+P+K  RLDYM+QK+VEMG   ++PVIT++T      
Sbjct: 61  ACTIRLMEKVREQTAPTGIHYAFAPLKQARLDYMVQKAVEMGASLLQPVITQHTAVPRLG 120

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
            DR++   I AAEQC +LTLP I  P      L+ +D +  +VF DE     + L+ L A
Sbjct: 121 ADRMKANAIEAAEQCGVLTLPEIKAPVKFAAFLQAFDKDRALVFCDERAEVASPLDALSA 180

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           ++    V  LIGPEGG+   E+  L S  FV P+SLGPRI+R+DTAAVA +AL+    GD
Sbjct: 181 LS-GRKVTALIGPEGGFSENERADLLSRSFVCPISLGPRIMRADTAAVAVLALLNVTVGD 239

Query: 244 W 244
           W
Sbjct: 240 W 240


>gi|254463111|ref|ZP_05076527.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679700|gb|EDZ44187.1| conserved hypothetical protein TIGR00046 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 240

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 98/238 (41%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            RLFVD PL        S  Q HYL  V+R+  G  + LFNGKDGEW  +I   GK    
Sbjct: 5   TRLFVDQPLAEGNCVSVSQAQAHYLFGVMRLAVGGAVSLFNGKDGEWRCEILEAGKRKGV 64

Query: 68  -KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +   Q++      D+   F+PIK  R D++++K+ EMG   I PV T +T +     +R
Sbjct: 65  LRCTVQTKPLQMPPDLWLCFAPIKKTRTDFIVEKATEMGASKICPVQTEFTNSERIKQER 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++ + + AAEQC    +P +   + L  +L +W    QI+F DET   E  +    A A 
Sbjct: 125 LQAHAVEAAEQCGGTYVPEVIALSKLSTMLDHWPEERQIMFCDET---ELGVASSLASAS 181

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E++ LHS+P    +SLGPRILR+DTAAVAAM + QA  GDW
Sbjct: 182 RGPWAILIGPEGGFSPAERKRLHSMPEAHVVSLGPRILRADTAAVAAMTIWQAALGDW 239


>gi|84685244|ref|ZP_01013143.1| hypothetical protein 1099457000257_RB2654_10264 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666976|gb|EAQ13447.1| hypothetical protein RB2654_10264 [Rhodobacterales bacterium
           HTCC2654]
          Length = 241

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 138/245 (56%), Gaps = 5/245 (2%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M   + + RLFVD  L          D+ HYL  V+R   GD + LFNG+DGEW ++++ 
Sbjct: 1   MIERAKI-RLFVDESLREGQTIPLERDKAHYLFGVMRQAVGDRVALFNGRDGEWTAEVTL 59

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK         Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV+T +T +
Sbjct: 60  AGKRNGVLTCLGQAAPQLDPPDLWLMFAPIKKARTDFIVEKAAEMGASRIVPVLTEFTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               +DR++ + + AAEQC    +P +  P  L+ LL  WD   +++F DE    EN   
Sbjct: 120 ERVRVDRLQAHAVEAAEQCGGTFVPEVAEPEKLDRLLDGWDGARRLMFCDEALAGEN--- 176

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           K  + A     AILIGPEGG+   E++ LH +     +SLGPRILR+DTAAVAAM L Q+
Sbjct: 177 KPLSGAAGAPWAILIGPEGGFSDAERKRLHGMESAVSVSLGPRILRADTAAVAAMTLWQS 236

Query: 240 ICGDW 244
             GDW
Sbjct: 237 ALGDW 241


>gi|256004286|ref|ZP_05429268.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           2360]
 gi|255991720|gb|EEU01820.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           2360]
          Length = 254

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 119/247 (48%), Gaps = 9/247 (3%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK- 63
             + R FV            SG+ ++++  VLR+ +GD + + +G+  ++L +I  +   
Sbjct: 6   FKMPRFFVRKSDIYGDFINISGEDFNHIKKVLRLGKGDKVTVCDGEGTDYLVEIEKIEDA 65

Query: 64  -SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
                 VE    +      V       K++++DY+IQK+VE+G+  I PVIT  T     
Sbjct: 66  VINTRIVEAMKNATEPPLKVTLFQGLPKSDKMDYIIQKAVELGINEIVPVITERTVVKMD 125

Query: 123 ------NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                   +R    ++ AA+QC+   +P +  P + +  L N   +   +   E      
Sbjct: 126 EKSGSKKYERWNRISMEAAKQCNRGIIPKVGIPLSFKEALDNAKGSSLALIPYEKETGIK 185

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             E L + + +  V++ IGPEGG+   E ET  S   + P++LGPRILR++TA +A +++
Sbjct: 186 LKEVLSSSSSVEKVSVFIGPEGGFTETEIETAVSCG-ICPVTLGPRILRTETAGIAVLSI 244

Query: 237 VQAICGD 243
           +    GD
Sbjct: 245 LMYELGD 251


>gi|288957600|ref|YP_003447941.1| ribosomal RNA small subunit methyltransferase [Azospirillum sp.
           B510]
 gi|288909908|dbj|BAI71397.1| ribosomal RNA small subunit methyltransferase [Azospirillum sp.
           B510]
          Length = 259

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 134/238 (56%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR- 66
            RL+VD PL          ++ H+L HVLR+  GD + +FNG+DGEW + I   GK    
Sbjct: 7   TRLYVDSPLAEGQSVGLDHERAHFLRHVLRLDRGDAVAVFNGRDGEWRAVIDGFGKGWCS 66

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +  Q R Q    D+  +F+P+K  R+D++ +K+ EMG+  + PV TR T     N+DR
Sbjct: 67  LTLAEQRREQDTGPDLWLVFAPLKKGRIDFVAEKATEMGVSRLCPVFTRRTDPNRVNLDR 126

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   + AAEQC+ L++P +     L+  L  W    ++    E   +    E L   A 
Sbjct: 127 LRANAVEAAEQCERLSVPDLADALPLDRALAAWPAERRLYLCAEAGAARPIAEVLRDAAA 186

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
            P  A+L+GPEGG+   E + L  LPFV P+ LGPRILR+DTA VAA+A  Q++ GDW
Sbjct: 187 GP-AALLVGPEGGFDQSELDELAKLPFVVPVGLGPRILRADTAVVAALACWQSLAGDW 243


>gi|56698449|ref|YP_168823.1| 16S ribosomal RNA methyltransferase RsmE [Ruegeria pomeroyi DSS-3]
 gi|56680186|gb|AAV96852.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 251

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 130/246 (52%), Gaps = 10/246 (4%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+V+  L      + S DQ HYL  V+R+  GD + LFNG+DGEW +++   GK     
Sbjct: 6   RLYVEQALGQGQPVQVSRDQAHYLFGVMRLGVGDWVALFNGRDGEWQARVGEAGKRGGEL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             E QS       D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 66  LCESQSAPLRMPPDLWLLFAPIKKARTDFIVEKAAEMGAARIVPVQTEFTNSERIRQDRL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL--------- 178
           + + + AAEQC    +P +     L  LL  W    Q++F DET    +S          
Sbjct: 126 QAHAVEAAEQCGGTYVPEVAELQKLGPLLDRWPAERQLMFCDETLAGRSSALSGLLAGQG 185

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E           AILIGPEGG+   E+  L +LP    +SLGPRILR+DTAAVAA+ L Q
Sbjct: 186 ENARTGGPSGPWAILIGPEGGFSERERARLAALPNAHAVSLGPRILRADTAAVAALTLWQ 245

Query: 239 AICGDW 244
              GDW
Sbjct: 246 QALGDW 251


>gi|294010080|ref|YP_003543540.1| hypothetical protein SJA_C1-00940 [Sphingobium japonicum UT26S]
 gi|292673410|dbj|BAI94928.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 253

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RL V+  L         G+  HYL  V+R+K  D +LLF+G+ GEW +K   + K    
Sbjct: 18  PRLHVETQLGEGVSVPVDGNPAHYLISVMRVKADDIVLLFDGRSGEWAAKARDIRKRDLV 77

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  ++R      D     +PI+  R+D + +K+ E+G+  ++PV+TR       N+DR
Sbjct: 78  LEVVSRTRPPEDVPDFWLCCAPIRKGRIDLVAEKACELGVARLQPVLTRRAVVDKLNLDR 137

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +  + + AAEQC    LP +     L+ LL++W     + FADE+ G   +       AH
Sbjct: 138 LYAHLVEAAEQCGRTALPELGQMAKLDALLRDWPEGRWLFFADESGGEPLADTLK---AH 194

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               A LIGPEGG+   E+E +  +    P+SLGPRILR++TAA+AA +    I GDW
Sbjct: 195 PGPAAFLIGPEGGFDPAEREAIRRVAKAIPVSLGPRILRAETAAIAATSAWMTINGDW 252


>gi|260575962|ref|ZP_05843957.1| protein of unknown function DUF558 [Rhodobacter sp. SW2]
 gi|259021888|gb|EEW25189.1| protein of unknown function DUF558 [Rhodobacter sp. SW2]
          Length = 245

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 98/238 (41%), Positives = 138/238 (57%), Gaps = 2/238 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD PL +      + DQ +YL  V+R+  GD +LLFNG+DGEW   ++  GK     
Sbjct: 7   RLYVDQPLGVGQPVPLNADQANYLFAVMRLGRGDAVLLFNGRDGEWRGVVAEAGKRGGVL 66

Query: 69  VEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V   Q+R      D+  +F+PIK  R D++++K+ E+G   I PV TR+T       DR+
Sbjct: 67  VCDAQTRPLQMPPDLWLLFAPIKKARTDFIVEKAAELGASRILPVQTRFTNAERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET-CGSENSLEKLHAIAH 186
           + + + AAEQC    +P +     L+ +L  W    ++++ DE   G  ++L  L A A 
Sbjct: 127 QAHAVEAAEQCGGTFVPEVCDLQGLDKVLDTWPAERRLLWCDEHMVGGSSALTGLLATAR 186

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E+  L  LP V P+SLGPRILR+DTAAVAA+ L QA  GDW
Sbjct: 187 GGPWAILIGPEGGFAESEQARLRGLPQVVPISLGPRILRADTAAVAALVLWQAALGDW 244


>gi|77464587|ref|YP_354091.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           2.4.1]
 gi|77389005|gb|ABA80190.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 257

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 93/250 (37%), Positives = 137/250 (54%), Gaps = 14/250 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGPGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             + Q+       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCKDQTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-------------GS 174
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+                
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGLLEAAGGFE 186

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E+          AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVAA+
Sbjct: 187 ARGFEEGPKRPSPGPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVAAL 246

Query: 235 ALVQAICGDW 244
            L Q++ GDW
Sbjct: 247 TLWQSVLGDW 256


>gi|255264688|ref|ZP_05344030.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255107023|gb|EET49697.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 239

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+VD  L        + +Q HYL  V+R    + + LFNG+DGEW +++   GK     
Sbjct: 6   RLYVDHDLGAGQSVLLTKEQAHYLFGVMRKGVDEVLSLFNGRDGEWDARVVEAGKRKGIL 65

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
             E QS+      DV  +F+PIK  R D++++K+ EMG   I PV T +T +     +++
Sbjct: 66  VCEAQSKPLQLPPDVWLMFAPIKKARTDFIVEKATEMGAARIMPVQTEFTNSDRVRHEKL 125

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
             + + AAEQC    +P + P   L  +L  W  + +++F DE      ++    +    
Sbjct: 126 VAHAVEAAEQCGGTYVPPVDPLAKLTKVLAAWPEDRKLLFCDEALVGAQAVFAEASH--- 182

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E+E L + P+VT  SLGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 183 DKWAILIGPEGGFSQAERELLGAKPYVTQASLGPRILRADTAAVAALTLWQTTQGDW 239


>gi|159045639|ref|YP_001534433.1| 16S ribosomal RNA methyltransferase RsmE [Dinoroseobacter shibae
           DFL 12]
 gi|157913399|gb|ABV94832.1| protein of unknown function DUF558 [Dinoroseobacter shibae DFL 12]
          Length = 249

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 122/238 (51%), Gaps = 2/238 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGK-DGEWLSKISYVGKSIRF 67
           RL+V+ PL        SG Q HYL  V+R   G+ + LFNG         +    +    
Sbjct: 11  RLYVEHPLGQGQTVPLSGAQAHYLFGVMRRGVGEVVTLFNGHAGAWAARVVEAGKRGGVL 70

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +VE Q+  Q    D+   F+PIK  R D++++K+ EMG   I PV T +T       DR+
Sbjct: 71  EVETQTAPQRDPPDLWLCFAPIKKARTDFIVEKAAEMGARRIVPVQTAFTNAERIRRDRL 130

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ LL +W  +  ++F DE    E +       A  
Sbjct: 131 QAHAVEAAEQCGGTFVPEVADLVGLDRLLSDWPSDRSLMFCDEALAEEGAAAAADTPALP 190

Query: 188 PN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E+  L ++P    + LGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 191 DGPWAILIGPEGGFSEPERARLRAMPQAQSVRLGPRILRADTAAVAALTLWQIRYGDW 248


>gi|300024089|ref|YP_003756700.1| hypothetical protein Hden_2583 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525910|gb|ADJ24379.1| protein of unknown function DUF558 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 248

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 101/237 (42%), Positives = 146/237 (61%), Gaps = 2/237 (0%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF+   L      + +  Q HYL +VLR++ G  +L+FNG+DGEW + +    K     
Sbjct: 10  RLFIADDLAAGVSVELAQQQAHYLTNVLRLRPGAKLLVFNGRDGEWQASLIESRKRTTVL 69

Query: 69  -VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +E Q+R Q +  D+ Y+F+P+K +RLDYM+QK+ EMG+  +RPVIT  T     N +R+
Sbjct: 70  GIEEQTRPQEQGPDIDYLFAPLKRSRLDYMVQKATEMGVRRLRPVITERTIAERVNSERM 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
               I AAEQC IL +P + PP +LE  L  WD    +++ DE   + + +  L  +   
Sbjct: 130 LANAIEAAEQCGILRVPEVEPPVSLETALAAWDPARALIYCDEHETAADPIATLRKVPAG 189

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           P VA+LIGPEGG+ + E+  L +  +V PL LGPRI+R+DTAAVAA+ LV A+ GDW
Sbjct: 190 P-VAVLIGPEGGFSNGERSRLLANSYVVPLPLGPRIMRADTAAVAALTLVNAVLGDW 245


>gi|163732851|ref|ZP_02140296.1| hypothetical protein RLO149_13455 [Roseobacter litoralis Och 149]
 gi|161394211|gb|EDQ18535.1| hypothetical protein RLO149_13455 [Roseobacter litoralis Och 149]
          Length = 247

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 134/237 (56%), Gaps = 5/237 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIRF 67
           RL+VD PL        S DQ HYL  V+R+  G ++L+F+G+ GEWL++++    ++   
Sbjct: 14  RLYVDHPLGEGQSVPVSRDQAHYLFGVMRLGVGAHVLVFDGQSGEWLAEVAQAGKRAGEL 73

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            +  Q+R      D+  +F+PIK  R D++++K+VEMG   I PV T +T       DR+
Sbjct: 74  HLLRQTRPLLMPPDLWLLFAPIKKARTDFIVEKAVEMGAARIMPVQTEFTNAGRIQRDRL 133

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+++L  WD    I+F DE    E+      A    
Sbjct: 134 QAHAVEAAEQCGGTFVPKVDDLARLDWVLGGWDTTRSIMFCDEERAGESLTLLQKAGPW- 192

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E E L SL    P+SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 193 ---AILIGPEGGFSPREHEKLGSLAHAHPVSLGPRILRADTAAVAALTVWQQALGDW 246


>gi|126463427|ref|YP_001044541.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105091|gb|ABN77769.1| protein of unknown function DUF558 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 257

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 93/250 (37%), Positives = 136/250 (54%), Gaps = 14/250 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGRGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAETGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCTDQTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-------------GS 174
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+                
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGLLEAAGGFE 186

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E+          AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVAA+
Sbjct: 187 ARGFEEGPKRPSPRPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVAAL 246

Query: 235 ALVQAICGDW 244
            L Q++ GDW
Sbjct: 247 TLWQSVLGDW 256


>gi|332559480|ref|ZP_08413802.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           WS8N]
 gi|332277192|gb|EGJ22507.1| 16S ribosomal RNA methyltransferase RsmE [Rhodobacter sphaeroides
           WS8N]
          Length = 257

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 92/250 (36%), Positives = 137/250 (54%), Gaps = 14/250 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+V+ PL        + DQ HYL  V+R+  G  + LFNG+DGEW ++++  GK     
Sbjct: 7   RLYVEQPLGRGQPVPLTQDQAHYLFGVMRLARGAAVSLFNGRDGEWRAEVAEAGKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
              +++       D+  +F+PIK  R D++++K+ EMG   I PV TR+T +     DR+
Sbjct: 67  LCTHRTAPLRLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTRFTNSERIRQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC-------------GS 174
           + + + AAEQC    +P +   T LE LL +W  + +I++ DE+                
Sbjct: 127 QAHAVEAAEQCGGTFVPEVADLTNLERLLADWPADRRIMWCDESLVGARAGLLEAAGGFE 186

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E+          AILIGPEGG+  EE+  L  +  V P+SLGPRILR+DTAAVAA+
Sbjct: 187 ARGFEEGPKRPSPGPWAILIGPEGGFSEEEQARLRRMEQVVPVSLGPRILRADTAAVAAL 246

Query: 235 ALVQAICGDW 244
            L Q++ GDW
Sbjct: 247 TLWQSVLGDW 256


>gi|125973834|ref|YP_001037744.1| hypothetical protein Cthe_1319 [Clostridium thermocellum ATCC
           27405]
 gi|281417994|ref|ZP_06249014.1| protein of unknown function DUF558 [Clostridium thermocellum JW20]
 gi|125714059|gb|ABN52551.1| protein of unknown function DUF558 [Clostridium thermocellum ATCC
           27405]
 gi|281409396|gb|EFB39654.1| protein of unknown function DUF558 [Clostridium thermocellum JW20]
 gi|316939970|gb|ADU74004.1| protein of unknown function DUF558 [Clostridium thermocellum DSM
           1313]
          Length = 247

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 119/245 (48%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--S 64
           + R FV            SG+ ++++  VLR+ +GD + + +G+  ++L +I  +     
Sbjct: 1   MPRFFVRKSDIYGDFINISGEDFNHIKKVLRLGKGDKVTVCDGEGTDYLVEIEKIEDAVI 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               VE    +      V       K++++DY+IQK+VE+G+  I PVIT  T       
Sbjct: 61  NTRIVEAMKNATEPPLKVTLFQGLPKSDKMDYIIQKAVELGINEIVPVITERTVVKMDEK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R    ++ AA+QC+   +P +  P + +  L N   +   +   E        
Sbjct: 121 SGSKKYERWNRISMEAAKQCNRGIIPKVGIPLSFKEALDNAKGSSLALIPYEKETGIKLK 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + + +  V++ IGPEGG+   E ET  S   + P++LGPRILR++TA +A ++++ 
Sbjct: 181 EVLSSSSSVEKVSVFIGPEGGFTETEIETAVSCG-ICPVTLGPRILRTETAGIAVLSILM 239

Query: 239 AICGD 243
              GD
Sbjct: 240 YELGD 244


>gi|94496115|ref|ZP_01302693.1| hypothetical protein SKA58_03355 [Sphingomonas sp. SKA58]
 gi|94424294|gb|EAT09317.1| hypothetical protein SKA58_03355 [Sphingomonas sp. SKA58]
          Length = 248

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RL V+  L         G+  HYL  V+R+K  D +LLF+G+ GEW ++   + K    
Sbjct: 13  PRLHVETQLGDGVAVPVDGNPAHYLISVMRVKPDDIVLLFDGRSGEWAARARDIRKRDLV 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +   Q+R+  +  D     +PI+  R+D + +K+ E+G+  ++PV+TR       N+DR
Sbjct: 73  LECVAQTRAPEQVPDYWLCCAPIRKGRIDLIAEKACELGVAKLQPVLTRRAVVDKLNLDR 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +  + + AAEQC    LP +     L+ LL NWD    + FADE+ G+          AH
Sbjct: 133 LHAHLVEAAEQCGRTALPDLGSLMKLDALLGNWDSRRHLFFADESGGAPLEQTL---RAH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               A L+GPEGG+  +E++ + ++P    +SLGPRILR++TAA+AA +   AI GDW
Sbjct: 190 PGPAAFLVGPEGGFDPQERDAIQAMPGAVAVSLGPRILRAETAAIAATSAWMAINGDW 247


>gi|224369186|ref|YP_002603350.1| hypothetical protein HRM2_20880 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691903|gb|ACN15186.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 250

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 106/245 (43%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R ++        +   +G +  +L  VLR+  GD + L +G+     ++I  +  +  
Sbjct: 1   MRRFYIKTDSICNGRAVITGQEARHLGTVLRLGPGDRVELVDGRGTIARAEIETLSHNTA 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               ++  S        +      +K  ++D +++   E+G+    P  +  +      +
Sbjct: 61  VFTILDSSSPGAESPVHITLAQGMLKDKKMDMLVRHLTELGICQWIPFYSSRSIPKPDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
             +  M+R       A +QC    LP I  P   + LLK        +   E   +    
Sbjct: 121 RIYSRMERWNKIAREALKQCGRSMLPLIEDPIPFDQLLKTSTDYDGKIAFWENATAPIHT 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  ++     + +LIGPEGG+ S E +      F +  SLGPRILR++TA++ A ALVQ
Sbjct: 181 IQTPSMEPAKKIIVLIGPEGGFSSFEIDAARENGF-SSCSLGPRILRAETASLTAAALVQ 239

Query: 239 AICGD 243
            + GD
Sbjct: 240 YLFGD 244


>gi|83859513|ref|ZP_00953034.1| hypothetical protein OA2633_13950 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852960|gb|EAP90813.1| hypothetical protein OA2633_13950 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 254

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 97/250 (38%), Positives = 147/250 (58%), Gaps = 13/250 (5%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RL++D PL          DQ HYL +V+R K GD + LFNG+DGEW ++++   +    
Sbjct: 5   PRLYIDAPLEAGAVLDLDRDQAHYLVNVMRRKPGDGVRLFNGRDGEWRAEVASADRKRAS 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            ++  Q RSQ+   D+   F+P+K  R D++++K+ E+G+ +I PVIT+ TQ+     DR
Sbjct: 65  LQIVQQRRSQSATPDMALYFAPVKKARTDFIVEKATELGVASITPVITQRTQSERVRTDR 124

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE------- 179
           ++  T  A+EQ + L LP I+ P +L  +LK WD    ++FADE+  S+           
Sbjct: 125 MQALTREASEQTERLDLPVIHEPVSLTQMLKGWDEARTLMFADESGDSQTEPWGGEHGRA 184

Query: 180 -----KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L         A+L+GPEGG+  EE+  LH+  FV P+SLGPRILR+DTAA AA+
Sbjct: 185 RPMAEALAGRERGGKWAMLVGPEGGFSVEERTLLHAQTFVLPVSLGPRILRADTAAAAAL 244

Query: 235 ALVQAICGDW 244
           ++ Q++ GDW
Sbjct: 245 SVWQSMLGDW 254


>gi|329888452|ref|ZP_08267050.1| RNA methyltransferase, RsmE family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328847008|gb|EGF96570.1| RNA methyltransferase, RsmE family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 239

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 134/239 (56%), Gaps = 3/239 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           + RL V   L        + DQ  YL  V+R+K GD +L+FNG+DGEW   ++ V  K +
Sbjct: 1   MIRLHVQGDLAPGAVVAPTLDQSRYLTQVMRLKAGDELLVFNGRDGEWRVSVAEVLKKGV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             + E Q R Q    D++ I + +K  R++ +++K+ E+G   +R  +T  T      +D
Sbjct: 61  ILRAEEQMRPQVYGPDLELIVAVVKKARVETIVEKAAELGAKRVRLALTHRTNADRLRLD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+      AAEQ   L +P +  P  L+ LL  W+   +++F DET G+  +     A  
Sbjct: 121 RLDAIAEEAAEQTGRLDVPVVDDPVKLDALLDGWEAGRRLMFCDETGGAPAASALTQAGD 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                AILIGPEGG+  EE E L SLPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 181 --GKWAILIGPEGGFSPEEGERLRSLPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 237


>gi|119383376|ref|YP_914432.1| hypothetical protein Pden_0624 [Paracoccus denitrificans PD1222]
 gi|119373143|gb|ABL68736.1| protein of unknown function DUF558 [Paracoccus denitrificans
           PD1222]
          Length = 239

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 95/237 (40%), Positives = 138/237 (58%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR-F 67
           RLF+D PL      + + DQ HYL+ V+R   GD IL+FNG+DGEWL++I  + K     
Sbjct: 5   RLFIDHPLAEGQGIELNADQSHYLSSVMRQGAGDEILVFNGQDGEWLARIERIAKRGGAL 64

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +   Q+  Q    D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR+
Sbjct: 65  EALRQTAPQLNPPDLWLVFAPIKKARTDFIVEKAAEMGAARILPVQTDHTNSERIRQDRL 124

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L  LL  WD   +I++ADE       +    +    
Sbjct: 125 QAHAVEAAEQCGGTHVPEVCDLVPLSRLLDGWDAGRRILWADEALAGPAQV---LSGLPR 181

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AILIGPEGG+   E++ L ++  VT ++LGPRILR+DTAAVA++AL QA  GDW
Sbjct: 182 GPWAILIGPEGGWSESERKRLSAMDCVTRIALGPRILRADTAAVASLALWQASLGDW 238


>gi|114705941|ref|ZP_01438844.1| surface protein [Fulvimarina pelagi HTCC2506]
 gi|114538787|gb|EAU41908.1| surface protein [Fulvimarina pelagi HTCC2506]
          Length = 295

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 103/238 (43%), Positives = 145/238 (60%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFV+  +   T   A+  Q +YL +VLR  EGD++LLFNG+DGEW +++    K    
Sbjct: 55  PRLFVEERITADTPIAATSPQANYLLNVLRKDEGDSVLLFNGQDGEWRAELRKASKKKLD 114

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                + R Q    D+ Y F+P+K  RLDYM+QK+VEMG G ++PV+T  TQN     D+
Sbjct: 115 LFPVAKVRVQQPPYDLIYCFAPLKVGRLDYMVQKAVEMGAGILQPVLTHRTQNHRVRTDK 174

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC IL +P    P   + LL NW  +  +VF DE   + + ++ L  +  
Sbjct: 175 IRANAIEAAEQCGILAIPECREPVKFDDLLSNWSSSIPLVFCDEKMDAASPIDALRELGD 234

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                ++IGPEGG+  +E+ +L    F T +SLGPRILR+DTAAVAA+ +VQA+CGDW
Sbjct: 235 GRK-GLIIGPEGGFSQDERVSLLGAEFTTAISLGPRILRADTAAVAALTMVQAVCGDW 291


>gi|126734662|ref|ZP_01750408.1| hypothetical protein RCCS2_12334 [Roseobacter sp. CCS2]
 gi|126715217|gb|EBA12082.1| hypothetical protein RCCS2_12334 [Roseobacter sp. CCS2]
          Length = 244

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 126/238 (52%), Gaps = 6/238 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGK-DGEWLSKISYVGKSIRF 67
           RL+VD  L        S +Q HYL  V+R+ EG  + L NG+        +    K    
Sbjct: 10  RLYVDHALGQGQSVPLSREQAHYLFGVMRLAEGAVLSLINGRDGAWDADVVKAGKKGGIL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN-THYNMDR 126
           +   Q+       DV  +F+PI+  R  ++++K+VEMG+  + PV T +TQ+      D+
Sbjct: 70  ECSAQTGPLQMPPDVWLLFAPIRKERTAFIVEKAVEMGVSRVCPVQTDFTQSANRVRQDK 129

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++T+ I AAEQC    +P +     L+ LL  W  + Q++F DE    +     L     
Sbjct: 130 LQTHAIEAAEQCGGTFVPPVDDLAKLDRLLAAWPEDRQLMFCDEVLIGDRVGLPLVEGPW 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E++ L  LPF  P+SLGPRILR+DTAAVAA+ + Q   GDW
Sbjct: 190 ----AILIGPEGGFSPAERDRLRGLPFAHPVSLGPRILRADTAAVAALTVWQQALGDW 243


>gi|103487756|ref|YP_617317.1| 16S ribosomal RNA methyltransferase RsmE [Sphingopyxis alaskensis
           RB2256]
 gi|98977833|gb|ABF53984.1| protein of unknown function DUF558 [Sphingopyxis alaskensis RB2256]
          Length = 249

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 131/238 (55%), Gaps = 6/238 (2%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIR 66
            RLF+D PL   +     G   HYL  V+R+K GD +LLF+ + GEWL+ ++    +S+ 
Sbjct: 13  PRLFIDQPLGAGSAPVIDGAAAHYLLGVMRLKAGDPVLLFDNRSGEWLAVVADAAKRSVT 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            ++E   R      D+   F+P+K  RLD++I+K+ E+G+  ++PV+T  T       +R
Sbjct: 73  LRIERHMRDIEAVPDLWLCFAPVKKARLDWIIEKATELGVRRLQPVMTERTIVERVRRER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    I A EQC    LP +  P  L  LLK W     ++FADE  G   +     A A 
Sbjct: 133 LEAQIIEACEQCGRTALPALAEPVKLPQLLKAWPAERALLFADEAGGVPMARLAAPAPA- 191

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AIL GPEGG+   E+  L + P V  L+LGPRILR++TAA+AA +L  A  GDW
Sbjct: 192 ----AILTGPEGGFTDRERALLAAHPAVHRLALGPRILRAETAAIAATSLWMAQHGDW 245


>gi|84515820|ref|ZP_01003181.1| hypothetical protein SKA53_14261 [Loktanella vestfoldensis SKA53]
 gi|84510262|gb|EAQ06718.1| hypothetical protein SKA53_14261 [Loktanella vestfoldensis SKA53]
          Length = 244

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 131/238 (55%), Gaps = 6/238 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF- 67
           RL+VD PL +      + DQ HYL  V+R+  GD + L N +DGEW + +   G      
Sbjct: 10  RLYVDHPLGVGQSVPLNRDQAHYLFGVMRLGAGDVLSLINSRDGEWDAVVEKAGNKGGVL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN-THYNMDR 126
             + Q+R      D+  +F+PI+  R  ++++K+VE+G   I PV T +TQ       D+
Sbjct: 70  ACQAQTRPLQTPPDLWLVFAPIRKERTAFIVEKAVELGAARIIPVQTAFTQAANRIRQDK 129

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++ + + A+EQC    +P +     L+ LL +W  + Q++F DE          +   A 
Sbjct: 130 LQAHAVEASEQCGGTFVPPVDDLAKLDRLLADWPKDRQLMFCDEAAIGA----PVRLPAI 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+   E++ L +LPF   +SLGPRILR+DTAAVAA+ L Q   GDW
Sbjct: 186 PGPWAILIGPEGGFSPAERDKLRALPFAHAVSLGPRILRADTAAVAALTLWQQALGDW 243


>gi|167036024|ref|YP_001671255.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida GB-1]
 gi|166862512|gb|ABZ00920.1| protein of unknown function DUF558 [Pseudomonas putida GB-1]
          Length = 239

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 111/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-DLPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKK 59

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q  +        V       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  TVRVSLDQALTGQADSPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   TLP I+PP  L   L +   + ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSTLPVIHPPVPLTEWLSSTQADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A LIGPEGG    E E   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPAGLAFLIGPEGGLSEAEVEQAKAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|182679209|ref|YP_001833355.1| hypothetical protein Bind_2249 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635092|gb|ACB95866.1| protein of unknown function DUF558 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 250

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 106/239 (44%), Positives = 142/239 (59%), Gaps = 6/239 (2%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIR 66
            RL++D PL           Q HYL  VLR+  GD+IL+FNG++GEW + +     K+++
Sbjct: 9   PRLYLDQPLRAGGTVALDKSQAHYLCTVLRLVAGDHILVFNGREGEWRAALKESGRKTVQ 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +   Q R+Q   +D+ Y+F+P+K  RLDYM QK+VEMG   ++P+ TR TQN   N++R
Sbjct: 69  IEPIEQVRTQEPDNDLHYLFAPLKHARLDYMAQKAVEMGASLLQPLFTRRTQNERINLER 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC ILTLP I     L+  L   D N  +VF DE       L  L     
Sbjct: 129 LRANAIEAAEQCGILTLPEIAEAVKLDAYLARRDQNRVLVFCDEDAPPIGPLAALREALR 188

Query: 187 IPNVA-----ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
              VA     +LIGPEGG+ + E++ L S P    +SLGPRILR+DTAAVA +ALVQAI
Sbjct: 189 PGGVACRGADVLIGPEGGFDATERDLLVSQPNHIRISLGPRILRADTAAVAVLALVQAI 247


>gi|303238634|ref|ZP_07325167.1| protein of unknown function DUF558 [Acetivibrio cellulolyticus CD2]
 gi|302593753|gb|EFL63468.1| protein of unknown function DUF558 [Acetivibrio cellulolyticus CD2]
          Length = 247

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 117/246 (47%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--S 64
           + R F++           +G+ Y+++  VLR+K  + + L +G   E++++I   G    
Sbjct: 1   MPRFFINSKDVFDDNINITGEDYNHIKKVLRLKCEEIVTLSDGIGNEYVAEIKDFGDGFV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-------T 117
               +E    +      V       K++++D++IQKSVE+G+  I PV+T          
Sbjct: 61  HTKVIESYKNTTEPPIKVTLYQGLPKSDKMDFIIQKSVELGISRIVPVLTERTVVRLDSE 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           ++     +R    +  AA+QC+   +P I  P + +  +K        +   E     + 
Sbjct: 121 KDAAKKCERWNRISQEAAKQCNRGIIPKIEVPISFKEAIKKVHDVPLSLIPYEKESKNSL 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            + L ++  I  V++ IGPEGG+  +E E   +   ++ ++LGPRILR++TA +  + ++
Sbjct: 181 KQILKSVGDISEVSVFIGPEGGFTEQEIEEAVNCG-LSSVTLGPRILRTETAGITVLTIL 239

Query: 238 QAICGD 243
               GD
Sbjct: 240 MYELGD 245


>gi|148550061|ref|YP_001270163.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida F1]
 gi|148514119|gb|ABQ80979.1| protein of unknown function DUF558 [Pseudomonas putida F1]
          Length = 239

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 109/248 (43%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+  ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-DLPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYRGQLLEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q+          V       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  TVRVSLDQAFAGQADSPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   TLP I+PP  L   L +   + ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSTLPVIHPPVPLAEWLSSTKADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +      +A +IGPEGG    E E   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHEKPATLAFVIGPEGGLSEAEVEQAKAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|83854893|ref|ZP_00948423.1| hypothetical protein NAS141_09196 [Sulfitobacter sp. NAS-14.1]
 gi|83842736|gb|EAP81903.1| hypothetical protein NAS141_09196 [Sulfitobacter sp. NAS-14.1]
          Length = 240

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 92/243 (37%), Positives = 132/243 (54%), Gaps = 5/243 (2%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +++ + RL+VD PL           Q HYL  V+R   G ++LLFNG DGEW ++++  G
Sbjct: 1   MNAKI-RLYVDHPLGQGQSVPLDKAQAHYLFGVMRQSVGASVLLFNGIDGEWRAEVAEAG 59

Query: 63  KSIRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
           K     V   Q++      D+  IF+PIK  R D++++K+ EMG   I PV + +T    
Sbjct: 60  KRGGVLVCAEQTKPLQMPPDLWLIFAPIKKARTDFIVEKAAEMGARRIVPVQSEFTNAGR 119

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
              DR++ + + AAEQC    +P +     L+ L+  W+    ++F DE    E      
Sbjct: 120 VQRDRLQAHAVEAAEQCGGTFVPEVADMVRLDRLIDRWEPERSLMFCDEALAGEEEG--- 176

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
            A A     AILIGPEGG+   E+  L  L +  P++LGPRILR+DTAAVAAM L Q   
Sbjct: 177 LASARPGPWAILIGPEGGFSDSERVRLRGLDWSRPVALGPRILRADTAAVAAMTLWQKTL 236

Query: 242 GDW 244
           GDW
Sbjct: 237 GDW 239


>gi|26991662|ref|NP_747087.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida
           KT2440]
 gi|24986759|gb|AAN70551.1|AE016697_6 conserved hypothetical protein TIGR00046 [Pseudomonas putida
           KT2440]
 gi|313500961|gb|ADR62327.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 239

 Score =  158 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 110/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+  ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-DLPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYRGQLLEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q+          V       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  TVRVSLDQAFAGQADSPLHVHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   TLP I+PP TL   L +   + ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSTLPVIHPPVTLAEWLSSTKADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +      +A +IGPEGG    E E   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLISHEKPATLAFVIGPEGGLSEAEVEQAKAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|326386680|ref|ZP_08208302.1| 16S ribosomal RNA methyltransferase RsmE [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208995|gb|EGD59790.1| 16S ribosomal RNA methyltransferase RsmE [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 255

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 122/238 (51%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFV  PL         G Q HYL  V+R+  GD ++L +   GEW ++   VGK    
Sbjct: 17  PRLFVTGPLGDGVSVTIEGGQAHYLVRVMRIAPGDVVVLCDDATGEWATQAGPVGKRDLV 76

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                + R +    D     + +K +R D +++K+ E+G+  +RP++ R       N +R
Sbjct: 77  LTCTTRLREREDVPDFWLCPALLKKDRFDLVLEKASELGVARLRPMLARRCVADKLNPER 136

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
            R   I AAEQC    LP    P  +E LL +W  +  + FADE  G+  +       AH
Sbjct: 137 ARATLIEAAEQCARTALPQCDAPVRIEALLADWPQDRTLFFADENGGAPAAASF---AAH 193

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
                +L+GPEGG+   E+  + + P   P++LGPRILR +TAA+AA +L   +CGDW
Sbjct: 194 PGPAGLLVGPEGGFDEAERAAIRAHPAAVPITLGPRILRGETAAIAATSLWMGLCGDW 251


>gi|39934226|ref|NP_946502.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris CGA009]
 gi|39648074|emb|CAE26594.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 251

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 105/246 (42%), Positives = 144/246 (58%), Gaps = 3/246 (1%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +      RLFVD  L    Q     DQ +YL +VLR+  G  +L FNG+DGEW + I+  
Sbjct: 3   RYDFRSPRLFVDAALAPGAQVPLERDQSNYLGNVLRLGAGAAVLAFNGRDGEWRATIAGR 62

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            +    +V  Q+R Q +  DV Y+F+P+K  RLDYM QK+VEMG G ++PV+T++TQ   
Sbjct: 63  KRPEALEVAEQTRPQDRLPDVAYVFAPLKHARLDYMAQKAVEMGAGRLQPVLTQHTQVHR 122

Query: 122 YNMDRVRTYTISAAEQCDILTLPFI-YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
            N DR+R   I AAEQC IL+L  +  P     FL    +    +VF DE     + +  
Sbjct: 123 LNTDRMRANVIEAAEQCGILSLAEVGEPIGLDRFLAGRANGERLLVFCDEDAEIADPVAA 182

Query: 181 LHAIAHI--PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           L A        V +L+GPEGG+ +EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQ
Sbjct: 183 LQAARDAAARGVDLLVGPEGGFSTEERALLLKQPAILRLALGPRIMRADTAAVAALTLVQ 242

Query: 239 AICGDW 244
           A+ GDW
Sbjct: 243 AVLGDW 248


>gi|192289752|ref|YP_001990357.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris TIE-1]
 gi|192283501|gb|ACE99881.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           TIE-1]
          Length = 251

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 105/246 (42%), Positives = 144/246 (58%), Gaps = 3/246 (1%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +      RLFVD  L    Q     DQ +YL +VLR+  G  +L FNG+DGEW + I+  
Sbjct: 3   RYDFRSPRLFVDAALAPGAQVPLERDQSNYLGNVLRLGAGAAVLAFNGRDGEWRATIAGR 62

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            +    +V  Q+R Q +  DV Y+F+P+K  RLDYM QK+VEMG G ++PV+T++TQ   
Sbjct: 63  KRPEALEVAEQTRPQDRLPDVAYVFAPLKHARLDYMAQKAVEMGAGRLQPVLTQHTQVHR 122

Query: 122 YNMDRVRTYTISAAEQCDILTLPFI-YPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
            N DR+R   I AAEQC IL+L  +  P     FL    +    +VF DE     + +  
Sbjct: 123 LNTDRMRANVIEAAEQCGILSLAEVGEPIGLDRFLASRANGERLLVFCDEDAEIADPVAA 182

Query: 181 LHAIAHI--PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           L A        V +L+GPEGG+ +EE+  L   P +  L+LGPRI+R+DTAAVAA+ LVQ
Sbjct: 183 LQAARDAAARGVDLLVGPEGGFSTEERALLLKQPVILRLALGPRIMRADTAAVAALTLVQ 242

Query: 239 AICGDW 244
           A+ GDW
Sbjct: 243 AVLGDW 248


>gi|302874303|ref|YP_003842936.1| hypothetical protein Clocel_1419 [Clostridium cellulovorans 743B]
 gi|307689431|ref|ZP_07631877.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium cellulovorans
           743B]
 gi|302577160|gb|ADL51172.1| protein of unknown function DUF558 [Clostridium cellulovorans 743B]
          Length = 248

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 109/244 (44%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + FV+     +      G+   ++  VLR+K GD + + +    E+ +K++ + K   
Sbjct: 1   MHKFFVEPSEIAEGIVTIEGEDVKHIYKVLRLKVGDIVNINDCNGTEYNAKLTSIDKKEV 60

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY---TQNTH 121
               +E    +      +       K  ++DY++QK  E+G+ A  PV T       +  
Sbjct: 61  KAEIIETLDSNNESPIKIVLYQGMPKATKMDYIVQKGTEVGINAFIPVNTERVVVNTSEF 120

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
             +DR+      AA+Q     +P ++ P   E LLK  +    IV   E   +       
Sbjct: 121 KKLDRLNRIAKEAAKQSKRTIIPKVHEPIEFEELLKELEEYSLIVVPYENAENFGIKNLA 180

Query: 182 H--AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                  + +VAI+IGPEGG+   E E L S+     ++LGPRILR++TA V   +L+  
Sbjct: 181 KGVKKEEVDSVAIIIGPEGGFEDSEIERLKSIN-AHIVTLGPRILRTETAGVVCASLIMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|126740599|ref|ZP_01756286.1| hypothetical protein RSK20926_04507 [Roseobacter sp. SK209-2-6]
 gi|126718400|gb|EBA15115.1| hypothetical protein RSK20926_04507 [Roseobacter sp. SK209-2-6]
          Length = 261

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 95/252 (37%), Positives = 132/252 (52%), Gaps = 16/252 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RF 67
           RL+V+ PL +        DQ HYL  V+R   G ++ LFNG+DGEW ++IS  GK     
Sbjct: 10  RLYVEHPLGVGQSIPLEKDQAHYLFGVMRQALGGHVALFNGRDGEWQAEISEAGKRGGTL 69

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               QS+      D+  IF+PIK  R D++++K+ EMG   I PV T YT +     DR+
Sbjct: 70  TCIEQSKPLQMPPDLWLIFAPIKKARTDFIVEKAAEMGAAKILPVGTEYTNSERIRQDRL 129

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI--- 184
           + + + AAEQC    +P +     L  LL +W    Q++F DE    +     L      
Sbjct: 130 QAHAVEAAEQCGGTYVPEVCDLQKLSRLLDDWPAKRQLMFCDEAEVGQQRFLDLTQGGGT 189

Query: 185 ------------AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                       A     AILIGPEGG+  +E++ LH++     +SLGPRILR+DTAAVA
Sbjct: 190 GADRSASEPVPGAVSQPWAILIGPEGGFSDKERKRLHAMEQAHVVSLGPRILRADTAAVA 249

Query: 233 AMALVQAICGDW 244
           AM + Q   GDW
Sbjct: 250 AMTVWQQTLGDW 261


>gi|146342924|ref|YP_001207972.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium sp.
           ORS278]
 gi|146195730|emb|CAL79757.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 249

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 102/237 (43%), Positives = 149/237 (62%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            RLFVD PL          +Q +YL +VLR+  GD +L+FNG++GEW + I+   ++   
Sbjct: 9   PRLFVDAPLIEGGAVALDRNQSNYLGNVLRLGAGDQVLVFNGREGEWQATIAGRKRADLL 68

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
            ++ + R Q +  D+ Y+F+P+K  RLDY++QK+VEMG   ++PV+TR+TQ +  N +R+
Sbjct: 69  TIQQRLRPQDQLPDITYVFAPLKHARLDYIVQKAVEMGAAVLQPVLTRHTQVSRLNGERM 128

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC IL+L  +  P  LE  L+    +  +VF DE     + ++ L   A  
Sbjct: 129 RANVIEAAEQCGILSLAEVRDPVPLERFLRERMASRLLVFCDEAAEIADPVQALRGAAAN 188

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +LIGPEGG+ +EE+E L     VT L+LGPRILR+DTA VAA+AL+QA  GDW
Sbjct: 189 AGIDLLIGPEGGFAAEERELLLRQRQVTRLALGPRILRADTAGVAALALLQATLGDW 245


>gi|294675943|ref|YP_003576558.1| hypothetical protein RCAP_rcc00386 [Rhodobacter capsulatus SB 1003]
 gi|294474763|gb|ADE84151.1| protein of unknown function DUF558, methyltransferase predicted
           [Rhodobacter capsulatus SB 1003]
          Length = 241

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY-VGKSIRF 67
           RL V  PL        S DQ +YL  V+R+  GD + LFNG+DGEW +++     +    
Sbjct: 7   RLCVTHPLGPGQAVPLSPDQANYLFAVMRLGPGDRVALFNGRDGEWTAEVVEGSKRGGTL 66

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
                +  Q    D+  +F+PIK  R D++++K+ E+G   I PV T +T       DR+
Sbjct: 67  ACLGLAAPQLNPPDLWLLFAPIKKERTDFIVEKAAELGCAKILPVQTEFTNAARIKQDRL 126

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC    +P +     L+ +LK+W+   +I++ DE+           A    
Sbjct: 127 QAHALEAAEQCLGTYVPEVSDLQPLQKVLKSWNPARRILWGDESLVGPAQT---LAGLAP 183

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              AIL+GPEGG+   E+  L +LPFVTP+SLGPRILR+DTAA AA+ L Q+  GDW
Sbjct: 184 GPWAILVGPEGGFSETERHQLRALPFVTPVSLGPRILRADTAACAAITLWQSSLGDW 240


>gi|254486640|ref|ZP_05099845.1| conserved hypothetical protein TIGR00046 [Roseobacter sp. GAI101]
 gi|214043509|gb|EEB84147.1| conserved hypothetical protein TIGR00046 [Roseobacter sp. GAI101]
          Length = 240

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 85/243 (34%), Positives = 127/243 (52%), Gaps = 5/243 (2%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +++ + RL+V+  L           Q HYL  V+R   G  +LLFNGKDGEW +++   G
Sbjct: 1   MNAKI-RLYVEHGLGQGQSVPLDKAQAHYLFGVMRQAVGAAVLLFNGKDGEWRAEVVEAG 59

Query: 63  KSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
           K     +   Q++      D+  IF+PIK  R D++++K+ EMG   I PV T +T    
Sbjct: 60  KRGGVLQCVAQTKPLQMPPDLWLIFAPIKKTRTDFIVEKAAEMGARRIVPVQTDFTNAGR 119

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
              DR++ + + AAEQC    +  +     L+ L+  WD    ++F DE     +    +
Sbjct: 120 VQRDRLQAHAVEAAEQCGATFVAEVTEMVKLDRLIDQWDAGRSLMFCDEALAGSD---AV 176

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
              +      ILIGPEGG+   E+  L  L +   ++LGPRILR+DTAAVAAM + Q   
Sbjct: 177 LGQSGRGAWGILIGPEGGFSDRERSRLRGLEYARSVTLGPRILRADTAAVAAMTVWQQAF 236

Query: 242 GDW 244
           GDW
Sbjct: 237 GDW 239


>gi|104783966|ref|YP_610464.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas entomophila
           L48]
 gi|95112953|emb|CAK17681.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 239

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 118/248 (47%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +    +    Q HY+  VLRM  GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFIDAPLGLGEH-ELPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q+     +S   V       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  TVRVSLDQALPGQAESSLHVHLGQGLSRGERMDWAIQKATELGVNEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   ++P I+PP TL   +K  D + ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSSVPVIHPPVTLAEWIKGSDADLKLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A LIGPEGG +  E E   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPARLAFLIGPEGGLNDAEVEQAKAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|114800139|ref|YP_760086.1| 16S ribosomal RNA methyltransferase RsmE [Hyphomonas neptunium ATCC
           15444]
 gi|114740313|gb|ABI78438.1| conserved hypothetical protein TIGR00046 [Hyphomonas neptunium ATCC
           15444]
          Length = 256

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 130/252 (51%), Gaps = 14/252 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLFVD PL          +Q +YL  VLR+++G ++ LFNG+DGEW + +        
Sbjct: 4   IPRLFVDAPLAEAGAVALDDEQSNYLLRVLRLEDGASVRLFNGRDGEWTATVHKTSAKRA 63

Query: 67  FKV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                 + +++     + +  +F+P+K ++ D +++K+ E+G   IRPV+T  TQ     
Sbjct: 64  EATPSRQTRTQPGQIGTRLTLLFAPVKKDQTDLILEKATELGAARIRPVLTERTQTRTVR 123

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE---- 179
            DR R   + AAEQ + L LP I    +L+  L   +    ++F DE      +      
Sbjct: 124 ADRFRKIALEAAEQTERLDLPEILDLASLDAALDALEPGTAVIFCDEAGDEAEAPWGGQA 183

Query: 180 -------KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                  ++       + AIL GPEGG+   E+  L       P+SLGPRILR++TAA++
Sbjct: 184 GRARPMLEVLEELKGRSAAILTGPEGGFTPAERAFLRGRAETWPVSLGPRILRAETAAIS 243

Query: 233 AMALVQAICGDW 244
           AM L QA+CGDW
Sbjct: 244 AMTLWQAVCGDW 255


>gi|109899639|ref|YP_662894.1| hypothetical protein Patl_3334 [Pseudoalteromonas atlantica T6c]
 gi|109701920|gb|ABG41840.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudoalteromonas atlantica
           T6c]
          Length = 242

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L    +   + D  +++A+VLR K G  ++LFNG   E+  +   V K 
Sbjct: 1   MRISRIYHPDTLHPDQELSLTPDASNHVANVLRSKVGQPVVLFNGDGNEYSGEFIDVSKR 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                     S S      +       + +R+D+++QKSVE+G+  I P+IT        
Sbjct: 61  KVRVQIDAKLSMSLESPLSIHLGQGVSRGDRMDWVLQKSVELGVTEITPLITERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            Q       + +   I+A EQC    LP ++ P   +  +       ++        S  
Sbjct: 121 EQRWQKKHAQWQKIIIAACEQCGRNVLPVLHMPMDFQSWVNQSTQALRLALHPRAEKSFR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                H       V +LIGPEGG+  +E            + LGPR+LR++TAA+ A++ 
Sbjct: 181 -----HTSVGKDGVRLLIGPEGGFSDQELYQ-TEQGGFQTVQLGPRVLRTETAAITAISA 234

Query: 237 VQAICGD 243
           +QAI GD
Sbjct: 235 LQAIYGD 241


>gi|330721278|gb|EGG99366.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC2047]
          Length = 241

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 115/247 (46%), Gaps = 16/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F+D PL    Q +   +  HYL  VLR+     + +FNG+ GE+ ++I    K+
Sbjct: 1   MRIPRIFIDLPLNEHQQVELPRETSHYLNRVLRLPVDAQLRVFNGQGGEYQAQICAANKN 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   + +   +    +    +  K +R+D+++QK+ E+G+  I  + +  T     
Sbjct: 61  AVSLAIGAFSAEDNSSPLHIHLGIALSKGDRMDFVVQKATELGIKEISLLYSERTEVKLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +   ISA EQC    +P I+ PT L   L+      +          + 
Sbjct: 121 GEREEKRLQHWQKVAISACEQCASNHVPTIHAPTPLNQWLEERHETVK-------LIMQP 173

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             ++     +   VA+L+GPEGG+   E    +   F   LSLGPRILR++TA + A+++
Sbjct: 174 GTDQPFKQDNPGKVALLVGPEGGFSESEVNAANQAGF-NNLSLGPRILRTETAPLVAISI 232

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 233 LQHHWGD 239


>gi|297544383|ref|YP_003676685.1| hypothetical protein Tmath_0939 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842158|gb|ADH60674.1| protein of unknown function DUF558 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 245

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 116/244 (47%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G      S        + 
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDGSTEYQTSIYGVEKNRVI 60

Query: 67  FKVEYQSRSQTKQSDVQ-YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
             +E + +S T+ S          K+++++ +IQK  E+G+    P+ITRY        N
Sbjct: 61  LFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  ++R    +  A +Q    +LP I  P + E  LK  +     +   E   +    E
Sbjct: 121 LNKKIERWNKISREACKQSGRTSLPEICMPISFEEALKQIEEFDLCIIPYEKEKTLKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  + +I  VAI IGPEGG+  EE +          +SLGPRILR++TAA++  ++V  
Sbjct: 181 VLDGVKNIKKVAIFIGPEGGFSEEEVDLALRYS-AKLVSLGPRILRTETAAISVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|77461509|ref|YP_351016.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           Pf0-1]
 gi|77385512|gb|ABA77025.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 239

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 107/248 (43%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL      +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFIDAPLSTGEH-ELPEAQAHYISRVLRMAEGDAVQLFDGSGHEFRGSLVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+ +   +    
Sbjct: 60  RVVVQIDEQFAGQVESPLKIHLGQGLSRGERMDWAIQKATELGVTEITPIFSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC    +P I+PP  L   LK  +   ++V          
Sbjct: 120 DERADKRLLHWRQVAISACEQCGRSRVPVIHPPVLLADWLKQTEAELKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A LIGPEGG    E E            LGPR+LR++TA V A+A+
Sbjct: 176 ---PLVSHAKPSTLAFLIGPEGGLSDAEVEQA-KAGGFHAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|256821459|ref|YP_003145422.1| hypothetical protein Kkor_0233 [Kangiella koreensis DSM 16069]
 gi|256794998|gb|ACV25654.1| protein of unknown function DUF558 [Kangiella koreensis DSM 16069]
          Length = 242

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 115/248 (46%), Gaps = 14/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F    L + T+     +   +++ VLRM  G  I LFNG    + ++I  + ++
Sbjct: 1   MRVPRIFTSEALSLSTEMALDKEASTHISRVLRMNTGQQIELFNGDGFSYFAQIQAIERN 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 VE    +     ++       + ++++  +QK VE+G+    P+IT        
Sbjct: 61  QVSVRVVEAIEVNNESPLNIHLFQGISRGDKMELTLQKGVELGVKQFTPLITERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +   +    SA EQC   ++P +YP   L+  L   ++    +  D     + 
Sbjct: 121 AKRWQKKLQHWQKVIESACEQCGRNSIPSLYPAVKLQDALSQLNNTSFFMHPDSKHSFKT 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +    +      + + +GPEGG+  EE E + S     P+ LGPRILR++TAA+AA+++
Sbjct: 181 IIADAQS-----ELQLWVGPEGGFSDEEVEWVESHG-CKPVQLGPRILRTETAALAAVSV 234

Query: 237 VQAICGDW 244
           + ++ GD+
Sbjct: 235 MNSLWGDF 242


>gi|170719665|ref|YP_001747353.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas putida W619]
 gi|169757668|gb|ACA70984.1| protein of unknown function DUF558 [Pseudomonas putida W619]
          Length = 239

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 108/248 (43%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-DLPEAQAHYIGRVLRMAPGDAVQLFDGSGQEYLGQLLEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q+          +       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  TVRVSLDQAVAGQAESPLHIHLGQGLSRGERMDWAIQKATELGANEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC    LP I  P TL   +K  D + ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSILPIIRAPVTLGDWIKGSDADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +      +A LIGPEGG    E +      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPARLAFLIGPEGGLSEAEVDQAKGAGF-QAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|167040699|ref|YP_001663684.1| 16S ribosomal RNA methyltransferase RsmE [Thermoanaerobacter sp.
           X514]
 gi|300914740|ref|ZP_07132056.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X561]
 gi|307724026|ref|YP_003903777.1| hypothetical protein Thet_0859 [Thermoanaerobacter sp. X513]
 gi|166854939|gb|ABY93348.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X514]
 gi|300889675|gb|EFK84821.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X561]
 gi|307581087|gb|ADN54486.1| protein of unknown function DUF558 [Thermoanaerobacter sp. X513]
          Length = 245

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 116/244 (47%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G      S        + 
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDGSTEYQTSIYGVEKNRVI 60

Query: 67  FKVEYQSRSQTKQSDVQ-YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
             +E + +S T+ S          K+++++ +IQK  E+G+    P+ITRY        N
Sbjct: 61  LFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  ++R    +  A +Q    +LP I  P + E  LK  +     +   E   +    E
Sbjct: 121 LNKKIERWNKISREACKQSGRTSLPEICMPISFEEALKQIEEFDLCIIPYEKEKTLKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  + +I  VAI +GPEGG+  EE +          +SLGPRILR++TAA++  ++V  
Sbjct: 181 VLDGVKNIKKVAIFVGPEGGFSEEEVDLALRYS-AKLVSLGPRILRTETAAISVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|289578110|ref|YP_003476737.1| hypothetical protein Thit_0897 [Thermoanaerobacter italicus Ab9]
 gi|289527823|gb|ADD02175.1| protein of unknown function DUF558 [Thermoanaerobacter italicus
           Ab9]
          Length = 245

 Score =  155 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 115/244 (47%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +++ FVD     +      G   H++ +VLR+K+GD I++ +G      S        + 
Sbjct: 1   MRKFFVDKEKIKENFAYIEGKDTHHIINVLRLKKGDEIVISDGSTEYQTSIYGVEKNRVI 60

Query: 67  FKVEYQSRSQTKQSDVQ-YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
             +E + +S T+ S          K+++++ +IQK  E+G+    P+ITRY        N
Sbjct: 61  LFLESKLQSNTESSIEIALFQGLPKSDKMELIIQKCTEIGVKKFIPIITRYSVVDIKNSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  ++R    +  A +Q    +LP I  P +    LK  +     +   E   +    E
Sbjct: 121 LNKKIERWNKISREACKQSGRTSLPEICMPISFGEALKRIEEFDLCIIPYEKEKTLKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  + +I  VAI +GPEGG+  EE +          +SLGPRILR++TAA++  ++V  
Sbjct: 181 VLDGVKNIKKVAIFVGPEGGFSEEEVDLALRYS-AKLVSLGPRILRTETAAISVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|261855041|ref|YP_003262324.1| hypothetical protein Hneap_0420 [Halothiobacillus neapolitanus c2]
 gi|261835510|gb|ACX95277.1| protein of unknown function DUF558 [Halothiobacillus neapolitanus
           c2]
          Length = 244

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 113/248 (45%), Gaps = 13/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+++D  L          ++ +YL +VLR+++G  + +F+G++ E  + +S   + 
Sbjct: 1   MRIPRIYLDAALAEGATLPLPAERLNYLKNVLRLRDGQALRVFDGQNHEADATLSLGKRE 60

Query: 65  IRFKVEYQ-SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
               +    + S         I +  K  ++D++IQK+VE+G+    PV T  +      
Sbjct: 61  GSLAIGRVAAHSVESPLQTHLIQAMGKGEKMDWVIQKAVELGVTRFTPVSTERSVVELKG 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +       R     I A EQ     LP + P  +LE  L   D   + V           
Sbjct: 121 ERADKRHARFIDIAIGACEQSGRNFLPRVDPILSLEEALTQTDAALKWVLHPNPGSGAAL 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
                      +VA+LIGPEGG    E E   +  F+ PL+LG R+LR++TA + A++++
Sbjct: 181 PAVA-----PDSVALLIGPEGGLSDHEVEAAIASGFM-PLTLGSRVLRTETAPIVALSVL 234

Query: 238 QAICGDWY 245
           Q   GD++
Sbjct: 235 QMQWGDFF 242


>gi|188580094|ref|YP_001923539.1| hypothetical protein Mpop_0826 [Methylobacterium populi BJ001]
 gi|179343592|gb|ACB79004.1| protein of unknown function DUF558 [Methylobacterium populi BJ001]
          Length = 250

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW S+I     KS  
Sbjct: 9   PRLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRSEIVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+R Q   SD+ Y+F+P+KT RLDYM QK+VEMG G ++PV TR+TQ     +DR
Sbjct: 69  LRVVAQTRPQPAPSDLHYLFAPLKTGRLDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH---A 183
           ++   I AAEQC IL +P I  P  L   L   D    +VF DE     + +  L     
Sbjct: 129 LQANAIEAAEQCGILAVPEIGEPDRLPACLAALDPGRLLVFCDEDAPVTDPVAALRGAAD 188

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A  P +A+L+GPEGG+H EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 189 PADPPPLAVLVGPEGGFHPEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|256752132|ref|ZP_05492998.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256748946|gb|EEU61984.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 245

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 113/244 (46%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNG-KDGEWLSKISYVGKSI 65
           ++++F+D            G+ +H+L +VLR+K G+ I+  +G K+     +     K I
Sbjct: 1   MRKIFIDRQNIKGEFVYIEGEDFHHLVNVLRLKRGNEIVASDGLKEYAARIEEIKKDKLI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
            F       +     ++       K+++++ +IQK  E+G+    PV+TRY        N
Sbjct: 61  LFLERELESNTESPLEISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  + R R  +  A +Q     +P I  P + E  +   D     +   E   +    E
Sbjct: 121 INKKIARWRKISEEACKQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +  + I IGPEGG+  EE E   +   + P+SLGPRILR++TAA+A  ++V  
Sbjct: 181 VLKKAKGVKKIGIFIGPEGGFSQEEIELALN-KSIKPVSLGPRILRTETAAIAVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|89056403|ref|YP_511854.1| 16S ribosomal RNA methyltransferase RsmE [Jannaschia sp. CCS1]
 gi|88865952|gb|ABD56829.1| protein of unknown function DUF558 [Jannaschia sp. CCS1]
          Length = 245

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M     + RLFVD PL        S D  +YL +V+R+  G  + LFNG DGEW ++++ 
Sbjct: 1   MSQRPKI-RLFVDHPLGEAQSVPVSRDHANYLFNVMRLDAGAGVALFNGTDGEWRAEVAA 59

Query: 61  VGKSIRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
            GK     V   Q+  Q    D+  +F+PIK  R D++++K+ E+G+  + PV T  T  
Sbjct: 60  KGKRGGVLVCKEQTAPQVMPPDMWLLFAPIKKARTDFIVEKAAELGVARVCPVRTERTNA 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                D+++ + + AAEQC    +P +    +LE +L  WD    +VFADE     +S  
Sbjct: 120 ERIRQDKLQAHAMEAAEQCGGTYVPPVEDIRSLEKVLDGWDDRRALVFADEAEAGRSSSL 179

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                A  P  AILIGPEGG+   E+  L ++P V  LSLGPRILR+DTAAVAA+ L Q 
Sbjct: 180 AAVLAAAPPPAAILIGPEGGFSDAERARLRAMPNVHVLSLGPRILRADTAAVAALTLWQE 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 HVGDW 244


>gi|229595716|ref|YP_001525220.2| 16S ribosomal RNA methyltransferase RsmE [Azorhizobium caulinodans
           ORS 571]
          Length = 250

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
              +RLFV   L   T      +Q HY+A+V+R+     +L+FNG+DGEW +       K
Sbjct: 6   FRAQRLFVREDLAADTTFSLPSEQAHYVANVIRLPVRGGLLVFNGRDGEWRATRIEGGKK 65

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            +R  +  Q+R Q   + + Y F+P+K  RLDYM+QK+VEMG G + PV+T++TQ    N
Sbjct: 66  EVRLSIGGQTRPQPAAAGLTYAFAPLKHARLDYMVQKAVEMGAGVLAPVLTQHTQIPRVN 125

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
            +R+    I AAEQC ILT+P +  P  L   L     +  +VF DE     + L  L  
Sbjct: 126 GERMEANAIEAAEQCGILTIPSVRAPQGLSAFLGARPADDMLVFCDEAAPVADPLVALRP 185

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A    + +LIGPEGG+ ++E+  LH    V  ++LGPRILR+DTA VAA+ALVQA+CGD
Sbjct: 186 AA-GGPITVLIGPEGGFSADERTLLHRQERVIVIALGPRILRADTAGVAALALVQAVCGD 244

Query: 244 W 244
           W
Sbjct: 245 W 245


>gi|158330817|dbj|BAF88302.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 283

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
              +RLFV   L   T      +Q HY+A+V+R+     +L+FNG+DGEW +       K
Sbjct: 39  FRAQRLFVREDLAADTTFSLPSEQAHYVANVIRLPVRGGLLVFNGRDGEWRATRIEGGKK 98

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
            +R  +  Q+R Q   + + Y F+P+K  RLDYM+QK+VEMG G + PV+T++TQ    N
Sbjct: 99  EVRLSIGGQTRPQPAAAGLTYAFAPLKHARLDYMVQKAVEMGAGVLAPVLTQHTQIPRVN 158

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
            +R+    I AAEQC ILT+P +  P  L   L     +  +VF DE     + L  L  
Sbjct: 159 GERMEANAIEAAEQCGILTIPSVRAPQGLSAFLGARPADDMLVFCDEAAPVADPLVALRP 218

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A    + +LIGPEGG+ ++E+  LH    V  ++LGPRILR+DTA VAA+ALVQA+CGD
Sbjct: 219 AA-GGPITVLIGPEGGFSADERTLLHRQERVIVIALGPRILRADTAGVAALALVQAVCGD 277

Query: 244 W 244
           W
Sbjct: 278 W 278


>gi|296284223|ref|ZP_06862221.1| 16S ribosomal RNA methyltransferase RsmE [Citromicrobium
           bathyomarinum JL354]
          Length = 255

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 119/238 (50%), Gaps = 4/238 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNG-KDGEWLSKISYVGKSIR 66
            RLFV+  L         G++ HYL  V+R+ EGD ++L +               + + 
Sbjct: 13  PRLFVEDELGEGRTIALYGNRAHYLGKVMRVSEGDTVILCDDLTGEWAARVGQVDKRRVD 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V  + R +    D+    + +K +R D +++K+ E+G+ AIRPV+TR       N +R
Sbjct: 73  VTVVERLREREAVPDLWLCPALLKKDRFDLVLEKATELGVAAIRPVVTRRCVADKLNPER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
             T    AAEQC    LP +  P  L+ LL +W     + FADE  G +          H
Sbjct: 133 AATIVTEAAEQCARTALPQVAGPVKLDALLADWPAERALFFADEEGGEDA---ASAFARH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AIL GPEGG+   E+  + +LP   P++LGPRILR +TA +AA+++  A  GDW
Sbjct: 190 GAPAAILTGPEGGFDDAERAAIRALPQAIPITLGPRILRGETATIAAISIWMAQAGDW 247


>gi|153010322|ref|YP_001371536.1| hypothetical protein Oant_2999 [Ochrobactrum anthropi ATCC 49188]
 gi|151562210|gb|ABS15707.1| protein of unknown function DUF558 [Ochrobactrum anthropi ATCC
           49188]
          Length = 248

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 112/245 (45%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RL+V+  L    Q + +    HYL HVLR+K+GD IL FNG+ GEW S+   
Sbjct: 1   MRANYKMQRLYVENDLDDGDQIEVAPQAAHYLTHVLRLKDGDEILAFNGRHGEWKSRLKP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +      Q+R Q   SD+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGKKRLFLMPFEQTRPQPLASDLVYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++   I AAEQC +L++P        +  ++ WD +  ++F DE   S++ L 
Sbjct: 121 PRLGADRIKANAIEAAEQCGVLSIPECCEAIRFDRFIEQWDKSRHLIFCDEGYESDDPLT 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +A  P VA+LIGPEGG+  +E++TL +LPFVT + LGPRILR+DTAAVAAMALVQ+
Sbjct: 181 ILQKMAPGP-VALLIGPEGGFSEDERQTLRNLPFVTAIPLGPRILRADTAAVAAMALVQS 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|15613913|ref|NP_242216.1| hypothetical protein BH1350 [Bacillus halodurans C-125]
 gi|10173966|dbj|BAB05069.1| BH1350 [Bacillus halodurans C-125]
          Length = 250

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 104/247 (42%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV       T    +GD   ++  V+RM  GD ++  +G       +I     S  
Sbjct: 1   MQRYFVPKEQMTDTYVTITGDDVKHIIKVMRMTIGDELICSDGHGRTVRCEIEKANDSEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPV------ITRYTQ 118
               +E    +      V    +  K ++LDY++QK  E+G  A  P       +    +
Sbjct: 61  LARVIEPLIPNTELPIRVTIAQALPKGDKLDYIVQKGTELGAQAFWPFSASRSIVKWDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R+      AAEQ     +P I  P     LL+      + + A E    E  L
Sbjct: 121 KGRKKTERLMKIAKEAAEQSYRERIPSIETPLAFSKLLQEISGFTKTIVAYEEEAKEGRL 180

Query: 179 E----KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L+ + H  ++ ++IGPEGG+ +EE + +       P  LGPRILR++TA++ A+
Sbjct: 181 MTFAACLNELHHGDSLLVIIGPEGGFTTEEIDAIQRAGGA-PAGLGPRILRTETASLYAL 239

Query: 235 ALVQAIC 241
           A +    
Sbjct: 240 AAISYHF 246


>gi|49082184|gb|AAT50492.1| PA0419 [synthetic construct]
          Length = 241

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLSLGQH-DLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A L+GPEGG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGF-HSARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|15595616|ref|NP_249110.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PAO1]
 gi|218889161|ref|YP_002438025.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           LESB58]
 gi|254237347|ref|ZP_04930670.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254243517|ref|ZP_04936839.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9946275|gb|AAG03808.1|AE004479_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126169278|gb|EAZ54789.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126196895|gb|EAZ60958.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218769384|emb|CAW25144.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 240

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLSLGQH-DLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A L+GPEGG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGF-HSARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|218528889|ref|YP_002419705.1| hypothetical protein Mchl_0859 [Methylobacterium chloromethanicum
           CM4]
 gi|218521192|gb|ACK81777.1| protein of unknown function DUF558 [Methylobacterium
           chloromethanicum CM4]
          Length = 250

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 107/240 (44%), Positives = 147/240 (61%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I     KS  
Sbjct: 9   PRLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR
Sbjct: 69  LRVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L   A 
Sbjct: 129 LQANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEEASVTDPVAALRGAAD 188

Query: 187 IPN---VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             +   +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 189 PASPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|312963582|ref|ZP_07778063.1| hypothetical protein PFWH6_5505 [Pseudomonas fluorescens WH6]
 gi|311282091|gb|EFQ60691.1| hypothetical protein PFWH6_5505 [Pseudomonas fluorescens WH6]
          Length = 239

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F D PL +    +    Q HY++ VLRM EGD + LF+G   E+L  +  VGK 
Sbjct: 1   MRLSRFFTDTPLSLGDH-ELPEAQAHYISRVLRMGEGDAVQLFDGSGQEFLGTLLEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q           +       +  R+D+ IQK+ E+G+ AI P+ +   +    
Sbjct: 60  RVTVQLTQHFAGQAESPLHIHLGQGLSRGERMDWAIQKATELGVNAITPIFSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   T+P I+PP  L   LK  + + ++V          
Sbjct: 120 DERADKRLLHWRQVAISACEQCGRSTVPVIHPPLLLADWLKQTEADLKLVLHPVAEPMV- 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                 + A   ++A LIGPEGG    E ET     +     LGPR+LR++TA V A+A+
Sbjct: 179 ------SHAKPSSLAFLIGPEGGLTDNEVETAQGAGY-HAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|254699975|ref|ZP_05161803.1| 16S ribosomal RNA methyltransferase RsmE [Brucella suis bv. 5 str.
           513]
 gi|254710992|ref|ZP_05172803.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           B2/94]
 gi|254712536|ref|ZP_05174347.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M644/93/1]
 gi|254715608|ref|ZP_05177419.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M13/05/1]
 gi|256029374|ref|ZP_05442988.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           M292/94/1]
 gi|256059062|ref|ZP_05449271.1| 16S ribosomal RNA methyltransferase RsmE [Brucella neotomae 5K33]
 gi|256157566|ref|ZP_05455484.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti M490/95/1]
 gi|256253459|ref|ZP_05458995.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ceti B1/94]
 gi|260167538|ref|ZP_05754349.1| 16S ribosomal RNA methyltransferase RsmE [Brucella sp. F5/99]
          Length = 248

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|240137404|ref|YP_002961875.1| hypothetical protein MexAM1_META1p0669 [Methylobacterium extorquens
           AM1]
 gi|240007372|gb|ACS38598.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 250

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 108/240 (45%), Positives = 148/240 (61%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I     KS  
Sbjct: 9   PRLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR
Sbjct: 69  LRVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH---A 183
           ++   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L     
Sbjct: 129 LQANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEDASVTDPVAALRGAAD 188

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A+ P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 189 PANPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|320116218|ref|YP_004186377.1| hypothetical protein Thebr_1425 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|319929309|gb|ADV79994.1| protein of unknown function DUF558 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 245

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 113/244 (46%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNG-KDGEWLSKISYVGKSI 65
           ++++F+D            G+ +H+L +VLR+K G+ I+  +G K+     +     K I
Sbjct: 1   MRKIFIDRQNIKGEFVYIEGEDFHHLVNVLRLKRGNEIVASDGLKEYAARIEEIKKDKLI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
            F       +     ++       K+++++ +IQK  E+G+    PV+TRY        N
Sbjct: 61  LFLERELESNTESALEISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  + R R  +  A +Q     +P I  P + E  +   D     +   E   +    E
Sbjct: 121 INKKIARWRKISEEACKQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +  + I IGPEGG+  EE E   +   + P+SLGPRILR++TAA+A  ++V  
Sbjct: 181 VLKKAKGVKKIGIFIGPEGGFSQEEIELALN-KSIKPVSLGPRILRTETAAIAVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|107099405|ref|ZP_01363323.1| hypothetical protein PaerPA_01000417 [Pseudomonas aeruginosa PACS2]
          Length = 240

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 111/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLSLGQH-DLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+    + ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRGDDLRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A L+GPEGG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGF-HSARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|325273070|ref|ZP_08139378.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas sp. TJI-51]
 gi|324101804|gb|EGB99342.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas sp. TJI-51]
          Length = 239

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 109/248 (43%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLRM  GD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-DLPEAQAHYVGRVLRMAPGDAVQLFDGSGQEYRGHLLEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  Q+          +       +  R+D+ IQK+ E+G  AI P+I+   +    
Sbjct: 60  TVRVSLDQAFAGQADSPLHIHLGQGLSRGERMDWAIQKATELGANAITPIISERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   TLP I PPTTL   L +     ++V          
Sbjct: 120 DERADKRLAHWRQVAISACEQCGRSTLPAINPPTTLAEWLSSTHAELKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A LIGPEGG    E E      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHARPATLAFLIGPEGGLGDAEVEQAQRAGF-QAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|226311620|ref|YP_002771514.1| hypothetical protein BBR47_20330 [Brevibacillus brevis NBRC 100599]
 gi|226094568|dbj|BAH43010.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 252

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 9/243 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK--ISYVGKS 64
           ++R FV+     + +    GD  H++ +V+R +EG+ I++ +G      +K       + 
Sbjct: 1   MQRYFVEPHSFTENELTIVGDDVHHIVNVMRAREGEEIIVSDGAGRSARAKLVYLSAKEV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +E     +     V       K  +L++++QK  E+G  +  P  +  T      +
Sbjct: 61  RAEVMEMLQEERELPIRVTIGQGLPKGEKLEWILQKGTELGAYSFFPFSSERTIVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R R     AAEQ     LP +  P +   +L+          A E  GS    
Sbjct: 121 KEAKKLERWRKIVKEAAEQSHRAVLPELLSPVSFREILEAGQSYTHCAIAYEKEGSTTIH 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           + L  +    ++ +L+GPEGG+  EE     S  F+T +SLGPRILR++TA+   +A   
Sbjct: 181 QVLEEMTASDSLLVLVGPEGGFSPEEVAQAESKGFLT-VSLGPRILRTETASQYVLACAS 239

Query: 239 AIC 241
              
Sbjct: 240 YQF 242


>gi|121602013|ref|YP_988622.1| hypothetical protein BARBAKC583_0300 [Bartonella bacilliformis
           KC583]
 gi|120614190|gb|ABM44791.1| conserved hypothetical protein TIGR00046 [Bartonella bacilliformis
           KC583]
          Length = 247

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 117/245 (47%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +   +RLF+  PL +  +    G Q  YL HVLRM+EG  ILLFNG DGEWL+++  
Sbjct: 1   MRANYKFQRLFIQQPLVLNAEVIIEGSQASYLIHVLRMREGARILLFNGCDGEWLAELIT 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K I   ++ +Q R QT +SD+ Y F+PIK+ RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKIVVVRIIHQERVQTVRSDLVYCFAPIKSARLDYMVQKAVEMGVSVLQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+L    P  +LE LL +WD    + F DE+    N L 
Sbjct: 121 TRINMARIEANIIEASEQCGILSLSECAPTVSLEALLTSWDEARPLFFCDESHEFHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L        V +LIGPEGG+  EE+  L   PFV P+SLGPRILR+DTAAVAA+A++  
Sbjct: 181 LLKKY-RAMPVGVLIGPEGGFSEEERILLKKYPFVVPISLGPRILRADTAAVAALAIINT 239

Query: 240 ICGDW 244
             GDW
Sbjct: 240 TVGDW 244


>gi|254510112|ref|ZP_05122179.1| surface protein [Rhodobacteraceae bacterium KLH11]
 gi|221533823|gb|EEE36811.1| surface protein [Rhodobacteraceae bacterium KLH11]
          Length = 229

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 86/228 (37%), Positives = 126/228 (55%), Gaps = 3/228 (1%)

Query: 18  IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-VEYQSRSQ 76
                  + DQ HYL  V+R+  G  + LFNG+DGEWLS+++  GK         Q++  
Sbjct: 3   PGQSVPLTRDQAHYLFGVMRLSVGARVALFNGQDGEWLSEVAEAGKRGGVLGCIAQTKPL 62

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAE 136
               D+  +F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + + AAE
Sbjct: 63  QLPPDLWLLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSDRIRQDRLQAHAVEAAE 122

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGP 196
           QC    +P +     L+ +L  W    Q++F DE      S  +L         AILIGP
Sbjct: 123 QCGGTFVPEVAELQRLDRVLDAWPETRQLMFCDEAEVG--SALRLAKQEQNQPWAILIGP 180

Query: 197 EGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           EGG+  +E++ L +LP+   +SLGPRILR+DTA VAAM + Q   GDW
Sbjct: 181 EGGFSDKERKRLAALPYSHTVSLGPRILRADTAVVAAMTMWQQALGDW 228


>gi|28872189|ref|NP_794808.1| hypothetical protein PSPTO_5076 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855443|gb|AAO58503.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 239

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFSGTLLEVGKK 59

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E  +        +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVRVQLTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP  L   +K  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPASLAFLIGPEGGLNDAEVDQAQNAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|325204878|gb|ADZ00332.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M01-240355]
          Length = 241

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLADIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|254705760|ref|ZP_05167588.1| 16S ribosomal RNA methyltransferase RsmE [Brucella pinnipedialis
           M163/99/10]
          Length = 248

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 114/245 (46%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRXPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|213971885|ref|ZP_03399986.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato T1]
 gi|301385288|ref|ZP_07233706.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061292|ref|ZP_07252833.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato K40]
 gi|302131396|ref|ZP_07257386.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213923369|gb|EEB56963.1| conserved hypothetical protein TIGR00046 [Pseudomonas syringae pv.
           tomato T1]
          Length = 239

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E  +        +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVRVQLTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP  L   +K  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPASLAFLIGPEGGLNDAEVDQAQNAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|326389861|ref|ZP_08211425.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994129|gb|EGD52557.1| protein of unknown function DUF558 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 245

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 113/244 (46%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNG-KDGEWLSKISYVGKSI 65
           ++++F+D            G+ +H+L +VLR+K G+ I+  +G K+     +     K I
Sbjct: 1   MRKIFIDRQNIKGEFVYIEGEDFHHLVNVLRLKRGNEIVASDGLKEYAARIEEIKKDKLI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
            F       +     ++       K+++++ +IQK  E+G+    PV+TRY        N
Sbjct: 61  LFLERELESNTESALEISLFQGLPKSDKMELIIQKCAEIGVKKFIPVVTRYTVVDITKSN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
            +  + R R  +  A +Q     +P I  P + E  +   D     +   E   +    E
Sbjct: 121 INKKIARWRKISEEACKQSGRTGVPEICMPISFEEAINQVDKFDLCIIPYEKEQTSKLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L     +  + I IGPEGG+  EE E   +   + P+SLGPRILR++TAA+A  ++V  
Sbjct: 181 VLEKAKGVKKIGIFIGPEGGFSQEEIELALN-KSIKPVSLGPRILRTETAAIAVCSIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 ELGD 243


>gi|330957011|gb|EGH57271.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 239

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 116/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGLEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+I+   +    
Sbjct: 60  RVRVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIISERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP  L   ++  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIRLTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPASLAFLIGPEGGLNEAEVDQAQTAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|304313284|ref|YP_003812882.1| Protein of unknown function (DUF558) [gamma proteobacterium HdN1]
 gi|301799017|emb|CBL47260.1| Protein of unknown function (DUF558) [gamma proteobacterium HdN1]
          Length = 248

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F + PL   T+   +    H++  VLRMK GD +LLFNG  GE+  +I   GK 
Sbjct: 1   MRIPRIFQEIPLLEGTKVTLTESGSHHVTQVLRMKPGDQVLLFNGTGGEYFGEIEATGKR 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   +    +     V       K  R DY IQK+VE+G+  I P+ +R       
Sbjct: 61  GVEVLLTYFNEVDRASPLSVHLGQVIGKGERFDYAIQKAVELGVTEITPLFSRRCEVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   ++A EQ  +  +P I+ P  L    +    + + +   E      
Sbjct: 121 GPRLDKKLQQWKHLAVAACEQSGLNIIPQIHAPVALAEWAETVQADARWILHTEGEPHNP 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                       ++A  +GPEGG+   E  ++    F   +S+GPRI R++TA V  ++L
Sbjct: 181 F-----TQQAPQSLAFAVGPEGGFEDTEVSSVRERGFDC-VSMGPRIWRTETAPVVMLSL 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQYHWGD 241


>gi|229220845|ref|YP_223253.2| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 1
           str. 9-941]
 gi|229358031|ref|YP_418671.2| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis
           biovar Abortus 2308]
 gi|229597252|ref|YP_001932396.2| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus S19]
 gi|254690902|ref|ZP_05154156.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 6
           str. 870]
 gi|254695788|ref|ZP_05157616.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 3
           str. Tulya]
 gi|254698683|ref|ZP_05160511.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254732130|ref|ZP_05190708.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 4
           str. 292]
 gi|256256087|ref|ZP_05461623.1| 16S ribosomal RNA methyltransferase RsmE [Brucella abortus bv. 9
           str. C68]
 gi|260544638|ref|ZP_05820459.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260097909|gb|EEW81783.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 248

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 114/245 (46%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|148558128|ref|YP_001257708.1| 16S ribosomal RNA methyltransferase RsmE [Brucella ovis ATCC 25840]
 gi|225629236|ref|ZP_03787269.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|148369413|gb|ABQ62285.1| conserved hypothetical protein TIGR00046 [Brucella ovis ATCC 25840]
 gi|225615732|gb|EEH12781.1| conserved hypothetical protein [Brucella ceti str. Cudo]
          Length = 285

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|229597125|ref|YP_001622546.2| 16S ribosomal RNA methyltransferase RsmE [Brucella suis ATCC 23445]
          Length = 248

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLELGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|17988874|ref|NP_541507.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 1
           str. 16M]
 gi|256043637|ref|ZP_05446562.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256262333|ref|ZP_05464865.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260564827|ref|ZP_05835312.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990057|ref|ZP_06102614.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984700|gb|AAL53771.1| surface protein [Brucella melitensis bv. 1 str. 16M]
 gi|260152470|gb|EEW87563.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263000726|gb|EEZ13416.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092061|gb|EEZ16358.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 248

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|325131649|gb|EGC54355.1| hypothetical protein TIGR00046 [Neisseria meningitidis M6190]
 gi|325137512|gb|EGC60095.1| hypothetical protein TIGR00046 [Neisseria meningitidis ES14902]
 gi|325141520|gb|EGC63990.1| hypothetical protein TIGR00046 [Neisseria meningitidis 961-5945]
 gi|325199017|gb|ADY94473.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           G2136]
          Length = 241

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 110/246 (44%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +          + 
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIM----SINRAR 175

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +          +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 176 KLADIRQPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|256111326|ref|ZP_05452352.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis bv. 3
           str. Ether]
 gi|265992832|ref|ZP_06105389.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262763702|gb|EEZ09734.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 248

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP  +     +  L  WD + +++F DE   S++ L 
Sbjct: 121 LRLGTERIRANAIEAAEQCGVLSLPDCWEALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|330951354|gb|EGH51614.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae Cit
           7]
          Length = 239

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 115/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +  ++S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQQESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|194100123|ref|YP_002003263.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           NCCP11945]
 gi|240122667|ref|ZP_04735623.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268681265|ref|ZP_06148127.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|193935413|gb|ACF31237.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|268621549|gb|EEZ53949.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
          Length = 241

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVDLPDNIVRHL-NVLRIRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L                 S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSEST-----RLIMSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 CKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|239833512|ref|ZP_04681840.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239821575|gb|EEQ93144.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 248

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 114/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RL+V+  L   +Q + +    HYL HVLR+KEGD IL FNG+DGEW S+   
Sbjct: 1   MRANYKMQRLYVENDLQSGSQIEVASQAAHYLTHVLRLKEGDEILAFNGRDGEWKSRLRP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q   SD+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGKKRLFLEPFDQTRPQPPASDLIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR+R   I AAEQC +L+LP        +  ++ WD    ++F DE   S++ L 
Sbjct: 121 PKLGTDRIRVNAIEAAEQCGVLSLPACRETIRFDRFIEQWDETRHLIFCDEGHESDDPLT 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L A+   P  A+LIGPEGG+  +E++TL  LP+VT + LGPRILR+DTAAVAAMALVQ+
Sbjct: 181 ILQAMKPGP-AALLIGPEGGFSEDERQTLRRLPYVTAIPLGPRILRADTAAVAAMALVQS 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|330964692|gb|EGH64952.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 239

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 116/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +  +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVRVQLNKCFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP TL   +K  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMTLADWIKLTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHAKPVSLAFLIGPEGGLNDAEVDQAQTAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|296386918|ref|ZP_06876417.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PAb1]
 gi|313111958|ref|ZP_07797747.1| hypothetical protein PA39016_004050033 [Pseudomonas aeruginosa
           39016]
 gi|310884249|gb|EFQ42843.1| hypothetical protein PA39016_004050033 [Pseudomonas aeruginosa
           39016]
          Length = 240

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLALGQH-DLPETQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+  D + ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDDLRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A    +A L+GPEGG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGF-HAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|330984681|gb|EGH82784.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009640|gb|EGH89696.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 239

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 115/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|254559584|ref|YP_003066679.1| hypothetical protein METDI1041 [Methylobacterium extorquens DM4]
 gi|254266862|emb|CAX22661.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 250

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 107/240 (44%), Positives = 148/240 (61%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSIR 66
            RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++ +    KS  
Sbjct: 9   PRLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAELVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR
Sbjct: 69  LRVVVQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH---A 183
           ++   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L     
Sbjct: 129 LQANAIEAAEQCGILSVPEIGEPARLPGCLDALEANRLLVFCDEDASVTDPVAALRGAAD 188

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
            A+ P +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ GD
Sbjct: 189 PANPPPLAVLVGPEGGFHAEERALIAARPNTVVLSLGPRILRADTAAVAVLALVQAVLGD 248


>gi|59802454|ref|YP_209166.1| hypothetical protein NGO2160 [Neisseria gonorrhoeae FA 1090]
 gi|240079873|ref|ZP_04724416.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae FA19]
 gi|240127370|ref|ZP_04740031.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268596016|ref|ZP_06130183.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268685742|ref|ZP_06152604.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|293397817|ref|ZP_06642023.1| ribosomal RNA small subunit methyltransferase E [Neisseria
           gonorrhoeae F62]
 gi|59719349|gb|AAW90754.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|268549804|gb|EEZ44823.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268626026|gb|EEZ58426.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291611763|gb|EFF40832.1| ribosomal RNA small subunit methyltransferase E [Neisseria
           gonorrhoeae F62]
          Length = 241

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVDLPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSENTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 CKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|289625569|ref|ZP_06458523.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647472|ref|ZP_06478815.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298485033|ref|ZP_07003130.1| predicted methyltransferase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160443|gb|EFI01467.1| predicted methyltransferase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330865771|gb|EGH00480.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 239

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 116/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+G I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVGEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|240117029|ref|ZP_04731091.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID1]
 gi|268602715|ref|ZP_06136882.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268586846|gb|EEZ51522.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
          Length = 241

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L                 S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSEST-----RLIMSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 CKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|254787838|ref|YP_003075267.1| 16S rRNA m3U1498 methyltransferase [Teredinibacter turnerae T7901]
 gi|237684009|gb|ACR11273.1| 16S rRNA m3U1498 methyltransferase [Teredinibacter turnerae T7901]
          Length = 241

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 118/248 (47%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +          H+L  VLRM+ G  ++LFNG  GE+ + I+   K 
Sbjct: 1   MRIPRIYTQQLLQPEVDVVLEEAASHHLLKVLRMETGRELILFNGLGGEYRATITSATKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E+    +      +      + +R D+++QK+ E+G+  I P+ +  ++    
Sbjct: 61  AATVTISEHDPVERESPLVTELAVGISRGDRFDWVLQKATELGISRIVPLFSERSEVKLS 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I A EQC   TLP +  P ++E  + +   + + V    +     
Sbjct: 121 GERLEKRLSQWQKVVIGACEQCQRNTLPELTAPQSVENYVTDSLCDLRFVLHHRSTHH-- 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L  +A   +VA+L+GPEGG    E +   +  F +PL+LGPR+LR++TA + A+++
Sbjct: 179 ----LSQLAAPASVALLVGPEGGLSDAEIQLAENAGF-SPLALGPRVLRTETAPLVALSV 233

Query: 237 VQAICGDW 244
           VQA  GD+
Sbjct: 234 VQATWGDF 241


>gi|147677216|ref|YP_001211431.1| 16S ribosomal RNA methyltransferase RsmE [Pelotomaculum
           thermopropionicum SI]
 gi|146273313|dbj|BAF59062.1| Uncharacterized protein conserved in bacteria [Pelotomaculum
           thermopropionicum SI]
          Length = 249

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 107/245 (43%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV        +   +G    ++  VLR+  GD + + +G+   + + I   G +  
Sbjct: 1   MPRFFVSPEQIKDGRIIITGPDVVHITRVLRLGRGDCLTVLDGRGRSYEAVIEKAGAAEV 60

Query: 67  FKVEYQSRSQT--KQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
             V     +        V  +    + +++D+++QK  E+GM  + P+I R +       
Sbjct: 61  VCVAGSVTAAGGLPAVKVTLVQGIPRGDKMDFIVQKGTELGMHRLIPLICRRSVVKLEGD 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
            +   ++R R   + A++QC    +P +  P   + +L         +   E    E   
Sbjct: 121 KSFRRLERWRRIALEASKQCRRPDVPEVDAPAGWDRVLAGMPPEAAALIPWEEEDGETLK 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           + L        V + IGPEGG+   E +   ++  V P++LGPRILR++TA +A + +V 
Sbjct: 181 DFLRRSLPKEEVYVFIGPEGGFDPGEVDKARAVG-VRPVTLGPRILRTETAGLAVLVMVL 239

Query: 239 AICGD 243
              GD
Sbjct: 240 YQWGD 244


>gi|291615399|ref|YP_003525556.1| hypothetical protein Slit_2944 [Sideroxydans lithotrophicus ES-1]
 gi|291585511|gb|ADE13169.1| protein of unknown function DUF558 [Sideroxydans lithotrophicus
           ES-1]
          Length = 245

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 111/245 (45%), Gaps = 12/245 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R +   PL + T  +   +  H+ + VLR++ GD + +F+G      + I+ +      
Sbjct: 4   PRFYCPPPLPLATNFELPPEAAHHASRVLRLRVGDAVQIFDGLGNALDATINAINGKHVL 63

Query: 68  KVEYQSRSQTKQSDVQ--YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
               Q+    ++S +      +   + ++D+++QK+ E+G   I PV T        +  
Sbjct: 64  LGNLQTFMGQQESGLHIALAQAMCTSEKMDWVVQKATELGAAEIIPVQTLRSVARLSSPR 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +  R   +SA EQC   TLP +  P  L   L++  H     F         ++ 
Sbjct: 124 AEKRAEHWRNVAVSACEQCGRNTLPQLQTPQELGTWLEDVRHTAGGKFILLPG---GAIN 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                       +LIGPEGG+ ++E        F+ P+ LGPR+LR++TAA+A +A +Q 
Sbjct: 181 LQSQPRPQGRATLLIGPEGGFTADEANIAQQAGFI-PILLGPRVLRTETAALAGIAALQT 239

Query: 240 ICGDW 244
           + GD+
Sbjct: 240 LWGDF 244


>gi|328474086|gb|EGF44891.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio parahaemolyticus
           10329]
          Length = 243

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + I  V K 
Sbjct: 1   MRIPRIYHPETIHQLGTIALSEDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVIREVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E    +     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVLVDVTERVESNIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEQWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  SEE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSEEIDMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|152998316|ref|YP_001343151.1| hypothetical protein Mmwyl1_4321 [Marinomonas sp. MWYL1]
 gi|150839240|gb|ABR73216.1| protein of unknown function DUF558 [Marinomonas sp. MWYL1]
          Length = 248

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 113/252 (44%), Gaps = 18/252 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGK------DGEWLSKI 58
             + R+F+D  L   T        + +L  VLR+K    I +FNG+           +  
Sbjct: 1   MRIPRIFIDSELNENTTIPLPDSAFQHLCKVLRLKSDHPIRVFNGQEFNGKSGQFNATLC 60

Query: 59  SYVGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT 117
               +S    V ++++ +      V    +  +  R+DY IQKSVE G+ AI+P+ +   
Sbjct: 61  DVEKRSANIHVADFEALNNEPPIQVTIGQTLSRGERMDYAIQKSVEAGVFAIQPLFSERC 120

Query: 118 QNT------HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET 171
           +               +   ISAAEQC    +P +YPP  L   + N +   ++     +
Sbjct: 121 EVKLQDGRAEKRQQHWQQIAISAAEQCGRGVVPIVYPPMGLSEWVANCNEMLKLTLHHHS 180

Query: 172 CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
                  EK         VA+LIGPEGG   +E +      F   ++LGPR+LR++TA +
Sbjct: 181 AKPIRQYEK----PANNQVALLIGPEGGLTEKEVQLSEKSGF-NAITLGPRVLRTETAPI 235

Query: 232 AAMALVQAICGD 243
            A++++ A+ GD
Sbjct: 236 VALSVINALWGD 247


>gi|302188983|ref|ZP_07265656.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           syringae 642]
          Length = 239

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLNESFAGQVESVLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLTEWIKQTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|326410911|gb|ADZ67975.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis M28]
 gi|326554202|gb|ADZ88841.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis
           M5-90]
          Length = 285

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 115/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQA 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|28899384|ref|NP_798989.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153839188|ref|ZP_01991855.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260366255|ref|ZP_05778714.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus K5030]
 gi|260878928|ref|ZP_05891283.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AN-5034]
 gi|260898271|ref|ZP_05906767.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus Peru-466]
 gi|260903375|ref|ZP_05911770.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AQ4037]
 gi|28807620|dbj|BAC60873.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747290|gb|EDM58274.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308085866|gb|EFO35561.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus Peru-466]
 gi|308090439|gb|EFO40134.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AN-5034]
 gi|308107481|gb|EFO45021.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus AQ4037]
 gi|308113508|gb|EFO51048.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           parahaemolyticus K5030]
          Length = 243

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETIHQLGTIALSEDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E    +     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVLVDVTERVESNIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEQWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  SEE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSEEIDMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|70733090|ref|YP_262863.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           Pf-5]
 gi|68347389|gb|AAY94995.1| conserved hypothetical protein TIGR00046 [Pseudomonas fluorescens
           Pf-5]
          Length = 239

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 115/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +    +    Q HY+  VLRM EG  + +F+G   E+   +  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGEH-ELPEAQAHYIGRVLRMAEGAALQVFDGSGTEFRGALVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S    Q     +       +  R+D+ IQK+ E+G+  I P+ +   +    
Sbjct: 60  RVRVQLNESFAGQQESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPIFSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC    +P I+PP  L   +K    + ++V          
Sbjct: 120 DERADKRLLHWRQVAISACEQCGRSQVPVIHPPVLLADWIKQARADLKLVLHPVA----- 174

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             + L + A   ++A LIGPEGG    E E  HS  F+ P  LGPR+LR++TA V A+A+
Sbjct: 175 --QPLESHAKPASLAFLIGPEGGLTDAEVELSHSAGFL-PARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|320322008|gb|EFW78104.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330886|gb|EFW86860.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330872110|gb|EGH06259.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 239

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 114/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|330942525|gb|EGH45109.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 239

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|254804259|ref|YP_003082480.1| hypothetical protein NMO_0244 [Neisseria meningitidis alpha14]
 gi|304388478|ref|ZP_07370582.1| 16S rRNA methyltransferase RsmE [Neisseria meningitidis ATCC 13091]
 gi|254667801|emb|CBA03770.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|304337534|gb|EFM03699.1| 16S rRNA methyltransferase RsmE [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|237816954|ref|ZP_04595946.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297249441|ref|ZP_06933142.1| ribosomal RNA small subunit methyltransferase E [Brucella abortus
           bv. 5 str. B3196]
 gi|237787767|gb|EEP61983.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297173310|gb|EFH32674.1| ribosomal RNA small subunit methyltransferase E [Brucella abortus
           bv. 5 str. B3196]
          Length = 285

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 114/245 (46%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 38  MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 97

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 98  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQV 157

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 158 LRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 217

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 218 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQA 276

Query: 240 ICGDW 244
           + GDW
Sbjct: 277 VLGDW 281


>gi|209966873|ref|YP_002299788.1| 16S ribosomal RNA methyltransferase RsmE [Rhodospirillum centenum
           SW]
 gi|209960339|gb|ACJ00976.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 260

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 135/238 (56%), Gaps = 2/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFVD PL         G + HYL  VLRM+ G+ +L FNG+DGEWL++++ +GKS   
Sbjct: 7   TRLFVDAPLSEGAAVPLEGGRAHYLRTVLRMQPGERVLAFNGRDGEWLAEVAQLGKSGGT 66

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                + R QT +     +F+P+K  R D + +K+ E+G   + PV TR T     N++R
Sbjct: 67  LTALRRERDQTGEEGPWLLFAPLKGGRSDSVAEKATELGAAVLHPVFTRRTDVGRVNLER 126

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +    + AAEQC+ L++P +     L   L+ WD    +  A E+  +  ++  + A   
Sbjct: 127 LAANAVEAAEQCERLSVPEVREACPLFKALEGWDPARVLFVAAESGQAMPAVSAVTAQ-R 185

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               A L+GPEGG+   E + L  LPFV P+ LGPR+LR+DTAA A +A+ QA+ GDW
Sbjct: 186 GRPAAWLLGPEGGFDRAELDGLLHLPFVVPVGLGPRVLRADTAAFAVLAVWQALAGDW 243


>gi|260773596|ref|ZP_05882512.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           metschnikovii CIP 69.14]
 gi|260612735|gb|EEX37938.1| ribosomal RNA small subunit methyltransferase E [Vibrio
           metschnikovii CIP 69.14]
          Length = 243

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D  +++  VLRM+ G ++ LF+G D E+ + IS + K 
Sbjct: 1   MRIPRIYHPSPIHQLGTLALSDDAANHIGKVLRMQPGQSVTLFDGSDAEFPAVISEISKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  Q   ++ +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QLTVDIQQRIEKSIESPLNLHLGQVISRGDKMEFTIQKSVELGVNTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   LE          ++        S N
Sbjct: 121 PKRFEKKLQQWQKIAIAACEQCGRNIVPVIRPVMELEAWCAEPSQALKLNLHPRASYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG   +E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVNKVRLLIGPEGGLSEQEIAMTEQYHFAETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|152976741|ref|YP_001376258.1| hypothetical protein Bcer98_3037 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025493|gb|ABS23263.1| protein of unknown function DUF558 [Bacillus cytotoxicus NVH
           391-98]
          Length = 249

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+      T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKNVNGTTIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAACTIAEITNEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPVITRYTQN 119
              VE+   +      V       K ++L+ + QK  E+G        A R ++    + 
Sbjct: 61  STIVEWIETTSELPILVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
           T   ++R++     AAEQ     +P +Y P + + LL+        + A E    +    
Sbjct: 121 TDKKVERLKKIVKEAAEQSHRTEIPHVYAPVSFKQLLEMSKEYDVCLVAYEEEAKQGEKA 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTIEPGQKLLIVFGPEGGLSEEEVSALREYKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|330899324|gb|EGH30743.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 239

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPIPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVAQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|239998111|ref|ZP_04718035.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae 35/02]
 gi|240112081|ref|ZP_04726571.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae MS11]
 gi|240124855|ref|ZP_04737741.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|254492891|ref|ZP_05106062.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268593962|ref|ZP_06128129.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268598139|ref|ZP_06132306.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268683436|ref|ZP_06150298.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|226511931|gb|EEH61276.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268547351|gb|EEZ42769.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268582270|gb|EEZ46946.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268623720|gb|EEZ56120.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|317165554|gb|ADV09095.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 241

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L                 S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSEST-----RLIMSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|83644376|ref|YP_432811.1| 16S ribosomal RNA methyltransferase RsmE [Hahella chejuensis KCTC
           2396]
 gi|83632419|gb|ABC28386.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 247

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 78/251 (31%), Positives = 118/251 (47%), Gaps = 19/251 (7%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +    R+F+D PL   +Q   +GDQ +Y+  VLRM+ GD   LF+G   ++  K+  
Sbjct: 1   MRNN----RIFIDQPLDGLSQLTLTGDQANYVGRVLRMRPGDAFHLFSGDGRDFPVKVLA 56

Query: 61  VGKSIR--FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ 118
           VG+        E  +        V       +  R+DY +QKS EMG+ A+ P+++   +
Sbjct: 57  VGRRDVEVALSEPLAIEAESPLRVHLGQVLSRGERMDYAVQKSTEMGVTALTPLLSERCE 116

Query: 119 ------NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
                          R  +ISA EQC    +P I   T LE  L++   + +++      
Sbjct: 117 VRLDGERQDKRWRHWRQVSISACEQCGRARVPDIGDVTPLESWLQSATADLKLILHP--- 173

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                           +V +LIGPEGG+  EE        FV    LGPRILR++TA VA
Sbjct: 174 ---GDARAWSPAQPPASVCLLIGPEGGFTDEEVALAERHGFVHA-PLGPRILRTETAPVA 229

Query: 233 AMALVQAICGD 243
           A+AL+Q + GD
Sbjct: 230 ALALMQWLWGD 240


>gi|325201437|gb|ADY96891.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M01-240149]
 gi|325207417|gb|ADZ02869.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           NZ-05/33]
          Length = 241

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 112/246 (45%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +        +   
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIMSINRARKLGD 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  + A    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 180 IRQPSGA----IVFMVGPEGGWTEQEEQQAFDAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|332142455|ref|YP_004428193.1| hypothetical protein MADE_1015315 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552477|gb|AEA99195.1| hypothetical protein MADE_1015315 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 242

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 115/248 (46%), Gaps = 14/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+ ++ + + + D  H++A VLR+K    I+LFNG   E+ +++  V + 
Sbjct: 1   MRIPRVYYPNPIPLEQEFELTEDAGHHIATVLRIKPNRPIVLFNGDGNEYSAQVISVQRK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
                     S ++     +       K +R+D ++QKSVE+G+  I PVIT        
Sbjct: 61  KVIVEADACLSLAKESPLHLHLGQGVSKGDRMDTVLQKSVELGVSEITPVITERCTVKLD 120

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I A EQ     +P +  P +L   L +  +  ++V A        
Sbjct: 121 ESRWEKKIQQWQKIVIGACEQSGRNIIPKLNAPVSLNTWLSSSTNTTRLVLAPGAEQ--- 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                    +     +LIGPEGG    E    +   +   +SLGPRILR++TAA+ ++++
Sbjct: 178 --PLARQPYNAQGFRLLIGPEGGLSDTEIHQANENGY-QSVSLGPRILRTETAAITSLSI 234

Query: 237 VQAICGDW 244
           +QA  GD+
Sbjct: 235 LQAQHGDF 242


>gi|240013291|ref|ZP_04720204.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae DGI18]
 gi|240120363|ref|ZP_04733325.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID24-1]
          Length = 241

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVDLPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L                 S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSEST-----RLIMSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|325292039|ref|YP_004277903.1| hypothetical protein AGROH133_04165 [Agrobacterium sp. H13-3]
 gi|325059892|gb|ADY63583.1| hypothetical protein AGROH133_04165 [Agrobacterium sp. H13-3]
          Length = 261

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 98/226 (43%), Positives = 152/226 (67%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL      +A+ +Q++YLA+VLRM +G  ILLFNG+DGEW +++S+
Sbjct: 17  MRANFRMQRLFVETPLVAGAAQEATTEQFNYLANVLRMTDGAEILLFNGRDGEWKARLSF 76

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +     +   Q+R Q   SD+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 77  PSRKKITLIPLEQTRPQPSASDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 136

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
             +N +++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L 
Sbjct: 137 KIHNTEKLRANAIEAAEQCGILSLPDVAEPVKLKDMLETWPRDRRIIYCDEGDAGQNPLP 196

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L +I     +A+L+GPEGG+  EE+E L SL FVTP+ LGPRILR
Sbjct: 197 VLQSIKE-RKIALLVGPEGGFSEEERELLRSLAFVTPIPLGPRILR 241


>gi|297584653|ref|YP_003700433.1| hypothetical protein Bsel_2365 [Bacillus selenitireducens MLS10]
 gi|297143110|gb|ADH99867.1| protein of unknown function DUF558 [Bacillus selenitireducens
           MLS10]
          Length = 250

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 106/246 (43%), Gaps = 13/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF--NGKDGEWLSKISYVGKS 64
           ++R FV+     +     +GD  H+++ V+RM +GD I+    +G  G    + +  G+ 
Sbjct: 1   MQRYFVEADQMKEDLFILTGDDAHHISKVMRMTDGDRIICCMPDGSCGTATIQSTAEGRV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
                 +   +     +V       K ++L+ +IQK+ E+G+ ++ PV    +       
Sbjct: 61  HAELETWLKETSEMPVEVTLAQGLPKGDKLELIIQKATELGVSSVIPVQMSRSIAKIDEK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----GS 174
                + R R     AAEQ     +P I  P +   +    +    ++ A E        
Sbjct: 121 KAGKKVVRWRKIAKEAAEQAHRNRVPCISEPVSFTRVQGLVEEYDLVIAAYEEEGKAGNH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L+ +     + ++IGPEGG+  EE E L     V  +S+GPRILR++TA +  +
Sbjct: 181 HALPVLLNGLLPGQRILVIIGPEGGFSPEEIEKLERAG-VRSVSIGPRILRTETAPLYVL 239

Query: 235 ALVQAI 240
           A V   
Sbjct: 240 AAVSYQ 245


>gi|220920410|ref|YP_002495711.1| hypothetical protein Mnod_0365 [Methylobacterium nodulans ORS 2060]
 gi|219945016|gb|ACL55408.1| protein of unknown function DUF558 [Methylobacterium nodulans ORS
           2060]
          Length = 267

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 104/243 (42%), Positives = 139/243 (57%), Gaps = 7/243 (2%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIR 66
            RLF+D P+    +      Q +YL  VLR  EGD +L+FNG+DGEW ++I     K+  
Sbjct: 9   PRLFLDLPMREGMRHSLDRAQANYLLGVLRRGEGDGVLVFNGRDGEWRAEIQPTGRKAGD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +  Q+R QT   ++ Y+F+P+K  RLDY+ QK+VEMG   IRPVITR TQ     +DR
Sbjct: 69  LILREQTRPQTPPGNLHYLFAPLKAARLDYVAQKAVEMGASLIRPVITRRTQGDRIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC ILT+P I     L   L   +    +VF DE     + +  L     
Sbjct: 129 LRANAIEAAEQCGILTIPEIAEAAPLPAALSALEAERLLVFCDEDAPVADPIMTLRQAGA 188

Query: 187 IPN------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                    +A++IGPEGG+  EE+  +   P    LSLGPRILR+DTAAVA +ALVQA+
Sbjct: 189 GREGNGGLPLAVVIGPEGGFTPEERALILDRPNTVRLSLGPRILRADTAAVAVLALVQAV 248

Query: 241 CGD 243
            GD
Sbjct: 249 LGD 251


>gi|240015737|ref|ZP_04722277.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae FA6140]
          Length = 241

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L                 S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSENT-----RLIMSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|66043720|ref|YP_233561.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           syringae B728a]
 gi|63254427|gb|AAY35523.1| Conserved hypothetical protein 46 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330971683|gb|EGH71749.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 239

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E        F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVTQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|152984501|ref|YP_001345914.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           PA7]
 gi|150959659|gb|ABR81684.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 240

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLALGQH-DLPEAQAHYIGRVLRHATGDAVQLFDGSGREYLGELIEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+  D   ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPRIHPPLALEDWLRQRDDELRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A L+GPEGG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHARPASLAFLVGPEGGLGDAEVEQAQAAGF-HSARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|332991913|gb|AEF01968.1| hypothetical protein ambt_02070 [Alteromonas sp. SN2]
          Length = 242

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 117/248 (47%), Gaps = 14/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+ ++ + + + +  H++A VLR+K    I+LFNG   E+ ++I    + 
Sbjct: 1   MRIPRIYYPNPIPLEEEFQLTEEAGHHIASVLRLKANHPIVLFNGDGNEYSAQIINAQRK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
             F       + S+    ++       K +R+D ++QKSVE+G+  I P+++        
Sbjct: 61  KVFVEADACLTLSKESSLNIHLGQGVSKGDRMDTVLQKSVELGVTEITPILSERCTVKLD 120

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I A EQ    TLP + PP  L   L     + ++V A        
Sbjct: 121 EARWEKKLLQWQKIIIGACEQSGRNTLPSLNPPIALNKWLSESTSSSRLVLAPGAE---- 176

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                    +     +LIGPEGG    E    +   F T  SLGPRILR++TAA++++++
Sbjct: 177 -KPLARQPYNSQGFRLLIGPEGGLSEGEIHQANESGF-TSCSLGPRILRTETAAISSISI 234

Query: 237 VQAICGDW 244
           +QA  GD+
Sbjct: 235 LQAQHGDF 242


>gi|315122545|ref|YP_004063034.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495947|gb|ADR52546.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 254

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 178/245 (72%), Positives = 211/245 (86%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK+H  LKRLFV+F L  K QGKAS  QYHYLAHVLRMKE + +L+FNG+DGEW+S ISY
Sbjct: 1   MKMHPPLKRLFVNFSLQPKAQGKASDAQYHYLAHVLRMKEKEKVLIFNGEDGEWISTISY 60

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           + KSI F VE+Q+R+QTK SD+ YIFSPIKTNRLDYMIQKSVEMG+ AIRPVITRYTQNT
Sbjct: 61  IKKSISFNVEHQTRTQTKPSDLHYIFSPIKTNRLDYMIQKSVEMGVSAIRPVITRYTQNT 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
           H N++R+RTY ISAAEQC+I++LP I+PP TL+ LL++WD N  IVFADETC  ENS  K
Sbjct: 121 HCNVNRMRTYAISAAEQCNIISLPSIHPPITLDTLLEDWDQNRHIVFADETCIHENS--K 178

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           + AIAHI ++A+LIGPEGG+H +EKE LHSLPFVTP+SLGPRILR+DTAAVAA+ALVQ+ 
Sbjct: 179 IQAIAHIVHMAVLIGPEGGFHPKEKEKLHSLPFVTPISLGPRILRADTAAVAAIALVQST 238

Query: 241 CGDWY 245
           CGDWY
Sbjct: 239 CGDWY 243


>gi|330878069|gb|EGH12218.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 239

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E  +        +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVRVQLTECFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP  L   +K  D + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTDADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG +  E     +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHARPASLAFLIGPEGGLNDAEVHQAQTAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|163850332|ref|YP_001638375.1| hypothetical protein Mext_0899 [Methylobacterium extorquens PA1]
 gi|163661937|gb|ABY29304.1| protein of unknown function DUF558 [Methylobacterium extorquens
           PA1]
          Length = 250

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 106/240 (44%), Positives = 148/240 (61%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLFV+  L           Q +YL  VLR  EG+ +LLFNG+DGEW ++I     KS  
Sbjct: 9   PRLFVEADLAEGRVLPLERAQANYLLTVLRRAEGEPVLLFNGRDGEWRAEIVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  Q+R Q   +D+ Y+F+P+KT R+DYM QK+VEMG G ++PV TR+TQ     +DR
Sbjct: 69  LRVVAQTRPQPAPADLHYLFAPLKTGRIDYMAQKAVEMGAGRLQPVFTRFTQGERIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           ++   I AAEQC IL++P I  P  L   L   + N  +VF DE     + +  L   A+
Sbjct: 129 LQANAIEAAEQCGILSVPEIGEPARLPACLDALEANRLLVFCDEDASVTDPVVALRGAAN 188

Query: 187 IPN---VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             +   +A+L+GPEGG+H+EE+  + + P    LSLGPRILR+DTAAVA +ALVQA+ G+
Sbjct: 189 PASPPPLAVLVGPEGGFHAEERALIAARPNTVALSLGPRILRADTAAVAVLALVQAVLGN 248


>gi|152981289|ref|YP_001352520.1| 16S ribosomal RNA methyltransferase RsmE [Janthinobacterium sp.
           Marseille]
 gi|151281366|gb|ABR89776.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 241

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 119/245 (48%), Gaps = 13/245 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +   PL I           H++  V+R+  GD+I LFNG+ GE+ + I+ + K   
Sbjct: 1   MPRFYCPQPLAIGAVITLPDHVAHHI-QVVRLGSGDHITLFNGEGGEYTATITTIEKKRV 59

Query: 67  FKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                    +       V    +  + +++D++I+K+VE+G+ AI+P+ ++        +
Sbjct: 60  TAEIKLFTPREVELPYAVTVAQALPEASKMDWIIEKAVELGVHAIQPLASQRCVVRLSAE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                M   +   ++A+EQ     L  +  P      ++  D + +I+ +      E SL
Sbjct: 120 RAAKKMQHWQGVIVAASEQSGRNRLAALAEPVDFNQWVQQKDLHKRILLSPRA---EQSL 176

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                     +VA++IGPEGG+  +E++   +      LS+GPR+LR++TA ++A+A + 
Sbjct: 177 SDWARHHPPQSVALMIGPEGGFTDKEEDLALAQG-ALMLSMGPRVLRTETAGLSALAALN 235

Query: 239 AICGD 243
           A+ G+
Sbjct: 236 AVWGE 240


>gi|116250629|ref|YP_766467.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255277|emb|CAK06352.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 245

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 98/226 (43%), Positives = 143/226 (63%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RLFVD PL      +A+ DQ++YL +VLRM+EG  ILLFNG+DGEW +    
Sbjct: 1   MRANFRMQRLFVDAPLSSGAVVEANADQFNYLGNVLRMEEGAEILLFNGRDGEWKATLTF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q +  D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC IL +P +  P  L  LL +W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGILGIPDVAEPVRLLDLLDHWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLSAIRERH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|77361513|ref|YP_341088.1| hypothetical protein PSHAa2598 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876424|emb|CAI87646.1| putative RNA methyltransferase with a deep trefoil knot, RrmA and
           YibK are structural paralogs [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 244

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             +  ++    + + T      D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K 
Sbjct: 1   MRVPHIYQASSIALNTPVTLDDDAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVTKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               +  Q  +        +       + +++D+ IQKSVE+G+  I P+ ++       
Sbjct: 61  NVVVMPQQLNTHDVESPLKIHLGQCVSRGDKMDFTIQKSVELGITEITPIFSQRCGVKLM 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+AAEQ     +P ++PP  L+  L       ++        S  
Sbjct: 121 GDRLDKKHQQWQKIAIAAAEQSGRNFVPVVHPPVDLKQWLAQQSAAIKLTLHPRAEHSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           ++           V  L+GPEGG+  EE        FV  + LGPR+LR++TAA+  ++ 
Sbjct: 181 TITV-----PKDGVRFLVGPEGGFTDEEMAQTKQQNFV-DIRLGPRVLRTETAALTVLSA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLQFGD 241


>gi|167630502|ref|YP_001681001.1| hypothetical protein HM1_2440 [Heliobacterium modesticaldum Ice1]
 gi|167593242|gb|ABZ84990.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 254

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 109/254 (42%), Gaps = 17/254 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R   +       +     ++  +L+ VLR++ GD +L F+G+  E+ + ++ +     
Sbjct: 1   MYRFLFEPRNLTGARVCLDREESQHLSKVLRLRAGDAVLAFDGQGNEYEAIVAEINGDKA 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
           F   +     S+     +  +    K  +++ +IQK+ E+G+  I PV+T  +       
Sbjct: 61  FLESLRPTGASREAPIRLWLLQGVAKGEKMELVIQKATELGVEKIFPVLTERSVVRFDAA 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 DR +     AA+QC    +P +  P     ++ +WD    ++   E    +   
Sbjct: 121 KAKERRDRWQKIAREAAKQCWRTVIPEVQLPAAWAEVITDWDMTMPLLIPWEKEQGKGLK 180

Query: 179 EKLH--------AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           + L           +    + + IGPEGG  + E            +SLGPRILR++TA 
Sbjct: 181 QVLTVLKKEGLLHDSPAKVIGLAIGPEGGLTAAEVALARDRG-ARTVSLGPRILRTETAG 239

Query: 231 VAAMALVQAICGDW 244
           +AA+A +    GDW
Sbjct: 240 IAALAAIMYELGDW 253


>gi|240114827|ref|ZP_04728889.1| 16S rRNA m3U1498 methyltransferase [Neisseria gonorrhoeae PID18]
 gi|260441357|ref|ZP_05795173.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria gonorrhoeae
           DGI2]
 gi|268600483|ref|ZP_06134650.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291044717|ref|ZP_06570426.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268584614|gb|EEZ49290.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291011611|gb|EFE03607.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 241

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 110/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHTARLTVLEKHRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSENTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+  +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAAITAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|302877374|ref|YP_003845938.1| hypothetical protein Galf_0129 [Gallionella capsiferriformans ES-2]
 gi|302580163|gb|ADL54174.1| protein of unknown function DUF558 [Gallionella capsiferriformans
           ES-2]
          Length = 243

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 111/246 (45%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +   P+  +       D  H+ + VLR++EGD++ LF+G   E+   I+ +     
Sbjct: 1   MPRFYCPPPIPAQGAFNLPADAAHHASRVLRLREGDSVQLFDGTGHEYHGAITDMTGKQV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               + +    +     +    +   + ++D++IQK+ E+G   I+P+ T  +       
Sbjct: 61  VVGDIVHIEADRESPLQIVLAQALCSSEKMDWVIQKATELGATEIQPLATGRSVAKLSAD 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +  +   ISA EQC    LP I+PP  +   L++   +    +       + + 
Sbjct: 121 RAAKRTEHWQQVAISACEQCGRNVLPVIHPPVEIGTWLQHMLDSDMSKY---ILLPQGAK 177

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                        +LIG EGG+   E +      F TP+ LG R++R++TAAVA +A++Q
Sbjct: 178 SLQEQEKPQSGAVLLIGAEGGFTEAESDNALRCGF-TPVRLGARVMRTETAAVAGLAVLQ 236

Query: 239 AICGDW 244
            + GD+
Sbjct: 237 TLWGDF 242


>gi|237798149|ref|ZP_04586610.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021001|gb|EGI01058.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 239

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTETPLSLGEH-ELPEAQVHYISRVLRMTEGDALQLFDGSGLEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +  +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVRVQMTERFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+PP  L   +K  + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHPPMPLADWIKLTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEIDQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|88859066|ref|ZP_01133707.1| putative RNA methyltransferase with a deep trefoil knot
           [Pseudoalteromonas tunicata D2]
 gi|88819292|gb|EAR29106.1| putative RNA methyltransferase with a deep trefoil knot
           [Pseudoalteromonas tunicata D2]
          Length = 243

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             +  ++    + I    +   D   ++  VLRM  GD + LFNG+ G++L++++ V K 
Sbjct: 1   MRIPHIYHPGSIEIGQILQLDDDAAGHIGRVLRMSIGDKVCLFNGQGGQFLAELTEVSKK 60

Query: 65  -IRFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
            +  ++E ++         +       + +++D+ IQKSVE+G+  I P+ T        
Sbjct: 61  GVNVQIESFEEHDVESPLKIHLGQGISRGDKMDFTIQKSVELGVTEITPLFTERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+AAEQ     +  I+PP  LE  L       ++        S  
Sbjct: 121 GDRLEKKHQQWQKIAIAAAEQSGRNFVTVIHPPIKLEQWLSQQSDELKLTLHPRAEHSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           ++ K         +  ++GPEGG+   E     +  F+  + LGPRILR++TAA+  ++ 
Sbjct: 181 TITK-----PTEGLRFIVGPEGGFTDAEMLMTKNSGFI-DIRLGPRILRTETAALTVLSA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLEFGD 241


>gi|229007176|ref|NP_353680.3| hypothetical protein Atu0657 [Agrobacterium tumefaciens str. C58]
          Length = 245

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 96/226 (42%), Positives = 148/226 (65%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RLF++  L      +A+G+Q++YLA+VLRM +G  ILLFNG+DGEW +K   
Sbjct: 1   MRANFRMQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRDGEWKAKLSF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q+R Q   +++ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKKISLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
             +N +++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L 
Sbjct: 121 KIHNSEKLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L A+     +A+L+GPEGG+  EE+  L SL FVTP+ LGPRILR
Sbjct: 181 ILQAVKE-RKIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILR 225


>gi|297529333|ref|YP_003670608.1| hypothetical protein GC56T3_0989 [Geobacillus sp. C56-T3]
 gi|297252585|gb|ADI26031.1| protein of unknown function DUF558 [Geobacillus sp. C56-T3]
          Length = 258

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 91/247 (36%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV            SGD  H++A V+RMK GD I+         + +I  +     
Sbjct: 1   MQRYFVSGQAQQGGIVAISGDDAHHIARVMRMKPGDGIICVFPDGRTAVCEIEQIANEHV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                Q + +  +  V+   +        + +                 A R V+    +
Sbjct: 61  QVRIVQWKEERSELPVRIYIAQGLPKGEKWELVIQKGTELGAAGFLPFEAARSVVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE----TCGS 174
                ++R +     AAEQ +   +P +  P +   LL         +FA E        
Sbjct: 121 KAEKKVERWKKIAKEAAEQAERTVVPDVRAPLSFVELLAFGQTVDVRLFAYEKEARNARH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  +     +  + GPEGG+  EE E L    F +P SLGPRILR++TA +  +
Sbjct: 181 AALPALLSRLRPGGALLAVFGPEGGFSPEEAEQLRQHGF-SPCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           +      
Sbjct: 240 SAASYEW 246


>gi|56461316|ref|YP_156597.1| 16S ribosomal RNA methyltransferase RsmE [Idiomarina loihiensis
           L2TR]
 gi|56180326|gb|AAV83048.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 243

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    + ++ + + S D + +L  VLR+  GD+I+LFNG    + +KI+ V K 
Sbjct: 1   MRVPRIYHPASISLQNETELSADAFQHLIKVLRLNVGDSIVLFNGDGQNYEAKITSVQKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q+ +     ++       + +R+D+++QKSVE+G+  I P+ +        
Sbjct: 61  SAQFVATSSQANASESPVNIHLAQVVSRGDRMDFVLQKSVELGVTEITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +    SA EQC    +P + P   L   + +     ++          +
Sbjct: 121 GDRLEKKQLQWQKIVHSACEQCGRSVVPQVKPAQQLTDFIASSFEGLRLTLDPTATQPLS 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S ++         + +LIGPEGG+   E      L F  P+ LGPRILR++TAA++A+  
Sbjct: 181 SFQQAEK-----GIQLLIGPEGGFTDTEVSAAGQLGF-KPMRLGPRILRTETAALSALTA 234

Query: 237 VQAICGD 243
           VQ   GD
Sbjct: 235 VQYQFGD 241


>gi|332305394|ref|YP_004433245.1| hypothetical protein Glaag_1016 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172723|gb|AEE21977.1| protein of unknown function DUF558 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 242

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L      + + D  +++A+VLR K G  ++LFNG   E+  +   V K 
Sbjct: 1   MRISRIYHPGALHSDQVLELTSDASNHVANVLRSKVGQPVVLFNGDGNEYSGEFIDVSKR 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                     S S      +       + +R+D ++QKSVE+G+  I P+IT        
Sbjct: 61  KVRVQIDAKLSISLESPLSIHLGQGISRGDRMDLVLQKSVELGVTEITPLITERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            Q       + +   I+A EQC    +P ++ PT  +  +       ++        S  
Sbjct: 121 AQRWQKKHAQWQKIIIAACEQCGRNVIPTLHMPTEFQAWVNQSTPALRLTLHPRAEKSFR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                H       V +LIGPEGG+  +E            + LGPR+LR++TAA+ A++ 
Sbjct: 181 -----HTAVGSDGVRLLIGPEGGFSDQELYQ-TEQGGFHTVQLGPRVLRTETAAITAISA 234

Query: 237 VQAICGD 243
           +QAI GD
Sbjct: 235 LQAIYGD 241


>gi|229593101|ref|YP_002875220.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas fluorescens
           SBW25]
 gi|229364967|emb|CAY53089.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 239

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 113/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F D PL +    +    Q HY++ VLRM EGD + LF+G   E+L  +  VGK 
Sbjct: 1   MRLSRFFTDTPLSLGDH-ELPEAQAHYISRVLRMGEGDAVQLFDGSGQEFLGSLLEVGKK 59

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E  +        +       +  R+D+ IQK+ E+G+ AI P+ +   +    
Sbjct: 60  RVTVQLTESVAGQAESPLHIHLGQGLSRGERMDWAIQKATELGVNAITPIFSDRCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   T+P I+PP  L   LK  + + ++V          
Sbjct: 120 DERADKRLLHWRQVAISACEQCGRSTVPLIHPPLLLADWLKQTEADLKLVLHPVAEPMV- 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                 + A   ++A LIGPEGG    E +      +     LGPR+LR++TA V A+A+
Sbjct: 179 ------SHAKPSSLAFLIGPEGGLTDAEVQAAQGAGY-HAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|71737741|ref|YP_272747.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558294|gb|AAZ37505.1| uncharacterized conserved protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 239

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 114/248 (45%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTEAPLSLGEH-ELPEAQTHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVSEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +      F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQDAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|118444754|ref|YP_878563.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium novyi NT]
 gi|118135210|gb|ABK62254.1| conserved hypothetical protein TIGR00046 [Clostridium novyi NT]
          Length = 251

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 108/247 (43%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + FV     +       G+   ++  VLR+KEGD + + +    E+L  I Y+ KS  
Sbjct: 1   MHKFFVSENNILSDIAVIEGEDVKHIYKVLRLKEGDKVNINDCNGKEFLGTIDYIDKSKV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-------T 117
               +E    +     +V       K +++D ++QK  E+G+  I PV+T          
Sbjct: 61  EVKLLEELEINNEPPIEVYLYQGLPKASKMDLIVQKCTELGIREITPVVTGRVASSINDI 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +     +DR       A +Q     +P +     ++ L +       IV   E   +   
Sbjct: 121 KRESKKLDRWNRIAFEACKQNKRTLIPKVNDIMNMDELKEQLKEMDLIVVPYENAENYGI 180

Query: 178 LEKLHAIA-HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            + +  +   +  V I+IGPEGG+  EE E L ++     ++LGPRILR++TA    +AL
Sbjct: 181 KQMIKNVTGEVKKVGIIIGPEGGFEQEEIEELKNME-AQIVTLGPRILRTETAGFTCLAL 239

Query: 237 VQAICGD 243
           +    GD
Sbjct: 240 LMYELGD 246


>gi|330886230|gb|EGH20131.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 239

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/248 (27%), Positives = 115/248 (46%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F + PL +    +    Q HY++ VLRM EGD + LF+G   E+   +  VGK 
Sbjct: 1   MRLSRFFTEAPLSLGEH-ELPEAQAHYISRVLRMTEGDALQLFDGSGQEFRGTLLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +   +S   +       +  R+D+ IQK+ E+G+G I P+++   +    
Sbjct: 60  RVHVQLTESFAGQVESGLRIHLGQGLSRGERMDWAIQKATELGVGEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    +P I+ P  L   +K+ + + ++V          
Sbjct: 120 DERAEKRQAHWQQIAISACEQCGRSVVPVIHAPMPLAEWIKHTEADLKLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A LIGPEGG +  E +   +  F     LGPR+LR++TA   A+++
Sbjct: 176 ---PLTSHDKPASLAFLIGPEGGLNDAEVDQAQAAGF-HAARLGPRVLRTETAPAVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|149191952|ref|ZP_01870183.1| hypothetical protein VSAK1_07844 [Vibrio shilonii AK1]
 gi|148834219|gb|EDL51225.1| hypothetical protein VSAK1_07844 [Vibrio shilonii AK1]
          Length = 243

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 117/247 (47%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRMKEG  +LLF+G   E+ + I+ +GK 
Sbjct: 1   MRIPRIYHPEPIHALGTLALSEDAAGHVGRVLRMKEGQEVLLFDGSGHEFPATITQIGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +  S + +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVDVDIQEKVSTSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P  +LE          ++        S N
Sbjct: 121 AKRFEKKLQQWQKIAISACEQCGRNTIPEIRPIMSLEQWCAEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  ++E E      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTKVRLLIGPEGGLSAQEIEMTEQYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|261418481|ref|YP_003252163.1| 16S ribosomal RNA methyltransferase RsmE [Geobacillus sp. Y412MC61]
 gi|319767558|ref|YP_004133059.1| hypothetical protein GYMC52_2535 [Geobacillus sp. Y412MC52]
 gi|261374938|gb|ACX77681.1| protein of unknown function DUF558 [Geobacillus sp. Y412MC61]
 gi|317112424|gb|ADU94916.1| protein of unknown function DUF558 [Geobacillus sp. Y412MC52]
          Length = 258

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 91/247 (36%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV            SGD  H++A V+RMK GD I+         + +I  +     
Sbjct: 1   MQRYFVSGQAQQGGIVAISGDDAHHIARVMRMKPGDGIICVFPDGRTAVCEIEQIANEHV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                Q + +  +  V+   +        + +                 A R V+    +
Sbjct: 61  QARIVQWKEERSELPVRIYIAQGLPKGEKWELVIQKGTELGAAGFLPFEAARSVVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE----TCGS 174
                ++R +     AAEQ +   +P +  P +   LL         +FA E        
Sbjct: 121 KAEKKVERWKKIAKEAAEQAERTVVPDVRAPLSFVELLSFGQTVDVRLFAYEKEARNARH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  +     +  + GPEGG+  EE E L    F +P SLGPRILR++TA +  +
Sbjct: 181 AALPALLSRLRPGGALLAVFGPEGGFSPEEAEQLRQHGF-SPCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           +      
Sbjct: 240 SAASYEW 246


>gi|261250170|ref|ZP_05942746.1| ribosomal RNA small subunit methyltransferase E [Vibrio orientalis
           CIP 102891]
 gi|260939286|gb|EEX95272.1| ribosomal RNA small subunit methyltransferase E [Vibrio orientalis
           CIP 102891]
          Length = 258

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 115/250 (46%), Gaps = 14/250 (5%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +    + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ ++I+ V
Sbjct: 13  RNTMRIPRIYHPEAINQLGSLMLSDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAEIASV 72

Query: 62  GKSIRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT-- 117
            K       ++   RS     D+       + +++++ IQKSVE+G+  I P+I+     
Sbjct: 73  SKKNVEVSIIQRVERSSESPLDLHLGQVVSRGDKMEFTIQKSVELGVNTITPLISERCGV 132

Query: 118 ----QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG 173
               +     + + +   ISA EQC   T+P I P   LE          ++        
Sbjct: 133 KLDQKRFEKKLAQWQKIAISACEQCGRNTVPEIRPIMQLEEWCGEEYDGLKLNLHPRAKY 192

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           S N+L        +  V +LIGPEGG  +EE     +  F   L LGPR+LR++TAA+ A
Sbjct: 193 SINTL-----PTPVEKVRLLIGPEGGLSAEEIGMTENYKFEETL-LGPRVLRTETAALTA 246

Query: 234 MALVQAICGD 243
           +  +Q   GD
Sbjct: 247 ITALQVRFGD 256


>gi|119470540|ref|ZP_01613243.1| hypothetical protein ATW7_12016 [Alteromonadales bacterium TW-7]
 gi|119446241|gb|EAW27518.1| hypothetical protein ATW7_12016 [Alteromonadales bacterium TW-7]
          Length = 244

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             +  ++    + + T      D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K 
Sbjct: 1   MRVPHIYQASSITLNTPVSLDDDAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVSKK 60

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               +  Q      +S   +       + +++D+ IQKSVE+G+  I P+ ++       
Sbjct: 61  NVVVMPQQFNPHDVESPLKIHLGQCVSRGDKMDFTIQKSVELGITEITPIFSQRCGVKLI 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+AAEQ     +P ++PP  ++  L+   +  ++        S  
Sbjct: 121 GDRLDKKHQQWQKIAIAAAEQSGRNYVPVVHPPIDIKQWLEQSTNAIKLTLHPRAEHSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           ++           V  L+GPEGG+  EE        FV  + LGPR+LR++TAA+  ++ 
Sbjct: 181 TITV-----PEDGVRFLVGPEGGFTDEEMAQTKQQEFV-DIRLGPRVLRTETAALTVLSA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLQFGD 241


>gi|304403938|ref|ZP_07385600.1| protein of unknown function DUF558 [Paenibacillus curdlanolyticus
           YK9]
 gi|304346916|gb|EFM12748.1| protein of unknown function DUF558 [Paenibacillus curdlanolyticus
           YK9]
          Length = 254

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/251 (23%), Positives = 105/251 (41%), Gaps = 15/251 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV      +T     GD  H+ + V+RM+ GD+ ++ +G   E ++K + +     
Sbjct: 1   MQRYFVPTSQFDETTVTLLGDDAHHASRVMRMRSGDSFIVSDGAGREAIAKATSIAADRI 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               VE  +  +     +    S  K ++++ +IQK  E+G  A  P  +      +   
Sbjct: 61  EADIVEKLAGDREPAWQITIAQSLPKGDKMELIIQKGTEIGAYAFVPFESERMIVQYDAK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R       AAEQ     +P I  P + + L+ +      ++F  E  G   S 
Sbjct: 121 KEAKRLERWEKIAKEAAEQAHRSRIPAIAKPASWKQLVGSIGEYDLVLFCYEEEGRSGSG 180

Query: 179 EKLH------AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
             L       A      V +++GPEGG+   E         V  + LG RILR++TA + 
Sbjct: 181 SGLRDAVRPIADRSNARVLVVVGPEGGFTESEAADASGAGAV-VVGLGKRILRTETAGLV 239

Query: 233 AMALVQAICGD 243
           A+  +    G+
Sbjct: 240 ALTALLYESGE 250


>gi|319898419|ref|YP_004158512.1| hypothetical protein BARCL_0241 [Bartonella clarridgeiae 73]
 gi|319402383|emb|CBI75922.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 240

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 110/229 (48%), Positives = 142/229 (62%), Gaps = 2/229 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+++  LKRLFV   L +  +    G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+++
Sbjct: 1   MRVNYKLKRLFVRQLLALNKEIVIEGQQASYLMHVLRMKEGAKILLFNGQDGEWLAKLTF 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K     ++  Q R QTK SD+ Y F+P+K  RLDYMIQK+VEMG   + P+IT YTQ 
Sbjct: 61  IKKKFVVVRLINQERLQTKSSDLFYCFAPLKYMRLDYMIQKAVEMGASVLHPIITHYTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I AAEQC IL+LP   P   L+  L+NWD    + F DE   S N++ 
Sbjct: 121 TRINMARIEANIIEAAEQCGILSLPKCAPAVPLKTFLENWDETHALFFCDELSESYNTIP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
                     + +LIGPEGG+  EE+  L   PFV  +SLGPRILR+DT
Sbjct: 181 LFKKH-RTTPLGVLIGPEGGFSEEERVFLKKYPFVFSVSLGPRILRADT 228


>gi|325127441|gb|EGC50371.1| hypothetical protein TIGR00046 [Neisseria meningitidis N1568]
          Length = 241

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 106/246 (43%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAARLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +          + 
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIM----SINRAR 175

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +          +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 176 KLADIRQPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|262273734|ref|ZP_06051547.1| ribosomal RNA small subunit methyltransferase E [Grimontia hollisae
           CIP 101886]
 gi|262222149|gb|EEY73461.1| ribosomal RNA small subunit methyltransferase E [Grimontia hollisae
           CIP 101886]
          Length = 243

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F   PL    +   S D  +++  VLRM+ G  +LLF+G   E+ + I+  GK 
Sbjct: 1   MRIPRIFHPEPLPDTGRVALSDDAANHVGRVLRMQAGQEVLLFDGSGAEFPAVIAESGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVTVDVAERVERSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNVITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+A EQC    +P + P  +L+  ++      ++        S N
Sbjct: 121 ADRFDKKWQQWQKIAIAACEQCGRNIVPEVRPVMSLDAWMQEPFDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  + +LIGPEGG  SEE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVSRLRLLIGPEGGLSSEEIARTRKFGFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|94501841|ref|ZP_01308353.1| hypothetical protein RED65_14462 [Oceanobacter sp. RED65]
 gi|94426062|gb|EAT11058.1| hypothetical protein RED65_14462 [Oceanobacter sp. RED65]
          Length = 241

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/249 (23%), Positives = 107/249 (42%), Gaps = 17/249 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL             H++  VLRM+ G  + +FNG    +          
Sbjct: 1   MRIPRIYTPQPLGEHNLIDLDDASAHHVGKVLRMEAGRQLKVFNGSGHRYFDATIVHADR 60

Query: 65  IRFKV---EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT- 120
            + +V   E  + S      +       K +++++ IQK+VE+G+  I P+ + +     
Sbjct: 61  KKVQVRLGESHASSTESPLSIHLGQVMSKGDKMEFTIQKAVELGVTDITPLWSEHCDVKL 120

Query: 121 -----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
                     +     ISA EQ     +P ++P   +E  L N + + + +         
Sbjct: 121 NQERLEKKHKQWLGIIISACEQSGRDVIPHLHPTIKIEDWLANMETDVKWLLDPGAE--- 177

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
                L +     +VAI +GPEGG+   E +      F + L +GPR+LR++TAA+ A+ 
Sbjct: 178 ----PLQSKVAPKSVAIAVGPEGGFSEGEVKLAQQQGFQSQL-IGPRVLRTETAALTAIT 232

Query: 236 LVQAICGDW 244
           ++Q+  GD+
Sbjct: 233 ILQSRWGDF 241


>gi|90415442|ref|ZP_01223376.1| hypothetical protein GB2207_09001 [marine gamma proteobacterium
           HTCC2207]
 gi|90332765|gb|EAS47935.1| hypothetical protein GB2207_09001 [marine gamma proteobacterium
           HTCC2207]
          Length = 245

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 114/247 (46%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F D PL        SG    +L+  LRM  G  I LFNG  GE+ + ++   KS
Sbjct: 1   MRIPRIFTDQPLSSGANLALSGSAARHLSSALRMSAGQEITLFNGLGGEFSATLTRATKS 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                   ++   +    ++    +  +  R+D+++QK+ E+G+  I P+ +  T+    
Sbjct: 61  QVDVSIGDFRDIDRESPLNLHLAIAVSRGERMDWIVQKATELGVSEITPLFSERTEVKLN 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +  +ISA EQC    +P I P  TL+  L     N +     +      
Sbjct: 121 GERLEKKLRHWQQVSISACEQCQRNLVPSINPALTLDQWLSQDTGNAEQ---LKLVLHHR 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S + L       +  +L+GPEGG    E        F   L+LGPR++R++TA +AA+++
Sbjct: 178 SDKSLAQHQPPKSACLLVGPEGGLSDNEISRAMDNGFA-ALTLGPRVMRTETAPLAAISI 236

Query: 237 VQAICGD 243
           +Q++ GD
Sbjct: 237 MQSVWGD 243


>gi|149375982|ref|ZP_01893748.1| hypothetical protein MDG893_03350 [Marinobacter algicola DG893]
 gi|149359619|gb|EDM48077.1| hypothetical protein MDG893_03350 [Marinobacter algicola DG893]
          Length = 244

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 118/247 (47%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ D PL          +   ++  VLRM+ G  +LLFNG   ++ + I+  GK 
Sbjct: 1   MRIPRIYTDSPLSEGATAGLDDNAAQHVGRVLRMQPGQELLLFNGDGNDYPATITEAGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                     +   +S ++ +      K +R+DY +QK+VEMG+  I P+ T        
Sbjct: 61  HVSVEVGTPSANATESHLEIVLGQTLSKGDRMDYAVQKAVEMGVTRIVPLTTERCDVKLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   ++  ISAAEQC    +P I P  TL    +N       +          
Sbjct: 121 GDREDKRLRHWQSVAISAAEQCGRARVPEIVPVMTLSEWFENSGDCDLRLVL-----HHR 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           + + L+ +A    VA++IGPEGG   +E     +  F+ P++LGPR+LR++TA VAAMAL
Sbjct: 176 TEQSLNTLAKPTRVALMIGPEGGLSPDEITAAANAGFL-PVALGPRVLRTETAPVAAMAL 234

Query: 237 VQAICGD 243
            Q + GD
Sbjct: 235 CQWLWGD 241


>gi|168215653|ref|ZP_02641278.1| RNA methyltransferase, RsmE family [Clostridium perfringens NCTC
           8239]
 gi|182382065|gb|EDT79544.1| RNA methyltransferase, RsmE family [Clostridium perfringens NCTC
           8239]
          Length = 250

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 111/246 (45%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHVKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPQVLEPMDFKEVLEKIDELDLMVIPYENATGYGIRAM 180

Query: 181 LHAIAHIPNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +++I +  ++    I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIENKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIVTLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|95928478|ref|ZP_01311225.1| protein of unknown function DUF558 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135268|gb|EAT16920.1| protein of unknown function DUF558 [Desulfuromonas acetoxidans DSM
           684]
          Length = 261

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 115/247 (46%), Gaps = 11/247 (4%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
            S ++R F        +      D  H+++ VLR++  D I+L +G+ G    +I  +  
Sbjct: 7   RSLMRRFFTPQITFTHSSADLPRDVAHHISTVLRLRTDDRIVLCDGRGGCAECRIDEISP 66

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH- 121
           K  R         Q     V  I     +++LD ++QK+ E+G+  +RPV  +  Q    
Sbjct: 67  KRCRVTRLRHWLEQETALPVTLIQGLPHSDKLDLILQKTTELGVQQVRPVRCQRCQYPIA 126

Query: 122 -----YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  ++R +     AA Q +   LP +    + E  L++ D + ++V  ++    + 
Sbjct: 127 PAKAARKLERWQKIVTEAARQSERSWLPEVAALCSFEEALQHCDADVKLVLWEQA---DQ 183

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+++        VA+++GPEGG   EE        FV  + LGPRILR++TA +A MA+
Sbjct: 184 PLQRVLPEISPDRVAVVVGPEGGLAQEEVALAVEHGFV-AVGLGPRILRTETAGMALMAI 242

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 243 LQYQYGD 249


>gi|15677755|ref|NP_274919.1| hypothetical protein NMB1925 [Neisseria meningitidis MC58]
 gi|7227182|gb|AAF42254.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|254670885|emb|CBA07409.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|316985547|gb|EFV64494.1| RNA methyltransferase family protein [Neisseria meningitidis
           H44/76]
 gi|325133384|gb|EGC56048.1| hypothetical protein TIGR00046 [Neisseria meningitidis M13399]
 gi|325139579|gb|EGC62119.1| hypothetical protein TIGR00046 [Neisseria meningitidis CU385]
 gi|325143638|gb|EGC65957.1| hypothetical protein TIGR00046 [Neisseria meningitidis M01-240013]
 gi|325200977|gb|ADY96432.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           H44/76]
 gi|325206833|gb|ADZ02286.1| conserved hypothetical protein TIGR00046 [Neisseria meningitidis
           M04-240196]
          Length = 241

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 108/246 (43%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAARLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +        +   
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIMSINRARKLGD 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  + A    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 180 IRQPSGA----IVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|293376255|ref|ZP_06622498.1| RNA methyltransferase, RsmE family [Turicibacter sanguinis PC909]
 gi|325845140|ref|ZP_08168449.1| RNA methyltransferase, RsmE family [Turicibacter sp. HGF1]
 gi|292645147|gb|EFF63214.1| RNA methyltransferase, RsmE family [Turicibacter sanguinis PC909]
 gi|325488805|gb|EGC91205.1| RNA methyltransferase, RsmE family [Turicibacter sp. HGF1]
          Length = 248

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 103/247 (41%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+        Q + + +  H++A V+RM+ G+ I++ N     +   I+ V     
Sbjct: 1   MQRYFLKNHQFQAKQVRITDEDAHHIARVMRMEVGERIIVCNEDKECYYLTITAVTPDEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E          +V       K ++ +++IQK+ E G     PV           +
Sbjct: 61  TGEIGEAIESDTELPIEVTIAQGLPKGDKFEWVIQKATECGATNFMPVSMERCVVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R       AAEQ     +P ++   T +  L+   H    +FA E    +  L
Sbjct: 121 KEVKKVERWNKIAKEAAEQSHRQVVPKVHSVHTFKAFLEQSKHYDVCLFAYEETAKQGEL 180

Query: 179 EKLHA----IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            +L      I     + +L+GPEGG   +E + L    F  P +LGPRILR++TA + A+
Sbjct: 181 AQLKQTLENIKPGATLLLLVGPEGGVGEKEVDLLIQHGF-KPCALGPRILRTETAPIYAL 239

Query: 235 ALVQAIC 241
           + +    
Sbjct: 240 SAISFAL 246


>gi|309379533|emb|CBX21899.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 241

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 113/247 (45%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGITAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|330812331|ref|YP_004356793.1| RNA methyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380439|gb|AEA71789.1| putative RNA methyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 239

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 110/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +    +    + HY+  VLRM EGD + +F+G   E+   ++ VGK 
Sbjct: 1   MRLSRFFIDAPLSLGDH-ELPEAKAHYIGRVLRMAEGDAVQVFDGSGQEFRGTLAEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+ +   +    
Sbjct: 60  RVRVQLDEQFAGQPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPIFSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   ++P I+PP  L   LK  +   ++V          
Sbjct: 120 DERADKRLLHWRQVAISACEQCGRSSVPVIHPPLLLADWLKQTEAELRLVLHPVAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +      +A LIGPEGG    E E   +  +     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLVSHDKPSTLAFLIGPEGGLSDAEVEQAKTAGY-HAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|161869288|ref|YP_001598455.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria meningitidis
           053442]
 gi|161594841|gb|ABX72501.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 241

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 107/246 (43%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAARLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S     R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGERMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +        +   
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIMSINRARKLGD 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  + A    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 180 IRQPSGA----IVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|325135519|gb|EGC58137.1| hypothetical protein TIGR00046 [Neisseria meningitidis M0579]
          Length = 241

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 109/246 (44%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LFNGK         +    ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFNGKGKAHAARLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +  ++       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  GAEILHEETADAESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +        +   
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIMSINRARKLGD 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  + A    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 180 IRQPSGA----IVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|319408122|emb|CBI81775.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 104/226 (46%), Positives = 143/226 (63%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+++   +RLF+  PL +  + +  G Q  YL HVLRMKEG  ILLFNG+DGEWL+KI+ 
Sbjct: 1   MRVNYKFQRLFIQQPLSLNREIEIEGAQVSYLVHVLRMKEGAQILLFNGQDGEWLAKITA 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K     ++ +Q+R QT  SD+ Y F+P+K  RLDYM+QK VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKFVVVQLIHQTRPQTTCSDLIYCFAPLKHARLDYMVQKVVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +  NM R++   I AAEQC IL+LP   P  +L+ LL +WD    + F DE+   +N L 
Sbjct: 121 SRINMARIKANIIEAAEQCGILSLPECLPAVSLKTLLAHWDKTHSLFFCDESHEIQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L        + +LIGPEGG+  EE+  L    FV  +SLGPRILR
Sbjct: 181 LLKKHG-TVPLGVLIGPEGGFSEEEQVLLRKHSFVISISLGPRILR 225


>gi|327482639|gb|AEA85949.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas stutzeri DSM
           4166]
          Length = 238

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 109/248 (43%), Gaps = 18/248 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +           HY+  VLR+  G  + LF+G   E+  ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGQHA-LPEASAHYIGRVLRLSAGSAVQLFDGSGAEYRGELLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 ++  +   +S   +       +  R+D+ IQK+ E+G+  I P+I+   +    
Sbjct: 60  SVSVELHERLAGMPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPLISERCEVRLN 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC    LP I+              +   V AD       
Sbjct: 120 DERADKRLAHWRQIAISACEQCGRSVLPIIHA--------PVTLRDWLDVEADLKLVLHP 171

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             E L + A   ++A LIGPEGG    E E      F+ P  LGPR+LR++TA V A+++
Sbjct: 172 VAEPLASHAKPQSLAFLIGPEGGLSDNEVELASGQGFL-PARLGPRVLRTETAPVVALSV 230

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 231 AQQLWGDF 238


>gi|160931277|ref|ZP_02078678.1| hypothetical protein CLOLEP_00114 [Clostridium leptum DSM 753]
 gi|156869755|gb|EDO63127.1| hypothetical protein CLOLEP_00114 [Clostridium leptum DSM 753]
          Length = 242

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 102/245 (41%), Gaps = 14/245 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV+       Q   +G    ++   LRMK GD + L + +  ++   +  +     
Sbjct: 1   MPRFFVES--VSGGQVILTGPDAAHMCRSLRMKPGDTVTLCDTQGFDYQCVVQRLSPEEA 58

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               ++           V       K  ++D+++QK+VE+G+  I PV      +     
Sbjct: 59  ALTIIDKHQCENEPSLSVILYQGLPKGEKMDWIVQKAVELGVSQIVPVRMERCVSRPDGK 118

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 DR +   + AA+QC    LP + PP      L         +F  E  G   S 
Sbjct: 119 ASQKKTDRWQKIAVEAAKQCGRGILPQVCPPADFHQALIQAAQAEVFLFCYEGGGESVSR 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V++LIGPEGG+   E E       V P++LG RILR++TA +AA++++ 
Sbjct: 179 LITQKTK---TVSVLIGPEGGFSLPEAEAARKAGGV-PVTLGKRILRTETAPLAALSVIM 234

Query: 239 AICGD 243
              G+
Sbjct: 235 YASGN 239


>gi|254437857|ref|ZP_05051351.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 307]
 gi|198253303|gb|EDY77617.1| conserved hypothetical protein TIGR00046 [Octadecabacter
           antarcticus 307]
          Length = 234

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 132/236 (55%), Gaps = 6/236 (2%)

Query: 11  FVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK-V 69
           +VD PL  + +   S +Q HYL  V+R+  G ++ LFNG+DGEW + ++   K       
Sbjct: 2   YVDHPLGPQERVALSREQAHYLFGVMRLDVGADVSLFNGRDGEWRALVAAASKKSGVLDC 61

Query: 70  EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN-THYNMDRVR 128
             Q++      D+  +F+PIK +R  ++++K+ E+G   I P+ T YTQ+      DR++
Sbjct: 62  VVQTKPLQMPPDLWLVFAPIKKDRTSFIVEKAAELGAARIVPLQTEYTQSANRVRQDRLQ 121

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
            + + AAEQC    +P +        +L  W+   +I+F DE    +  +   +A     
Sbjct: 122 AHALEAAEQCGGTYVPEVAELQKFAKMLDTWNPTRRILFCDEAMVDKPLILPTNAGPW-- 179

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             AILIGPEGG+  +E++ L+S+     +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 180 --AILIGPEGGFSDKERDRLNSMLCAHAISLGPRILRADTAAVAAMTLWQQAMGDW 233


>gi|121635582|ref|YP_975827.1| hypothetical protein NMC1899 [Neisseria meningitidis FAM18]
 gi|120867288|emb|CAM11059.1| hypothetical protein NMC1899 [Neisseria meningitidis FAM18]
          Length = 241

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK--ISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK     ++       ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAARLSFLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|170728459|ref|YP_001762485.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella woodyi ATCC
           51908]
 gi|169813806|gb|ACA88390.1| protein of unknown function DUF558 [Shewanella woodyi ATCC 51908]
          Length = 243

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 105/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  Q +   +   ++  VLRM  G+ I LFNG   E+LS+I    K 
Sbjct: 1   MRIPRIYQASPLQIGNQVELDDEPASHIGRVLRMNAGEQISLFNGDGHEYLSEIISASKK 60

Query: 65  IR-FKVEYQS-RSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               KV   +         +       + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NVSVKVLSSTLNESESPLHLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I A EQ     +P I P  T+E          ++           
Sbjct: 121 GERLEKKIQQWQKIVIGACEQSGRSQVPEIRPAMTIEAWSAEQTDATKLNLHPRAAHGIG 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L         P V +LIGPEGG    E        F T + LGPR+LR++TAA+ A++ 
Sbjct: 181 GLSLTS-----PKVRLLIGPEGGLSEAEIMMTEQYQF-TDVLLGPRVLRTETAALTAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|302389476|ref|YP_003825297.1| protein of unknown function DUF558 [Thermosediminibacter oceani DSM
           16646]
 gi|302200104|gb|ADL07674.1| protein of unknown function DUF558 [Thermosediminibacter oceani DSM
           16646]
          Length = 256

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 117/247 (47%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGK---DGEWLSKISYVGK 63
           +   F+   +      + SG+  H++A VLRM +GD + L NG        + ++    +
Sbjct: 1   MPIFFIHGKMNPGEVVEISGEDAHHIARVLRMGKGDLLSLSNGLDALGTGQILELFPEDR 60

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
            I+ KV  +++ + ++  +    S  K  + D ++QK+ E+G+    PVIT  T      
Sbjct: 61  KIKVKVIEKNKFEPRRPRITLFQSVPKGQKFDLILQKNTELGVSEFVPVITERTVVEIEG 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           ++     +R R  T  AA+QC    LP +  P + +  L+   +   ++   E       
Sbjct: 121 ESKSKKAERWRKITKEAAKQCRRPDLPVVREPVSFDGCLELLKNYRIVLVPWEGEREVFL 180

Query: 178 LEKLHA-IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
              L      +P++A+LIGPEGG+  +E E       VT +SLGPRILR++TA     A+
Sbjct: 181 KSILSNVPPDVPDIAVLIGPEGGFSVQEIERARKSGAVT-VSLGPRILRTETAGFVVTAV 239

Query: 237 VQAICGD 243
           +    GD
Sbjct: 240 LMYELGD 246


>gi|120555960|ref|YP_960311.1| 16S ribosomal RNA methyltransferase RsmE [Marinobacter aquaeolei
           VT8]
 gi|120325809|gb|ABM20124.1| 16S rRNA m(3)U-1498 methyltransferase [Marinobacter aquaeolei VT8]
          Length = 244

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 124/247 (50%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F D PL +  Q +   +  +++  VLRM+ G  +LLFNG   ++ + I+  GK 
Sbjct: 1   MRIPRIFTDSPLAVGGQCQLDDNAANHVGRVLRMQAGQALLLFNGDGQDYHATITEAGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  ++     +S ++ + +    K +R+DY +QK+VEMG+  I P+ T        
Sbjct: 61  HVQVAVTEAAENETESSLRVVLAQTLSKGDRMDYAVQKAVEMGVSEIVPLTTERCDVKLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   ISAAEQC    +P I P  T++  L++       +          
Sbjct: 121 GDREDKRLRHWQQVAISAAEQCGRARVPEIQPVMTVQQWLEHARACDLRLVL-----HHR 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +   L+ +    ++A++IGPEGG  +EE        F+ P++LGPR+LR++TA VAA+AL
Sbjct: 176 TERSLNTLEKPSSIALMIGPEGGLTAEEIALAEDNGFL-PVALGPRVLRTETAPVAAIAL 234

Query: 237 VQAICGD 243
            Q + GD
Sbjct: 235 CQWLWGD 241


>gi|170751754|ref|YP_001758014.1| hypothetical protein Mrad2831_5384 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658276|gb|ACB27331.1| protein of unknown function DUF558 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 250

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 102/240 (42%), Positives = 139/240 (57%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RL V   L           Q +YL +VLR    D +L+FNG+ GEW + +   G+    
Sbjct: 9   PRLHVAADLAAGVILPLDRAQANYLLNVLRRGPDDPVLVFNGRHGEWRAHLVQTGRKGAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V  Q+R QT+++D+ Y+F+P+K+ RLDY+ QK+VEMG G IRPVITR+TQ    N+DR
Sbjct: 69  LHVAAQTRPQTERADLHYLFAPLKSARLDYLAQKAVEMGAGTIRPVITRFTQGDRVNIDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   + AAEQC IL +P    P  L   L        +VF DE     + +  L A   
Sbjct: 129 LRANAVEAAEQCGILAIPECPEPERLPAALAGLAPGRLLVFCDEDAPVRDPVAALRAAGD 188

Query: 187 I---PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
               P +A+L+GPEGG+  EE+  + + P    LSLGPRILR+DTAAVA + LVQA+ GD
Sbjct: 189 PLAPPPLAVLVGPEGGFSEEERALILARPNTVALSLGPRILRADTAAVAVLTLVQAVLGD 248


>gi|332535117|ref|ZP_08410927.1| ribosomal RNA small subunit methyltransferase E [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035435|gb|EGI71933.1| ribosomal RNA small subunit methyltransferase E [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             +  ++    + + T      D   ++  VLRMK G+++ +FNG+ GE+LS+I  V K 
Sbjct: 1   MRVPHIYQTSSIALNTPVTLDDDAAGHIGRVLRMKVGEHVSIFNGEGGEYLSEIIEVTKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
                 +E           +       + +++D+ IQKSVE+G+  I P+ ++       
Sbjct: 61  TVVVMPLELNPHDVESPLKIHLGQCVSRGDKMDFTIQKSVELGITEITPIFSQRCGVKLM 120

Query: 123 ------NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+AAEQ     +P I+PP  L+  L       ++        S  
Sbjct: 121 GDRLEKKHQQWQKIAIAAAEQSGRNFVPIIHPPIDLKQWLAQQTDAIKLTLHPRAEHSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           ++           V  L+GPEGG+  +E      L FV  + LGPR+LR++TAA+  ++ 
Sbjct: 181 TITV-----PKDGVRFLVGPEGGFTDDEMALTKQLEFV-DIRLGPRVLRTETAALTVLSA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLQFGD 241


>gi|228879506|ref|YP_457473.2| 16S ribosomal RNA methyltransferase RsmE [Erythrobacter litoralis
           HTCC2594]
          Length = 276

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 83/262 (31%), Positives = 124/262 (47%), Gaps = 25/262 (9%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFV  P+   T     G+  HYL  V+R+  GD ++L +   GEW  K++ V K I  
Sbjct: 13  PRLFVPEPIAAGTAVTVDGNAAHYLGKVMRVSAGDAVILCDDATGEWACKVTDVEKRIVT 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +   + R + +  D     + +K +R D +++K+ E+G+ AIRPV+TR       N +R
Sbjct: 73  LEPVEKLREREQVPDFWLCPALLKKDRFDLVLEKATELGVRAIRPVVTRRCVADKLNAER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE---------------- 170
            R     AAEQC    LP +  P  L+ LL++W  +  + FADE                
Sbjct: 133 ARAIVTEAAEQCARTALPELAEPVKLDSLLRDWPEDRALFFADELGGAPAGEAFVTYSES 192

Query: 171 --------TCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPR 222
                           +           A+LIGPEGG+   E++ + + P    ++LGPR
Sbjct: 193 LRRQGPQAGKDPHLDDQAARGPRLRGGAALLIGPEGGFDDAERKAIRAHPQARAITLGPR 252

Query: 223 ILRSDTAAVAAMALVQAICGDW 244
           ILR +TAA+AA AL     GDW
Sbjct: 253 ILRGETAAIAATALWMGTVGDW 274


>gi|261393256|emb|CAX50882.1| conserved hypothetical protein [Neisseria meningitidis 8013]
          Length = 241

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 113/247 (45%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFHLPENLSVGQTVALPENIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGITAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGF-QAVTLGKRILRTETAPLAALAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|229107039|ref|NP_699939.2| 16S ribosomal RNA methyltransferase RsmE [Brucella suis 1330]
          Length = 248

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 113/245 (46%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++R +V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S   
Sbjct: 1   MRANYRMQRPYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQP 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K +  +   Q+R Q K S++ Y F+P+K  +LDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  EGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGQLDYMMQKAVEMGAGVLQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L 
Sbjct: 121 PRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLS 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +   P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA
Sbjct: 181 ILTGLEPGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQA 239

Query: 240 ICGDW 244
           + GDW
Sbjct: 240 VLGDW 244


>gi|229324846|ref|YP_496229.2| hypothetical protein Saro_0950 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 249

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 4/239 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFV+ PL    +    G Q HYL  V+R+  GD ++L +   GEW+S+++ VGK    
Sbjct: 13  PRLFVEMPLDQGMRLPVDGQQAHYLGKVMRVSTGDAVMLCDDATGEWVSRVAEVGKRDLV 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            ++E ++R + +  D     + +K    D +++K+ E+G   + PV+TR       N +R
Sbjct: 73  LEIERRTRPREEVPDFWLCAALLKKPNFDLVLEKATELGAARVVPVVTRRCVADKLNPER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
            RT  + AAEQC    LP +     L+ LL++W     + FADE  G   +        H
Sbjct: 133 ARTIMVEAAEQCARTALPSLGETVKLDQLLRDWPEGRTLFFADENGGIPAAA---AFSLH 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDWY 245
               A+L+GPEGG+   E+  + + P    ++LGPRILR +TA++A M L   + GDW+
Sbjct: 190 CGPAALLVGPEGGFDETERSAIRAHPAAVGIALGPRILRGETASIAGMGLWMGLQGDWF 248


>gi|229577456|ref|YP_001126527.2| 16S ribosomal RNA methyltransferase RsmE [Geobacillus
           thermodenitrificans NG80-2]
          Length = 258

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 96/247 (38%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV            SGD  H+++ V+RMK GD I          + +I  +     
Sbjct: 1   MQRYFVSDRERQGENVVISGDDAHHISRVMRMKPGDAIACVFPDGRTAVCQIEQIANEQV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                Q + + ++  V+   +        + +                 A R V+    +
Sbjct: 61  CARIVQWKEEGRELPVRIYIAQGLPKGEKWELVIQKGTELGAAGFLPFVAARSVVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----GS 174
                ++R +     AAEQ +   LP +  P +L+ L+   +     +FA E        
Sbjct: 121 KAEKKVERWKKIAKEAAEQAERTLLPIVRAPLSLKELIAFGETVDSRLFAYEEEARGGRH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            +    L  +    ++  + GPEGG+  EE E L    F+ P SLGPRILR++TA +  +
Sbjct: 181 ASLPALLADLQPGSSLLAVFGPEGGFSREEAEQLKQSGFL-PCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           A      
Sbjct: 240 AAASYEW 246


>gi|126665848|ref|ZP_01736829.1| hypothetical protein MELB17_04747 [Marinobacter sp. ELB17]
 gi|126629782|gb|EBA00399.1| hypothetical protein MELB17_04747 [Marinobacter sp. ELB17]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 119/248 (47%), Gaps = 14/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ D PL      +   +   ++  VLRM+ G  + LFNG   ++ + I+   K 
Sbjct: 1   MRIPRIYTDTPLQAGADAQLDDNAAQHVGRVLRMQPGQALSLFNGDGQDYRALIASASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  Q  + + +S ++ +      K +R+DY +QK+ EMG+  I P+ T        
Sbjct: 61  NVTVQVEQPTANSSESALEIVLGQTLSKGDRMDYAVQKATEMGVTRIVPLSTERCDVRLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R+  ISAAEQC    +P I P   +   L+        +          
Sbjct: 121 GDREDKRLSHWRSVAISAAEQCGRARVPDILPVMNITEWLEYSQRCDVRLVL-----HHR 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           + + L ++A   +VA++IGPEGG  ++E        F+ P++LGPR+LR++TA VAAMAL
Sbjct: 176 TEQSLDSLAKPNSVALMIGPEGGLSADEIAQAEKSGFL-PIALGPRVLRTETAPVAAMAL 234

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 235 CQWLWGDF 242


>gi|313669146|ref|YP_004049430.1| hypothetical protein NLA_18700 [Neisseria lactamica ST-640]
 gi|313006608|emb|CBN88073.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 241

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 112/247 (45%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +  ++       ++  I S     R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEETADTESPLNITLIQSISSGERMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+  + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVSPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +
Sbjct: 175 CKLSDIRHPSGAIVFMVGPEGGWTEQEEQYAFDAGF-QAVTLGKRILRTETAPLAAIAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|260427823|ref|ZP_05781802.1| surface protein [Citreicella sp. SE45]
 gi|260422315|gb|EEX15566.1| surface protein [Citreicella sp. SE45]
          Length = 269

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLFVD PL        + +Q HYL  V+R+  G  ILLFNG+DGEWL +++  GK     
Sbjct: 35  RLFVDHPLGAGQPVPLTREQAHYLFSVMRLGAGAPILLFNGRDGEWLCEVTEAGKRGGEA 94

Query: 69  VEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           V   Q+R Q    D+  +F+PIK  R D++++K+VE+G+  + PV T++T +     DR+
Sbjct: 95  VCDTQTRPQQMPPDLWLLFAPIKKARTDFIVEKAVELGVRRLLPVQTQFTNSERIRQDRL 154

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           + + + AAEQC  L +P +     L+ LL +W     ++F DE      +     A A  
Sbjct: 155 QAHAVEAAEQCGALFVPEVAELARLDRLLADWPAGRALLFCDEAEAGSRAAALDAAPAPA 214

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               +LIGPEGG+   E+  L ++     ++LGPRILR+DTA V+A+ L Q  CGDW
Sbjct: 215 A---VLIGPEGGFADAERARLGAMDETRVIALGPRILRADTATVSAITLWQVACGDW 268


>gi|308390021|gb|ADO32341.1| hypothetical protein NMBB_2198 [Neisseria meningitidis alpha710]
 gi|325129462|gb|EGC52292.1| hypothetical protein TIGR00046 [Neisseria meningitidis OX99.30304]
          Length = 241

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 107/246 (43%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R  +   L +        +   +L +VLR++  +NI LF+GK         +    ++
Sbjct: 1   MPRFHLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAARLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S     R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGERMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +        +   
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLIMSINRARKLGD 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  + A    +  ++GPEGG+  +E++      F   ++LG RILR++TA +AA+A +Q
Sbjct: 180 IRQPSGA----IVFMVGPEGGWTEQEEQQAFDAGF-QAVTLGKRILRTETAPLAALAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|212217753|ref|YP_002304540.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii
           CbuK_Q154]
 gi|212012015|gb|ACJ19395.1| hypothetical cytosolic protein [Coxiella burnetii CbuK_Q154]
          Length = 270

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 110/242 (45%), Gaps = 10/242 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ + K  
Sbjct: 31  RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 90

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY--TQNTH 121
                    +   +S   ++      ++ ++DY IQK+VE+G+  I P+IT    T+   
Sbjct: 91  VEITIDSKEAGRTESSLFIELGQGIFRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 150

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
             +   +   IS  EQ     +P +    +L   L        +V       S    +  
Sbjct: 151 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLVCHPNAQNSLADFKTT 210

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
                   + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA  
Sbjct: 211 SQ-----RITLLIGPEGGLSDDEVQRATQSGF-QVLFLGPRILRTETATVTALSLIQAYF 264

Query: 242 GD 243
           GD
Sbjct: 265 GD 266


>gi|164685878|ref|ZP_01945479.2| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165918716|ref|ZP_02218802.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|164601398|gb|EAX33970.2| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165917544|gb|EDR36148.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 110/242 (45%), Gaps = 10/242 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ + K  
Sbjct: 5   RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 64

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY--TQNTH 121
                    +   +S   ++      ++ ++DY IQK+VE+G+  I P+IT    T+   
Sbjct: 65  VEITIDSKEAGRTESSLFIELGQGIFRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 124

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
             +   +   IS  EQ     +P +    +L   L        +V       S    +  
Sbjct: 125 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLVCHPNAQNSLADFKTT 184

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
                   + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA  
Sbjct: 185 SQ-----RITLLIGPEGGLSDDEVQRATQSGF-QVLFLGPRILRTETATVTALSLIQAYF 238

Query: 242 GD 243
           GD
Sbjct: 239 GD 240


>gi|110798700|ref|YP_696706.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium perfringens
           ATCC 13124]
 gi|110673347|gb|ABG82334.1| RNA methyltransferase, RsmE family [Clostridium perfringens ATCC
           13124]
          Length = 250

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 108/246 (43%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T    +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHATITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG---SENS 177
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPQVLEPMDFKEVLEKIDQLDLMVIPYENATGYGIRAM 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +  +     I NV I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIEDKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIVTLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|299134206|ref|ZP_07027399.1| protein of unknown function DUF558 [Afipia sp. 1NLS2]
 gi|298590953|gb|EFI51155.1| protein of unknown function DUF558 [Afipia sp. 1NLS2]
          Length = 255

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 94/229 (41%), Positives = 129/229 (56%), Gaps = 1/229 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+      RLFVD PL    +     +Q HYL +VLR+  GD+IL+FNG DGEW ++I  
Sbjct: 2   MQRDFKSPRLFVDAPLDAGGRVALEREQGHYLGNVLRLGTGDSILVFNGHDGEWRAQIEG 61

Query: 61  VGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
             +     +  Q+R Q    D+  +F+P+K  RLDYM+QK+VEMG   + P +T++TQ +
Sbjct: 62  RKRPEHLTLTEQTRPQETPCDLHLLFAPLKHARLDYMVQKAVEMGASLLAPTLTQFTQVS 121

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
             N +R+R   I AAEQC IL LP I  P  L   L   D    ++F DE     + L  
Sbjct: 122 RVNTERMRANAIEAAEQCGILNLPGINEPQPLARRLSERDGQRLLIFCDEAAPQCDPLAA 181

Query: 181 LHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           L   A     + +L+GPEGG+  EE+  L   P +  LSLGPRILR+DT
Sbjct: 182 LGMGAGKTKGLDVLVGPEGGFSEEERALLLRQPRLMRLSLGPRILRADT 230


>gi|110632733|ref|YP_672941.1| hypothetical protein Meso_0372 [Mesorhizobium sp. BNC1]
 gi|110283717|gb|ABG61776.1| protein of unknown function DUF558 [Chelativorans sp. BNC1]
          Length = 248

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 95/226 (42%), Positives = 142/226 (62%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RL++   L    + + + +Q HYL +VLRM+ G  +L+FNG+ GEWL+++  
Sbjct: 1   MRANYKMQRLYLPEDLSKGAEVETTREQAHYLGNVLRMRGGAELLVFNGRHGEWLAEVKE 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K      V   +R QT Q D+ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ 
Sbjct: 61  ISKKSALLAVRELTREQTPQPDILYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQI 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                DR++   I AAEQC IL++P +  P  L+ LL  W+   ++VF DE    +N   
Sbjct: 121 PKLGTDRLQANVIEAAEQCGILSIPLVREPVKLDVLLSRWEEGRRLVFCDEDAPGQNPFP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
           +L A+A    + +L+GPEGG+   E+ TL SL FV P+ LGPRILR
Sbjct: 181 RLSALA-GERLGLLVGPEGGFSDSERRTLRSLAFVVPIPLGPRILR 225


>gi|308048318|ref|YP_003911884.1| 16S rRNA m(3)U-1498 methyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307630508|gb|ADN74810.1| 16S rRNA m(3)U-1498 methyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 243

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL    Q     D  +++  VLRM+ G  ++LFNG   ++ + I   GK 
Sbjct: 1   MRVPRIYQPVPLAAGQQLALDDDGANHIGRVLRMQPGQAVMLFNGDGQQYPAIIDEAGKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +         +       +  ++++ IQKSVE+G  +I P+ +        
Sbjct: 61  NVLVTVQSVEQHHVESPLALHLGQVISRGEKMEFTIQKSVELGAASITPLWSERCGVKLA 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I+A EQC    +P + P   L+  +       ++        S N
Sbjct: 121 GDRLDKKVAQWQKIAIAACEQCGRNVVPEVRPVMRLDQWMAEPFEGLKLNLHPRAEYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  + +LIGPEGG  +EE        F T + LGPR+LR++TAA+ AM  
Sbjct: 181 TLPE-----PVQALRLLIGPEGGLSAEEIAAAREFDF-TDILLGPRVLRTETAALTAMTA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|146284257|ref|YP_001174410.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas stutzeri
           A1501]
 gi|145572462|gb|ABP81568.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 238

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 72/248 (29%), Positives = 109/248 (43%), Gaps = 18/248 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +           HY+  VLR+  G  + LF+G   E+  ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGQHA-LPEASAHYIGRVLRLSAGSAVQLFDGSGAEYRGELLEVGKK 59

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 Y+  +   +S   +       +  R+D+ IQK+ E+G+  I P+I+   +    
Sbjct: 60  SVSVELYERLAGMPESPLRIHLGQGLSRGERMDWAIQKATELGVSEITPLISERCEVRLN 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC    LP I+              +   V AD       
Sbjct: 120 DERADKRLAHWRQIAISACEQCGRSVLPIIHA--------PVTLRDWLDVEADLKLVLHP 171

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             E L + A   ++A LIGPEGG    E E      F+ P  LGPR+LR++TA V A+++
Sbjct: 172 VAEPLASHAKPQSLAFLIGPEGGLSDSEVELASGQGFL-PARLGPRVLRTETAPVVALSV 230

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 231 AQQLWGDF 238


>gi|153835274|ref|ZP_01987941.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156975827|ref|YP_001446734.1| hypothetical protein VIBHAR_03572 [Vibrio harveyi ATCC BAA-1116]
 gi|148868249|gb|EDL67389.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156527421|gb|ABU72507.1| hypothetical protein VIBHAR_03572 [Vibrio harveyi ATCC BAA-1116]
          Length = 243

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETIQQLGVIALSDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK 60

Query: 65  I-RFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               ++ E    S     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVMVEISERVESSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  S+E +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSDEIDMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|307824730|ref|ZP_07654953.1| protein of unknown function DUF558 [Methylobacter tundripaludum
           SV96]
 gi|307734088|gb|EFO04942.1| protein of unknown function DUF558 [Methylobacter tundripaludum
           SV96]
          Length = 253

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + RL+   PL      +   D  HY+  VLR+K+  +I+LFNG  GE+L  ++ V + 
Sbjct: 1   MRVSRLYTSAPLATGKLIELDDDNGHYVRTVLRLKKDAHIILFNGHGGEYLCTVAEVSRK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH- 121
                  ++  RS      +       + +R+D  +QK+VE+G+  I P++T        
Sbjct: 61  AVLIDVGQWSDRSVESPLQITLGLGISRGDRMDLTVQKAVELGVNHITPLLTERCVVQFK 120

Query: 122 -----YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +     AAEQ    +LP +                 ++        + +
Sbjct: 121 GEKKPQRLLHWQKIVQHAAEQSGRTSLPPLLEV-EQLQNWLGNQQGLKVFLDPYAETTLS 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+          V +L GPEGG+ ++E++   +  F+ P+ LG RILR++TA++AA+A 
Sbjct: 180 ELK-----PETMKVTLLTGPEGGFSNQERDAAKASGFI-PVRLGSRILRTETASLAALAA 233

Query: 237 VQAICGDW 244
           VQ + GD+
Sbjct: 234 VQMLWGDF 241


>gi|210623864|ref|ZP_03294099.1| hypothetical protein CLOHIR_02050 [Clostridium hiranonis DSM 13275]
 gi|210153290|gb|EEA84296.1| hypothetical protein CLOHIR_02050 [Clostridium hiranonis DSM 13275]
          Length = 256

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/253 (24%), Positives = 115/253 (45%), Gaps = 12/253 (4%)

Query: 1   MKIHSHLKRLFVDFPLC--IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI 58
           M     + R FVD       +      G+   ++  VLR +EG+ + + +G+D E++ +I
Sbjct: 1   MDWTWTMDRFFVDKNNINLEENTCIIEGEDVKHITKVLRYREGEKLEICDGEDNEYVGEI 60

Query: 59  SYVGKSIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY 116
             + K       ++ +   +  +  V+      K  +++Y++QK  E+G   I  V T+ 
Sbjct: 61  KSMSKEEVCLDIIDKRDIKRESKLRVRVYQGMPKGPKMEYILQKLTEVGTDEIILVDTKR 120

Query: 117 T------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE 170
           +      +     ++R       AA+Q     +P +    + +  L++   N   +   E
Sbjct: 121 SVAKVDGKKEDKKLERWERIIYEAAKQSKRGKIPTLKGVLSFKEALEDMKRNDYNICPYE 180

Query: 171 TCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
              +   ++++  +  I ++ I IGPEGG   EE + L        ++LGPRILR++TA+
Sbjct: 181 DERNIPLVKEIRGLD-IESIGIFIGPEGGIADEEIDALKENG-AKVVTLGPRILRTETAS 238

Query: 231 VAAMALVQAICGD 243
             A ALVQ   GD
Sbjct: 239 TVASALVQYELGD 251


>gi|215919303|ref|NP_820935.2| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii RSA
           493]
 gi|206584188|gb|AAO91449.2| hypothetical cytosolic protein [Coxiella burnetii RSA 493]
          Length = 260

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 110/242 (45%), Gaps = 10/242 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ + K  
Sbjct: 21  RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 80

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY--TQNTH 121
                    +   +S   ++      ++ ++DY IQK+VE+G+  I P+IT    T+   
Sbjct: 81  VEITIDSKEAGRTESSLFIELGQGISRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 140

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
             +   +   IS  EQ     +P +    +L   L        +V       S    +  
Sbjct: 141 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLVCHPNAQNSLADFKTT 200

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
                   + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA  
Sbjct: 201 SQ-----RITLLIGPEGGLSDDEVQRATQSGF-QVLFLGPRILRTETATVTALSLIQAYF 254

Query: 242 GD 243
           GD
Sbjct: 255 GD 256


>gi|161831038|ref|YP_001597773.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii RSA
           331]
 gi|212211957|ref|YP_002302893.1| 16S ribosomal RNA methyltransferase RsmE [Coxiella burnetii
           CbuG_Q212]
 gi|161762905|gb|ABX78547.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
 gi|212010367|gb|ACJ17748.1| hypothetical cytosolic protein [Coxiella burnetii CbuG_Q212]
          Length = 244

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 110/242 (45%), Gaps = 10/242 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            ++R++    L + +        YHYL +VLR++EG  I+LFNG    +  +I+ + K  
Sbjct: 5   RIQRIYYPDQLSVDSTVTLDSRNYHYLLNVLRLREGHKIILFNGDGNNYGGRITRIQKKQ 64

Query: 66  RFKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY--TQNTH 121
                    +   +S   ++      ++ ++DY IQK+VE+G+  I P+IT    T+   
Sbjct: 65  VEITIDSKEAGRTESSLFIELGQGISRSEKMDYAIQKAVELGVNRIVPLITERTSTKPKT 124

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
             +   +   IS  EQ     +P +    +L   L        +V       S    +  
Sbjct: 125 QKLAHWQGVLISGCEQSGRCCIPELMQAQSLSDWLSQKREGLSLVCHPNAQNSLADFKTT 184

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
                   + +LIGPEGG   +E +      F   L LGPRILR++TA V A++L+QA  
Sbjct: 185 SQ-----RITLLIGPEGGLSDDEVQRATQSGF-QVLFLGPRILRTETATVTALSLIQAYF 238

Query: 242 GD 243
           GD
Sbjct: 239 GD 240


>gi|71082844|ref|YP_265563.1| hypothetical protein SAR11_0136 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061957|gb|AAZ20960.1| conserved hypothetical protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 233

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 66/232 (28%), Positives = 111/232 (47%), Gaps = 5/232 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF    L +    K    Q HY+  V+R+K G+   LFN         ++     + F 
Sbjct: 5   RLFFKESLSLNLTAKLDKSQSHYVNKVMRIKVGEVFSLFNNSGEWEAKILTISKSIVEFN 64

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q R +    D+   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+ 
Sbjct: 65  ITKQLRQKENVKDLWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERLE 124

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQ + + +P I  P +L+  L +   +   +F D    ++       A     
Sbjct: 125 KVIIEAAEQSNRINVPLIEDPQSLKSFLNHEKMDL--IFTDLNSENKKLDFNKLAHNPTC 182

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
              ++IGPEG +  EE+  + +   V P+ +   ILRS+TA ++A+++V  +
Sbjct: 183 ---VIIGPEGDFSEEERGEILAFKGVQPIKINENILRSETAVISALSIVNYL 231


>gi|229259630|ref|NP_107316.2| 16S ribosomal RNA methyltransferase RsmE [Mesorhizobium loti
           MAFF303099]
          Length = 244

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 100/226 (44%), Positives = 140/226 (61%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   L    +  A   Q HYL HVLR+ EG  ILLFNG+DGEW + I+ 
Sbjct: 1   MRANYKMQRLFVPDDLGPDAEFDADQQQSHYLIHVLRLGEGAEILLFNGRDGEWSAAIAA 60

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K   R +V+   R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 61  KSKKAVRLRVQTLQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      E LL  WD   ++VF DE   + N L 
Sbjct: 121 AKPSIDRLRANVVEAAEQCGILAVPEVREAEKFERLLAGWDKERRLVFCDEDASTNNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L A+     +A+L+GPEGG+  +E++ L +LPFVT + LGPRILR
Sbjct: 181 ALRAVKE-KKLALLVGPEGGFSDDERKMLRALPFVTAIPLGPRILR 225


>gi|168204735|ref|ZP_02630740.1| RNA methyltransferase, RsmE family [Clostridium perfringens E str.
           JGS1987]
 gi|169343763|ref|ZP_02864762.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|169298323|gb|EDS80413.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|170663617|gb|EDT16300.1| RNA methyltransferase, RsmE family [Clostridium perfringens E str.
           JGS1987]
          Length = 250

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 109/246 (44%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG---SENS 177
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPQVLEPMDFKGVLEKIDQLDLMVIPYENATGYGIRAM 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +  +     I NV I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIEDKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIVTLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|330813642|ref|YP_004357881.1| ribosomal RNA small subunit methyltransferase E [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486737|gb|AEA81142.1| ribosomal RNA small subunit methyltransferase E [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 238

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 76/240 (31%), Positives = 129/240 (53%), Gaps = 4/240 (1%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYV 61
           +   + R+F+   L    + +   DQ HY+++V+R+K GD +LLFNG DGE+L K+    
Sbjct: 1   MQKKI-RIFLSERLEENNKIELGKDQSHYISNVMRLKSGDELLLFNGIDGEFLGKVAGSE 59

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            K    +V  + R Q+K S++   F P+K  RLD++IQK  E+G+ +  PVI+ +T   +
Sbjct: 60  KKQTIIQVHAKQRDQSKPSNISLAFCPLKGQRLDFLIQKCTEVGLKSFIPVISDHTIVRN 119

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
            N +R++   I ++EQ D L +P +     LE  L        ++F D +  + +  + +
Sbjct: 120 VNENRLKKIIIESSEQSDQLHIPQVLSALNLEEFLHFLKKEDVVLFGDISSKNNDLTQLI 179

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
              +   N  + IGPEG +  +E+E +         SLG  ILRS+TAA+A + L+  + 
Sbjct: 180 EDKS--KNYILFIGPEGDFSPKEREIILKNVKFKSFSLGKNILRSETAAIAGLVLLNFLL 237


>gi|229525160|ref|ZP_04414565.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           bv. albensis VL426]
 gi|229338741|gb|EEO03758.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           bv. albensis VL426]
          Length = 243

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S +
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEAMKLNLHPRAKYSIH 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|160880435|ref|YP_001559403.1| hypothetical protein Cphy_2303 [Clostridium phytofermentans ISDg]
 gi|160429101|gb|ABX42664.1| protein of unknown function DUF558 [Clostridium phytofermentans
           ISDg]
          Length = 246

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 108/245 (44%), Gaps = 11/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R +++      T  +  G   +++ +VLRMK G+ ++  +G+  ++   I+   K   
Sbjct: 1   MQRFYIESTNISDTTIRIEGADVNHIKNVLRMKIGEKLIACDGQGIDYCCIIAEFEKDNI 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-------T 117
                E +       + +       K ++++ ++QK+VE+G   I PV+ +         
Sbjct: 61  ILSISERKKTDTELPAKLILFQGLPKKDKMELIVQKAVELGAYEIVPVMMKRTIVKLEDK 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSEN 176
           +     ++R +     AA+Q     +P ++   + +  +K        +   E   G   
Sbjct: 121 KKEQKKLERWQAIAEGAAKQSGRGFIPRVHEIVSYQEAIKMASECDLSILPYECASGINE 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +   ++      ++ I+IGPEGG+  +E +       + P++LG RILR++TA +  ++ 
Sbjct: 181 TRALINQSKGKDSIGIMIGPEGGFAEDEVDLAKEHG-IIPVTLGKRILRTETAGLTILSY 239

Query: 237 VQAIC 241
           +    
Sbjct: 240 LMLTL 244


>gi|116054150|ref|YP_788593.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115589371|gb|ABJ15386.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 240

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 110/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R FVD PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFVDQPLALGQH-DLPETQAHYIGRVLRHATGDAVQLFDGSGREYLGELVEVGKK 59

Query: 65  IRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  NVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVAEITPIVSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R   ISA EQC   +LP I+PP  LE  L+  D   ++V          
Sbjct: 120 DERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRDDELRLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +      +A L+GP+GG    E E   +  F     LGPR+LR++TA V A+A+
Sbjct: 176 ---PLASHVPPSRLAFLVGPKGGLSDAEVEQAKAAGF-HAARLGPRVLRTETAPVVALAV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|113461711|ref|YP_719780.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus somnus 129PT]
 gi|112823754|gb|ABI25843.1| 16S rRNA m(3)U-1498 methyltransferase [Haemophilus somnus 129PT]
          Length = 245

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 109/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++    L  +   + S D  +++  VLRM+ G+ I LF+G +  +  +   +   
Sbjct: 1   MRIPRIYHPTSLENQQTCQLSDDAANHVGRVLRMQVGEQIELFDGSNHIYPAIITQTNKK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  Q  ++     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  AIEVNILSRQLDNRESPLFIHLGQVISRGERMEFTIQKSVELGVNIITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   ISA EQC    +P I P   L+      D   ++        +  
Sbjct: 121 KDRMEKKIQQWQKIAISACEQCGRNIVPEIRPLMKLQDWCAEQDGTLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L ++        V +LIGPEGG  ++E     +  F T + LG R+LR++TAA++A+  
Sbjct: 181 TLPEIP----PQGVRLLIGPEGGLSAQEISQTETQGF-TEILLGKRVLRTETAALSAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|197334623|ref|YP_002155192.1| protein YggJ [Vibrio fischeri MJ11]
 gi|197316113|gb|ACH65560.1| protein YggJ [Vibrio fischeri MJ11]
          Length = 243

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 119/247 (48%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L  + +   S D  +++  V+RMKEG+++LLF+G   E+ + I+   K 
Sbjct: 1   MRIPRIHHPELLPSQGKVNLSDDAANHVGRVMRMKEGESVLLFDGSGAEFPAVITSASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +   ++ +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVEVEITERIERSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNVITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +D+ +   I+A EQC   T+P I P  +LE          ++        S N
Sbjct: 121 KERFEKKLDQWQKIAIAACEQCGRNTIPEIRPIMSLEEWCAEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      + NV +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTNVRLLIGPEGGLSSDEINMTEQYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|209548049|ref|YP_002279966.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209533805|gb|ACI53740.1| protein of unknown function DUF558 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 245

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 143/226 (63%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RLFVD PL      +A+ DQ++YLA+VLRM+EG  +LLFNG+DGEW +    
Sbjct: 1   MRANFRMQRLFVDAPLSSGAALEANADQFNYLANVLRMEEGGEVLLFNGRDGEWKATLTF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I+     ++R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRIQLTAIEETRPQPAPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVRLLDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLSAIRERH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|269960438|ref|ZP_06174811.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834865|gb|EEZ88951.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 243

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETIQQLGAIALSDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVSKK 60

Query: 65  I-RFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               ++ E    S     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVMVEISERVESSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAVSACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  S+E +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSDEIDMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|146305452|ref|YP_001185917.1| hypothetical protein Pmen_0412 [Pseudomonas mendocina ymp]
 gi|145573653|gb|ABP83185.1| 16S rRNA m(3)U-1498 methyltransferase [Pseudomonas mendocina ymp]
          Length = 241

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 111/247 (44%), Gaps = 17/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGQH-DLPEAQAHYIGRVLRHAVGDALQLFDGSGQEYLGELIEVGKK 59

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  ++ +   +S   +       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  SVRVELREAIAGMSESPLRIHLGQGLSRGERMDWAIQKATELGAAEITPIVSARCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  M   R   ISA EQC    LP I PP  L   L+  + + ++V          
Sbjct: 120 DERADKRMAHWRQVAISACEQCGRSVLPLINPPLELAAWLQQIEADLKLVLHPVAA---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L +     ++A L+GPEGG    E +   +  F     LGPR+LR++TA V A+++
Sbjct: 176 ---PLQSHDKPNSLAFLVGPEGGLSEAEVDQTKAAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGD 243
            Q + GD
Sbjct: 232 AQQLWGD 238


>gi|229006652|ref|ZP_04164286.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock1-4]
 gi|228754513|gb|EEM03924.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock1-4]
          Length = 249

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+         +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNDASIRIVGDDVHHIARVMRMSVGDHIYCCVNGKTAMCTIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  SAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPAVHAPASFKQLLAMNSDYDVCLVAYEEEAKQGEKA 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L A+     + ++ GPEGG   EE   L    F+ P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTALERGQKLLVVFGPEGGLSEEEISALREHKFI-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|254226308|ref|ZP_04919899.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125621170|gb|EAZ49513.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGITTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|326202057|ref|ZP_08191927.1| protein of unknown function DUF558 [Clostridium papyrosolvens DSM
           2782]
 gi|325987852|gb|EGD48678.1| protein of unknown function DUF558 [Clostridium papyrosolvens DSM
           2782]
          Length = 250

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 109/246 (44%), Gaps = 11/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV+       +    G+ + +L  VLR +  D +    G   ++ ++I  +  S  
Sbjct: 1   MSRYFVEEAQIANGRINIVGEDFQHLKKVLRAQLKDEVTACCG-GFDYTAEIEEINDSSI 59

Query: 67  FKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
             +         +S   V       K+++++ +IQK VE+G+  I PVIT    +     
Sbjct: 60  ICIITDVNKNFTESPLKVTLFQGLPKSDKMELIIQKCVELGVWEIVPVITDRCVSRINTD 119

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 + R +     AA+QC+  T+P I  P T +  ++        +   E   +   
Sbjct: 120 KDAKNKLARWQKIAREAAKQCNRGTIPNILYPITFKEAVEKASQAELAIIPYEKESAVGL 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              +     I + +I+IGPEGG+  +E +       V  +SLGPRILR++TA + A++L+
Sbjct: 180 KNIVPRYEGITSGSIIIGPEGGFEEKEVQMAEDRG-VKKISLGPRILRTETAGMVALSLL 238

Query: 238 QAICGD 243
               GD
Sbjct: 239 MYELGD 244


>gi|254230223|ref|ZP_04923615.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393236|ref|YP_003285090.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. Ex25]
 gi|151937255|gb|EDN56121.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262336830|gb|ACY50625.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. Ex25]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG ++LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETIHQLGSLALSDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISEVSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  TVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   K      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEEWCKEEYDGLKLNLHPRANYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|166031241|ref|ZP_02234070.1| hypothetical protein DORFOR_00928 [Dorea formicigenerans ATCC
           27755]
 gi|166029088|gb|EDR47845.1| hypothetical protein DORFOR_00928 [Dorea formicigenerans ATCC
           27755]
          Length = 248

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 112/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK--ISYVGKS 64
           ++  FVD     +   +  G   +++ +VLRM+ G+ + + +G+  E+L +       + 
Sbjct: 1   MQHFFVDASQVSEETIRIEGTDVNHMKNVLRMRIGEEVTVSDGQGKEYLCQVRDFEEEQV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               VE ++      S +       K  +++ ++QK VE+G+ A+ PV  +        +
Sbjct: 61  QLKIVETKASDAELPSKIYLFQGLPKQEKMELIVQKCVELGIYAVVPVSMKRCVVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                ++R  T   SAA+Q     +P +    T +  L+       ++   E   G E++
Sbjct: 121 KGAKKVERWNTIAASAAKQSGRGIVPEVTSVKTYKEALEMAKDLDVVLVPYECAEGMEHT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E + +I    +V I IGPEGG+  +E      +     ++LG RILR++TA +A ++++
Sbjct: 181 KELIQSIKPGQSVGIFIGPEGGFDPDEIALACEMGG-QVITLGKRILRTETAGLALLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 MFQL 243


>gi|18311008|ref|NP_562942.1| hypothetical protein CPE2026 [Clostridium perfringens str. 13]
 gi|168208728|ref|ZP_02634353.1| RNA methyltransferase, RsmE family [Clostridium perfringens B str.
           ATCC 3626]
 gi|168212937|ref|ZP_02638562.1| RNA methyltransferase, RsmE family [Clostridium perfringens CPE
           str. F4969]
 gi|18145690|dbj|BAB81732.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|170712974|gb|EDT25156.1| RNA methyltransferase, RsmE family [Clostridium perfringens B str.
           ATCC 3626]
 gi|170715557|gb|EDT27739.1| RNA methyltransferase, RsmE family [Clostridium perfringens CPE
           str. F4969]
          Length = 250

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 111/246 (45%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPEVLEPMDFKGVLEKIDELDLMVIPYENATGYGIRAM 180

Query: 181 LHAIAHIPNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +++I +  ++    I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIENKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIVTLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|121728575|ref|ZP_01681596.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147674458|ref|YP_001215995.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio cholerae O395]
 gi|229519855|ref|ZP_04409289.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae TM
           11079-80]
 gi|229530311|ref|ZP_04419699.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           12129(1)]
 gi|254291180|ref|ZP_04961976.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|261210046|ref|ZP_05924344.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC341]
 gi|262167137|ref|ZP_06034851.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           RC27]
 gi|121629131|gb|EAX61574.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|146316341|gb|ABQ20880.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|150422874|gb|EDN14825.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227012322|gb|ACP08532.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229332084|gb|EEN97572.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           12129(1)]
 gi|229343143|gb|EEO08127.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae TM
           11079-80]
 gi|260840811|gb|EEX67353.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC341]
 gi|262024437|gb|EEY43124.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           RC27]
 gi|327483322|gb|AEA77729.1| Ribosomal RNA small subunit methyltransferase E [Vibrio cholerae
           LMA3894-4]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|121590723|ref|ZP_01678055.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153819149|ref|ZP_01971816.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227080679|ref|YP_002809230.1| hypothetical protein VCM66_0454 [Vibrio cholerae M66-2]
 gi|229507107|ref|ZP_04396613.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae BX
           330286]
 gi|298501000|ref|ZP_07010801.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121547454|gb|EAX57563.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|126510294|gb|EAZ72888.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227008567|gb|ACP04779.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229355852|gb|EEO20772.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae BX
           330286]
 gi|297540248|gb|EFH76308.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSLN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|258620733|ref|ZP_05715768.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586931|gb|EEW11645.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|160873963|ref|YP_001553279.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS195]
 gi|160859485|gb|ABX48019.1| protein of unknown function DUF558 [Shewanella baltica OS195]
 gi|315266197|gb|ADT93050.1| protein of unknown function DUF558 [Shewanella baltica OS678]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++ S     ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKLLSCEANSSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P + P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVISACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLAH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|87134653|gb|ABD25395.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 258

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 4/239 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFV+ PL    +    G Q HYL  V+R+  GD ++L +   GEW+S+++ VGK    
Sbjct: 22  PRLFVEMPLDQGMRLPVDGQQAHYLGKVMRVSTGDAVMLCDDATGEWVSRVAEVGKRDLV 81

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            ++E ++R + +  D     + +K    D +++K+ E+G   + PV+TR       N +R
Sbjct: 82  LEIERRTRPREEVPDFWLCAALLKKPNFDLVLEKATELGAARVVPVVTRRCVADKLNPER 141

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
            RT  + AAEQC    LP +     L+ LL++W     + FADE  G   +        H
Sbjct: 142 ARTIMVEAAEQCARTALPSLGETVKLDQLLRDWPEGRTLFFADENGGIPAAA---AFSLH 198

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDWY 245
               A+L+GPEGG+   E+  + + P    ++LGPRILR +TA++A M L   + GDW+
Sbjct: 199 CGPAALLVGPEGGFDETERSAIRAHPAAVGIALGPRILRGETASIAGMGLWMGLQGDWF 257


>gi|153826558|ref|ZP_01979225.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|149739650|gb|EDM53864.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
          Length = 243

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E    S     D+       + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLANITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|82701513|ref|YP_411079.1| hypothetical protein Nmul_A0379 [Nitrosospira multiformis ATCC
           25196]
 gi|82409578|gb|ABB73687.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 255

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 64/256 (25%), Positives = 117/256 (45%), Gaps = 17/256 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R +    +      +      H+ A VLR++ GD ++LFNG  GE+   I    K 
Sbjct: 1   MTLPRFYCPIEILAGQTLELPSAVAHHAARVLRLEAGDEVVLFNGDGGEFTCVILRASKQ 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   +    +     +    +     ++D+++QK+VE+G+  I+P+IT+ +     
Sbjct: 61  GVDVVVERHVQVERESPLTILLAQAVCMGEKMDWIVQKAVELGVTRIQPLITKQSVVRLG 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIV--------FA 168
            +     +  ++   ISA EQC    +P + P  TL   L       ++           
Sbjct: 121 GERGEKRVSHLQKVVISACEQCGRNHVPEVLPLATLRNWLGRQTEARRMSSDSLSPDACF 180

Query: 169 DETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
             +  +   L      ++I ++ +L+GPEGG+  +E+       F+ PL LG RILR+++
Sbjct: 181 MLSPFATKGLRDFKHSSNIGSIILLVGPEGGFTQDEEAAAMVAGFI-PLRLGHRILRTES 239

Query: 229 AAVAAMALVQAICGDW 244
           AA+AA+  +QA+ GD+
Sbjct: 240 AALAAVGAMQALWGDY 255


>gi|59711043|ref|YP_203819.1| hypothetical protein VF_0436 [Vibrio fischeri ES114]
 gi|59479144|gb|AAW84931.1| predicted protein [Vibrio fischeri ES114]
          Length = 243

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 119/247 (48%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L  + +   S D  +++  V+RMKEG+++LLF+G   E+ + I+   K 
Sbjct: 1   MRIPRIHHPELLPSQGKVNLSDDAANHVGRVMRMKEGESVLLFDGSGSEFPAVITSASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +   ++ +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVEVEITERIERSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNIITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +D+ +   I+A EQC   T+P I P  +LE          ++        S N
Sbjct: 121 KERFEKKLDQWQKIAIAACEQCGRNTVPEIRPIMSLEEWCAEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      + NV +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTNVRLLIGPEGGLSSDEISMTEQYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|153802600|ref|ZP_01957186.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124121863|gb|EAY40606.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 243

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  KVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|190890510|ref|YP_001977052.1| hypothetical protein RHECIAT_CH0000889 [Rhizobium etli CIAT 652]
 gi|190695789|gb|ACE89874.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 245

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 140/226 (61%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RLFVD PL      +AS +Q++YLA+VLRM+    ILLFNG+DGEW  S   
Sbjct: 1   MRANFRMQRLFVDAPLSAGAVVEASAEQFNYLANVLRMEADAEILLFNGRDGEWKASLSF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEETRPQPLPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVKLSDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLSAIRERH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|110803459|ref|YP_699307.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium perfringens
           SM101]
 gi|110683960|gb|ABG87330.1| RNA methyltransferase, RsmE family [Clostridium perfringens SM101]
          Length = 250

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 111/246 (45%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHAKITGEDVKHIYKVLRVKPGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVLEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPEVLEPMDFKGVLEKIDELDLMVIPYENATGYGIRAM 180

Query: 181 LHAIAHIPNV---AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +++I +  ++    I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIENKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIVTLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|209694142|ref|YP_002262070.1| 16S ribosomal RNA methyltransferase RsmE [Aliivibrio salmonicida
           LFI1238]
 gi|208008093|emb|CAQ78234.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 243

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 116/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L  + +   S D  +++  V+RMKEG+ +LLF+G   E+ + I+   K 
Sbjct: 1   MRIPRIHHPELLPSQGKVNLSDDAANHVGRVMRMKEGEAVLLFDGSGAEFPAVITSSSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVEVEISERIDHSSESPLNLHLGQVVSRGDKMEFTIQKSVELGVNIITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     +D+     I+A EQC   T+P I P  +LE          ++        S N
Sbjct: 121 KERFEKKLDQWHKIAIAACEQCGRNTIPEIRPIMSLEEWCAEEYEGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      + NV +LIGPEGG  SEE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTNVRLLIGPEGGLSSEEITMTEQYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|228999104|ref|ZP_04158686.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock3-17]
 gi|228760721|gb|EEM09685.1| RNA methyltransferase, RsmE [Bacillus mycoides Rock3-17]
          Length = 249

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+         +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNDASIRIVGDDVHHIARVMRMSVGDHIYCCVNGKTAMCTIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  SAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPAVHAPASFKQLLAMSSDYDVCLVAYEEEAKQGEKA 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L A+     + ++ GPEGG   EE   L    F+ P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTALERGQKLLVVFGPEGGLSEEEISALREHKFI-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|323702403|ref|ZP_08114068.1| protein of unknown function DUF558 [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532709|gb|EGB22583.1| protein of unknown function DUF558 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 246

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 102/245 (41%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI--SYVGKS 64
           + R FVD           +G    +++ VLRM  GD + + +G+   + ++I      + 
Sbjct: 1   MARFFVDPQDIKGDTAIITGPDVKHISKVLRMGNGDRLTILDGRGLVFTAEITGMTKDEV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +  +         V  +    K ++++ +IQK  E+G+  I P+    +       
Sbjct: 61  TCHLLGPEVAPAEPNLKVTLVQGLPKGDKMETIIQKCTELGIYQIIPLAAARSVVRLDGK 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                  R +   + AA+QC    +P +     L  ++     N   V A E    ++  
Sbjct: 121 KAAERQQRWQRVAMEAAKQCRRPVIPRVQKLCQLTEVISMIPTNALGVIAWEDEKQQSLR 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           + L  +     + I IGPEGG+  EE   L    +   ++LGPRILR++TA   A+ +V 
Sbjct: 181 QLLQGVTMPEEIYIFIGPEGGFDPEEVARLSQRGWPN-VTLGPRILRTETAGPTALTMVL 239

Query: 239 AICGD 243
              G+
Sbjct: 240 YHYGE 244


>gi|153216268|ref|ZP_01950361.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124114357|gb|EAY33177.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQTGQEVLLFDGLGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|168826710|gb|ACA32081.1| protein of unknown function DUF558 [Haemophilus somnus 2336]
          Length = 272

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 58/248 (23%), Positives = 109/248 (43%), Gaps = 13/248 (5%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYV 61
           +  + R++    L  +   + S D  +++  VLRM+ G+ I LF+G +  +  +   +  
Sbjct: 27  NMRIPRIYHPTSLENQQTCQLSDDAANHVGRVLRMQVGEQIELFDGSNHIYPAIITQTNK 86

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +  Q  ++     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 87  KAIEVNILSRQLDNRESPLFIHLGQVISRGERMEFTIQKSVELGVNIITPLWSERCGVKL 146

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
                   + + +   ISA EQC    +P I P   L+      D   ++        + 
Sbjct: 147 DKDRMEKKIQQWQKIAISACEQCGRNIVPEIRPLMKLQDWCAEQDGTLKLNLHPRAKYTI 206

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L ++        V +LIGPEGG  ++E     +  F T + LG R+LR++T A++A+ 
Sbjct: 207 RTLPEIP----PQGVRLLIGPEGGLSAQEISQTETQGF-TEILLGKRVLRTETTALSAIT 261

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 262 ALQVCFGD 269


>gi|326797241|ref|YP_004315061.1| ribosomal RNA small subunit methyltransferase E [Marinomonas
           mediterranea MMB-1]
 gi|326548005|gb|ADZ93225.1| Ribosomal RNA small subunit methyltransferase E [Marinomonas
           mediterranea MMB-1]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++VD  L   T+       + +   VLR+KEG  I+LFNG  GE+ + +  V K 
Sbjct: 1   MRIPRIYVDIDLTEHTEIILPDSAFQHCCKVLRLKEGHAIILFNGDGGEYDATLYNVQKR 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   Y+         V    S  +  R+DY IQK+VE G+  I+P+ +        
Sbjct: 61  AASAQLTTYRVLENESPLKVTIGQSLSRGERMDYAIQKAVESGVFRIQPLFSERCEVKLQ 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   ISAAEQC    +P I  P  L   ++  +   +I     +    +
Sbjct: 121 EDRMEKRLKHWQQVAISAAEQCGRGVVPKILEPINLLDWVEKCNEMLKITLHHHSAKPIH 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                       ++A+LIGPEGG    E E      F   ++LGPR+LR++TA V A+  
Sbjct: 181 DF----ERPPENSIALLIGPEGGLTDIEVEKASLFGF-QSIALGPRVLRTETAPVVALTT 235

Query: 237 VQAICGD 243
           +  + GD
Sbjct: 236 LNLMWGD 242


>gi|239995591|ref|ZP_04716115.1| hypothetical protein AmacA2_14079 [Alteromonas macleodii ATCC
           27126]
          Length = 242

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 114/248 (45%), Gaps = 14/248 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+ ++ + + +    H++A VLR+K    I+LFNG   E+ ++I  V + 
Sbjct: 1   MRIPRVYYPNPIPLEQEFELTEGAGHHIATVLRIKPNRPIVLFNGDGNEYSAQIISVQRK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ---- 118
                     S ++     +       K +R+D ++QKSVE+G+  I PVIT        
Sbjct: 61  KVTVEADACLSLAKESPLHLHLGQGVSKGDRMDTVLQKSVELGVSEITPVITERCTVKLD 120

Query: 119 --NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I A EQ     +P +  P +L   L +  +  ++V A        
Sbjct: 121 ESRWEKKIQQWQKIIIGACEQSGRNIIPALNAPVSLNQWLSSSTNTTRLVLAPGAEQ--- 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                    +     +LIGPEGG    E    +   +   +SLGPRILR++TAA+ ++++
Sbjct: 178 --SLARQPYNAQGFRLLIGPEGGLSETEVHQANENGY-QSVSLGPRILRTETAAITSLSI 234

Query: 237 VQAICGDW 244
           +QA  GD+
Sbjct: 235 LQAQHGDF 242


>gi|229512531|ref|ZP_04402002.1| small ribosomal subunit 16S rRNA methyltransferase [Vibrio cholerae
           TMA 21]
 gi|229350424|gb|EEO15373.1| small ribosomal subunit 16S rRNA methyltransferase [Vibrio cholerae
           TMA 21]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                       + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITDRVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCSEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|217972024|ref|YP_002356775.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS223]
 gi|217497159|gb|ACK45352.1| protein of unknown function DUF558 [Shewanella baltica OS223]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIFQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +        ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKLLSCEVNLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQ     +P + P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLAH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|24372421|ref|NP_716463.1| hypothetical protein SO_0832 [Shewanella oneidensis MR-1]
 gi|24346395|gb|AAN53908.1|AE015528_1 conserved hypothetical protein TIGR00046 [Shewanella oneidensis
           MR-1]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL +  Q     D   ++  VLRM  G+ I LFNG   ++L++I    K 
Sbjct: 1   MRVPRIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGNGEQISLFNGDGHDYLAEIIDAAKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVTVKVLSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P + P   L+          ++          N
Sbjct: 121 GERLDKKIQQWQKIVISACEQSGRSQVPVVRPAMELQQWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLSH-----TRVRLLIGPEGGLSAEEIAMTETHQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|262164080|ref|ZP_06031819.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           VM223]
 gi|262027608|gb|EEY46274.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           VM223]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQTGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVRLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|258625617|ref|ZP_05720499.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262172417|ref|ZP_06040095.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           MB-451]
 gi|258582119|gb|EEW06986.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|261893493|gb|EEY39479.1| ribosomal RNA small subunit methyltransferase E [Vibrio mimicus
           MB-451]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQTGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|296133940|ref|YP_003641187.1| protein of unknown function DUF558 [Thermincola sp. JR]
 gi|296032518|gb|ADG83286.1| protein of unknown function DUF558 [Thermincola potens JR]
          Length = 249

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 106/245 (43%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + R FV        Q    G    +++ VLRM+ GD + L +    E+ ++I+ +     
Sbjct: 1   MARFFVKDEQVKGVQVFIVGSDVRHISKVLRMRPGDCLTLIDEAGTEYEARITQIAPERI 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               V   S ++    +V       K ++L+ +IQK VE+G+  I PV    +       
Sbjct: 61  TCEIVTETSVNREPPLEVILCQGLPKGDKLELIIQKGVELGVTRIIPVSCTRSVVQLTEE 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R +   + AA+QC    +P + P T  +  L+        V   E        
Sbjct: 121 KAAKRRERWQRVALEAAKQCRRNKVPEVSPLTGFDEALQLIPDGVLAVIPWEDAVGTGLK 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           + L +  +   V I IGPEGG+   E E       V P++LG RILR++TA +AA+ +V 
Sbjct: 181 KVLRSYNNRGQVWIFIGPEGGFTEAEIEKAKGKG-VVPVTLGRRILRAETAGIAAITMVL 239

Query: 239 AICGD 243
              GD
Sbjct: 240 YQLGD 244


>gi|262403905|ref|ZP_06080462.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC586]
 gi|262349867|gb|EEY99003.1| ribosomal RNA small subunit methyltransferase E [Vibrio sp. RC586]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+   +    S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLSTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                       S     D+       + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITARVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|262191080|ref|ZP_06049287.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae CT
           5369-93]
 gi|297580608|ref|ZP_06942534.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|262033056|gb|EEY51587.1| ribosomal RNA small subunit methyltransferase E [Vibrio cholerae CT
           5369-93]
 gi|297535024|gb|EFH73859.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 243

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++  VLRM+ G  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGFGAEFPAVISEVGKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                       + +S +         + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVLVNITDRVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 EKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|91762733|ref|ZP_01264698.1| hypothetical protein PU1002_05671 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718535|gb|EAS85185.1| hypothetical protein PU1002_05671 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 233

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 5/232 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF    L +    K    Q HY+  V+R+K G+   LFN         ++     + F 
Sbjct: 5   RLFFKESLSLNLTAKLDKSQSHYVNKVMRIKVGEVFSLFNNSGEWEAKILTISKSIVEFN 64

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q R +    D+   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+ 
Sbjct: 65  ITKQLRQKENVKDLWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERLE 124

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQ + + +P I  P +L+  L +       +F D    ++       A     
Sbjct: 125 KVIIEAAEQSNRINVPLIEDPQSLKSFLNHEKMGL--IFTDLNSENKKLDFNKLAHNPTC 182

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
              ++IGPEG +  EE+  + +   V P+ +   ILRS+TA ++A+++V  +
Sbjct: 183 ---VIIGPEGDFSEEERGEILAFKGVQPIKINENILRSETAVISALSIVNYL 231


>gi|317049423|ref|YP_004117071.1| hypothetical protein Pat9b_3219 [Pantoea sp. At-9b]
 gi|316951040|gb|ADU70515.1| protein of unknown function DUF558 [Pantoea sp. At-9b]
          Length = 243

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F   PL + ++     D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIFHPEPLAVNSEVFLDEDAANHVGRVLRMSAGQRLELFDGSNLTFAAEITQADKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 ++ Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  RVKVRVLDSQQDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I    TLE          ++        S N
Sbjct: 121 AERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEAADGLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  + +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERIRLLIGPEGGLSTEEIAMTAQHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|228993054|ref|ZP_04152977.1| RNA methyltransferase, RsmE [Bacillus pseudomycoides DSM 12442]
 gi|228766702|gb|EEM15342.1| RNA methyltransferase, RsmE [Bacillus pseudomycoides DSM 12442]
          Length = 249

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 100/246 (40%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+         +  GD  H++  V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNDASIRIVGDDVHHIVRVMRMSVGDHIYCCVNGKTAMCTIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  SAIVEWGEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPAVHAPASFKQLLAMSSDYDVCLVAYEEEAKQGEKA 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L A+     + ++ GPEGG   EE   L    F+ P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTALERGQKLLVVFGPEGGLSEEEISALREHKFI-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|27364902|ref|NP_760430.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio vulnificus CMCP6]
 gi|37681051|ref|NP_935660.1| hypothetical protein VV2867 [Vibrio vulnificus YJ016]
 gi|320155285|ref|YP_004187664.1| ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           MO6-24/O]
 gi|27361047|gb|AAO09957.1| Ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           CMCP6]
 gi|37199801|dbj|BAC95631.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319930597|gb|ADV85461.1| ribosomal RNA small subunit methyltransferase E [Vibrio vulnificus
           MO6-24/O]
          Length = 243

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 115/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + IS VGK 
Sbjct: 1   MRIPRIYHPETIQHLGVIALSDDAAGHIGRVLRMKEGQEVLLFDGSGAEFPAVISEVGKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
             +    E   RS     D+       +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVMVELSERVERSSESPLDLHLGQVISRGEKMEFTIQKSVELGVNTITPLISDRCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P  +LE          ++        S N
Sbjct: 121 EKRFEKKLAQWQKIAISACEQCGRNTIPEIRPIMSLEAWCAEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  SEE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTKVRLLIGPEGGLSSEEIDMTQQYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|114567095|ref|YP_754249.1| hypothetical protein Swol_1575 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114338030|gb|ABI68878.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 248

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 100/247 (40%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-- 64
           + R FV              +Q  ++  VLR+K GD + +F+G   E+  ++    +   
Sbjct: 1   MPRFFVSADNIKGNSVLIDEEQTRHIEKVLRLKSGDIVKVFDGNGNEYQVRLQEKKQKIL 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +  ++ ++    ++  +    ++ ++D++IQK+VE+G+ ++ P+ + ++       
Sbjct: 61  QAEILAQETTAEDLAINLTLVQGIARSEKMDFIIQKAVELGVRSLIPLQSEHSVARFDKE 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLE--FLLKNWDHNCQIVFADETCGSEN 176
                + R +     A +QC    +P + P                      +       
Sbjct: 121 KEGKKIKRWQKIAQEACKQCGRNHIPEVKPILDFPALMAQIGDKPALLCYEQEREAYFRT 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L +         + ++IGPEGG+   E E      +     LGPR LR++TA++ A  +
Sbjct: 181 LLREQRENFCTQGLFLIIGPEGGFSPAEVEIARRQGWFIA-GLGPRTLRTETASLLACGI 239

Query: 237 VQAICGD 243
           +    G+
Sbjct: 240 IMYEYGE 246


>gi|327191156|gb|EGE58200.1| hypothetical protein RHECNPAF_3350022 [Rhizobium etli CNPAF512]
          Length = 245

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 140/226 (61%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RLFVD PL      +A+ +Q++YLA+VLRM+    ILLFNG+DGEW  S   
Sbjct: 1   MRANFRMQRLFVDAPLSSGAAIEANAEQFNYLANVLRMEADAEILLFNGRDGEWKASLTF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      Q+R Q    D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEQTRPQPLPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLGIPDVAEPVKLSDLLDRWPKERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLSAIREKH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|291549888|emb|CBL26150.1| RNA methyltransferase, RsmE family [Ruminococcus torques L2-14]
          Length = 255

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 49/244 (20%), Positives = 106/244 (43%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLS--KISYVGKS 64
           ++  F D       Q + +G   +++ +VLRMK G+ + + +G+  ++    +     ++
Sbjct: 1   MQHFFADPSCVDGEQIRLAGSDVNHMKNVLRMKPGEEVWVSDGEGMDYFCSVEGYEEKEA 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           +   V+ +       S +       K +++++++QK+VE+G   I P   +        +
Sbjct: 61  VLRVVKKEVSQTELASRLILFQGLPKGDKMEWIVQKAVELGAYRIVPFAAKRSVVKLDQK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                 +R +     AAEQ     +P +    + +  +        ++   E   G + +
Sbjct: 121 KAGKKRERWQAIAKGAAEQSKRGIVPQVQDVMSFQEAMNYAKELDVVLVPYELQEGMKAT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              +  I    +V I IGPEGG+   E E       + P++LG RILR++TA +  ++++
Sbjct: 181 EAVISKIEPGQSVGIFIGPEGGFDESEIEQAKEAGAI-PITLGKRILRTETAGLTTLSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|150395613|ref|YP_001326080.1| 16S ribosomal RNA methyltransferase RsmE [Sinorhizobium medicae
           WSM419]
 gi|150027128|gb|ABR59245.1| protein of unknown function DUF558 [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 100/226 (44%), Positives = 149/226 (65%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL      +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++IS 
Sbjct: 1   MRANFRMQRLFVESPLHNGASHQATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEISM 60

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +     V   Q+R Q    D+ Y+F+P+KT RLDY++QK+VEMG G ++PVIT++ Q 
Sbjct: 61  PSRKQAVLVAVEQTRPQPAPCDLVYLFAPLKTGRLDYLVQKAVEMGAGVLQPVITQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              +++R+R   I AAEQC +L +P +  P  LE LL  W  + +IVF DE   S+N L 
Sbjct: 121 KIGSLERIRANAIEAAEQCGVLGIPAVEEPRRLEDLLAAWPRDRRIVFCDEGNESQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L+ +A    +A+LIGPEGG+   E++ L SL FVT + LGPRILR
Sbjct: 181 ILNELAE-HRLALLIGPEGGFSETERDLLRSLDFVTAIPLGPRILR 225


>gi|83950615|ref|ZP_00959348.1| hypothetical protein ISM_05935 [Roseovarius nubinhibens ISM]
 gi|83838514|gb|EAP77810.1| hypothetical protein ISM_05935 [Roseovarius nubinhibens ISM]
          Length = 234

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 90/224 (40%), Positives = 129/224 (57%), Gaps = 4/224 (1%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR-FKVEYQSRSQTKQSDVQ 83
             DQ +YL +V+R+ +G ++ LFNG+DG W ++++  GK     +V  Q+  Q    D+ 
Sbjct: 2   DRDQANYLFNVMRLDQGASVTLFNGRDGAWRAEVAERGKRGGALQVAEQTAPQRNPPDLW 61

Query: 84  YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTL 143
            +F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + I AAEQC    +
Sbjct: 62  LLFAPIKKARTDFIVEKAAEMGASRILPVQTEFTNSERIRQDRLQAHAIEAAEQCGGTFV 121

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL---EKLHAIAHIPNVAILIGPEGGY 200
           P +     L+ LL +W    Q++F DE      S        +       AILIGPEGG+
Sbjct: 122 PEVADLARLDRLLSDWPEERQLMFCDEALFDRPSPLTNGDATSSGTGTPWAILIGPEGGF 181

Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              E+  LH+LPF  P+SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 182 SDAERSRLHALPFAHPVSLGPRILRADTAAVAAMTLWQDRLGDW 225


>gi|119945034|ref|YP_942714.1| hypothetical protein Ping_1288 [Psychromonas ingrahamii 37]
 gi|119863638|gb|ABM03115.1| hypothetical protein DUF558 [Psychromonas ingrahamii 37]
          Length = 242

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R +    L + T+   S D   ++ HVLR++ G  I+LFNG  GE  + ++   K 
Sbjct: 1   MRIPRFYDPQTLTVATEVNLSKDAIQHI-HVLRLRPGAQIILFNGLGGEVQATLTSAQKR 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
               +         +S +      +  + +R++++IQK+VE+G+  I P+++        
Sbjct: 60  SCTALINSFNQTDNESPLHLHLGQVISRGDRMEFVIQKAVELGVNEITPLLSERCGVKLD 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            Q       + +   ++A EQ     +P I+    L    ++ +   ++        S N
Sbjct: 120 DQRMAKKQQQWQKIALAACEQSGRNIIPVIHETEALTTWCESAEQATKLTLHPRAKYSIN 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        I  + +LIGPEGG   +E     +L F   L LGPRILR++TAA++A+  
Sbjct: 180 TLP-----PEIKRIRLLIGPEGGLSDQEVTLTETLNFTETL-LGPRILRTETAALSAITA 233

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 234 LQCRFGD 240


>gi|183596310|ref|ZP_02958338.1| hypothetical protein PROSTU_00045 [Providencia stuartii ATCC 25827]
 gi|188023914|gb|EDU61954.1| hypothetical protein PROSTU_00045 [Providencia stuartii ATCC 25827]
          Length = 243

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++IS   K 
Sbjct: 1   MRIPRIYHPEPLQINTTIALGDDAANHVGRVLRMTAGQKLELFDGSNQVFCAEISEATKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 ++     +    D+       +  ++++ IQKSVE+G+  I P+++        
Sbjct: 61  KVSVNIIDSHVDDRESPLDLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+A EQC    +P I P  +LE      D   ++        S N
Sbjct: 121 PERLEKKRQQWQKIAIAACEQCGRNRIPQIRPVQSLEAWCAEEDGAFKVNLHPRATQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      A +  V +LIGPEGG   EE     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PAELNKVRLLIGPEGGLSEEEIAMTANYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRLGD 241


>gi|119503497|ref|ZP_01625580.1| hypothetical protein MGP2080_03120 [marine gamma proteobacterium
           HTCC2080]
 gi|119460559|gb|EAW41651.1| hypothetical protein MGP2080_03120 [marine gamma proteobacterium
           HTCC2080]
          Length = 243

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 100/243 (41%), Gaps = 16/243 (6%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+    L    + +   +  H+L  VLR + GDNI LF G   +W   +S V K     
Sbjct: 5   RLYTKQSLESGNKVELEAEVAHHLVKVLRARVGDNITLFTGTGLDWQCCVSEVHKRSVTL 64

Query: 69  VEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNT 120
                 + +              K +R D+ IQK+ E G+  I P+ +            
Sbjct: 65  SVGGASNPNTESPLKTHLGLCLSKGDRFDWAIQKATEAGVATITPLYSDRVDVKLPADRI 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +   +    SA EQC    +P I+ PT L    +      ++               
Sbjct: 125 PKRIAHWQQIVRSACEQCGRAIVPQIFDPTPLSNWAQEQVSEAKLFLHHRES-------A 177

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           +  +    ++A+L+GPEGG    ++       F+  + LGPR+LR++TA + A++++ A 
Sbjct: 178 MLPVTRPTSIALLVGPEGGLSETDRGYASDAGFI-GVKLGPRVLRTETAPLVALSILGAR 236

Query: 241 CGD 243
            GD
Sbjct: 237 WGD 239


>gi|78486164|ref|YP_392089.1| hypothetical protein Tcr_1823 [Thiomicrospira crunogena XCL-2]
 gi|78364450|gb|ABB42415.1| Conserved hypothetical protein with DUF 558 [Thiomicrospira
           crunogena XCL-2]
          Length = 245

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 112/248 (45%), Gaps = 12/248 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R ++        +      Q HY   VLR+K+   I +F+GK  +  + +   G+ 
Sbjct: 1   MRIPRFYLPVTFQEGERISLDKAQAHYALTVLRLKDQRPIEVFDGKGHQAHATLQVTGRK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
               F    +S +         +    K +R+DY IQKSVE+G+ AI+P+ T        
Sbjct: 61  TADVFIERCESVNTESPLQTVLLQGISKGDRMDYTIQKSVELGVTAIQPLFTERCDVKLT 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+A EQ +   +P + PP +    L        +V +      E+
Sbjct: 121 GDRLDKKRTQWQDIAINACEQSNRNVVPAVLPPLSYSDWLSTQTLVSGLVLSPTA---EH 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L+ L +     +V +LIGPEGG   EE         +TP+ LGPRILR++TA V  ++ 
Sbjct: 178 TLQTLPSSLSEQSVHLLIGPEGGLTDEEVLQGTQKG-LTPIQLGPRILRTETAGVVVLSA 236

Query: 237 VQAICGDW 244
           +Q + GD+
Sbjct: 237 LQTLWGDF 244


>gi|134094087|ref|YP_001099162.1| 16S ribosomal RNA methyltransferase RsmE [Herminiimonas
           arsenicoxydans]
 gi|133737990|emb|CAL61035.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 241

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 114/244 (46%), Gaps = 13/244 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +    L I           H++  V+R+  GD I LFNG+ GE+ + IS + K   
Sbjct: 1   MPRFYCPQALVIGAVVTLPEHVAHHI-QVIRLSAGDAITLFNGEGGEYTATISTIEKKRV 59

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                 ++ R       +    +  + +++D++I+K+VE+G  A++P+ ++        +
Sbjct: 60  TAEIKIFEPREVELPYAITLAQALPEASKMDWIIEKAVELGAHALQPLASQRCVVRLSAE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                M   +   I+A+EQ     L  +  P          D + +I+ +      E SL
Sbjct: 120 RAAKKMQHWQGIIIAASEQSGRNRLTTLAEPADFNQWATQQDLHVRIMLSPRA---EQSL 176

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                     +VA++IGPEGG+  +E+    +      LS+GPR+LR++TA +AA+A + 
Sbjct: 177 SDWARHHPPQSVALMIGPEGGFTEKEETQAIANG-ALMLSMGPRVLRTETAGMAAIAALN 235

Query: 239 AICG 242
           A+ G
Sbjct: 236 AVWG 239


>gi|182626905|ref|ZP_02954639.1| RNA methyltransferase, RsmE family [Clostridium perfringens D str.
           JGS1721]
 gi|177907755|gb|EDT70367.1| RNA methyltransferase, RsmE family [Clostridium perfringens D str.
           JGS1721]
          Length = 250

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 109/246 (44%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + + F    +   T  K +G+   ++  VLR+K G+ +++ N +  E+L ++  V K   
Sbjct: 1   MHKFFTPAHMFSDTHAKITGEDVKHIYKVLRVKAGEKVVVNNLESEEFLGEVEEVNKQEV 60

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E    +     ++       K  ++D ++QK VE+G+  I P IT          
Sbjct: 61  SIKILEKLDVNNESNLNITLFQGMPKAAKMDLIVQKCVELGVSEIIPTITDRVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCG---SENS 177
              +DR+    + A +Q     +P +  P   + +L+  D    +V   E          
Sbjct: 121 FKKLDRLNKIALEACKQSKRTVIPQVLEPMDFKEVLEKIDQLDLMVIPYENATGYGIRAM 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +  +     I NV I++GPEGG+   E E L        ++LGPRILR++TA    ++L+
Sbjct: 181 VNSIEDKDSIKNVGIMVGPEGGFEESEIEALKEKG-AHIITLGPRILRTETAGFTCISLI 239

Query: 238 QAICGD 243
           Q   GD
Sbjct: 240 QYELGD 245


>gi|218767503|ref|YP_002342015.1| 16S ribosomal RNA methyltransferase RsmE [Neisseria meningitidis
           Z2491]
 gi|121051511|emb|CAM07805.1| hypothetical protein NMA0528 [Neisseria meningitidis Z2491]
 gi|319409765|emb|CBY90071.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
          Length = 241

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 16/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L +        +   +L +VLR++  +NI LF+GK     ++++     ++
Sbjct: 1   MPRFYLPENLSVGQTVALPDNIVRHL-NVLRVRPNENITLFDGKGKAHAAQLTVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +   +       ++  I S    +R+D+ +QKSVE+G+ AI+PVI+          
Sbjct: 60  EAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRLDGE 119

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQ    T+P + P       L         +       S N  
Sbjct: 120 RAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSESTKLI-----MSINRA 174

Query: 179 EKLHAIAHIPN-VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            KL  I H    +  ++GPEGG+  +E++      F   ++LG RILR++T A+AA+A +
Sbjct: 175 RKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFDAGF-QTVTLGKRILRTETVALAALAAM 233

Query: 238 QAICGDW 244
           Q + GD+
Sbjct: 234 QTLWGDF 240


>gi|269101820|ref|ZP_06154517.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161718|gb|EEZ40214.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 243

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +     S D  +++  V+RM+ G  I+LF+G + E+ + I+   K 
Sbjct: 1   MRIPRIYHPESLPSQGSVMLSDDAANHVGRVMRMQAGQEIMLFDGSNAEFPAIITNASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  Q    + +S +         +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVEVEIQQRVECSIESPLNIHLGQVVSRGEKMEFTIQKSVELGVNTITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE          ++        S N
Sbjct: 121 GERFDKKLAQWQKIAIAACEQSGRNVVPEIRPIMKLEDWCAEEFSGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        + +V +LIGPEGG  S+E +   +  F   + LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVTDVRLLIGPEGGLSSDEIDMTENYNFDE-ILLGPRVLRTETAAMTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|126175723|ref|YP_001051872.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS155]
 gi|152999348|ref|YP_001365029.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella baltica OS185]
 gi|304411141|ref|ZP_07392756.1| protein of unknown function DUF558 [Shewanella baltica OS183]
 gi|307306436|ref|ZP_07586179.1| protein of unknown function DUF558 [Shewanella baltica BA175]
 gi|125998928|gb|ABN63003.1| protein of unknown function DUF558 [Shewanella baltica OS155]
 gi|151363966|gb|ABS06966.1| protein of unknown function DUF558 [Shewanella baltica OS185]
 gi|304350334|gb|EFM14737.1| protein of unknown function DUF558 [Shewanella baltica OS183]
 gi|306910727|gb|EFN41155.1| protein of unknown function DUF558 [Shewanella baltica BA175]
          Length = 243

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAINQQLNLDEDGAAHIGKVLRMGNGEHISLFNGDGHDYLAEIVDAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQ     +P + P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLAH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|237749444|ref|ZP_04579924.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380806|gb|EEO30897.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 242

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 120/243 (49%), Gaps = 13/243 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLF DFPL + T      +   ++  VLR+ EG+ I+LFNG+ GE+ ++I  + ++  
Sbjct: 1   MTRLFCDFPLVVGTNIDLPKETSRHI-QVLRLTEGNEIVLFNGEGGEYSARIISLDRTKT 59

Query: 67  FKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                    R      D+    +  +  ++D++I+K+VE+G   I+P+  + +       
Sbjct: 60  NVKILSRHDREVELPYDITLAQALPEAGKMDWIIEKAVELGAAGIQPLAAQRSVVRLNAD 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +T   +A+EQC   TL  I  P      + N     +++F      + +  
Sbjct: 120 RAEKRLARWQTIVTAASEQCGRNTLMEISEPVAFNTFIDNSGGCLRVMFTPRATETLSGW 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  A      + I+IGPEGG+  EE+E       V PLS+G RILR++TA +AA++ + 
Sbjct: 180 ARKQA---PQAITIMIGPEGGFSPEEEELAIQNG-VIPLSMGSRILRTETAGMAAISAIN 235

Query: 239 AIC 241
           AI 
Sbjct: 236 AIW 238


>gi|315127638|ref|YP_004069641.1| hypothetical protein PSM_A2576 [Pseudoalteromonas sp. SM9913]
 gi|315016152|gb|ADT69490.1| hypothetical protein PSM_A2576 [Pseudoalteromonas sp. SM9913]
          Length = 244

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             +  ++   P+ + T      D   ++  VLRMK G+ + +FNG+ GE+LS+I  V K 
Sbjct: 1   MRVPHIYQSSPIALNTPLNLDDDAAGHVGRVLRMKVGEQVSMFNGEGGEFLSEIIEVSKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E+          +       + +++D+ IQKSVE+G+  I P+ ++       
Sbjct: 61  TVVVMPLEFNPHDVESPLKIHLGQCVSRGDKMDFTIQKSVELGITEITPIFSQRCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+AAEQ     +P I PP  L+  L+      ++        S  
Sbjct: 121 GDRLEKKHQQWQKIAIAAAEQSGRNFVPIINPPVDLKHWLEQQTDAIKLTLHPRAEHSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           ++           V  L+GPEGG+  +E        FV  + LGPR+LR++TAA+  ++ 
Sbjct: 181 TITV-----PDGGVRFLVGPEGGFTDDEMAQTKQQEFV-DIRLGPRVLRTETAALTVLSA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLQFGD 241


>gi|172056822|ref|YP_001813282.1| hypothetical protein Exig_0784 [Exiguobacterium sibiricum 255-15]
 gi|171989343|gb|ACB60265.1| protein of unknown function DUF558 [Exiguobacterium sibiricum
           255-15]
          Length = 248

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 103/245 (42%), Gaps = 11/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV+           S D  H++ +V+RM  GD IL+ +G             ++  
Sbjct: 1   MQRYFVEQTARAGNTFTLSKDDAHHIKNVMRMDVGDEILVLDGTGLFRCRLEQLDKQTAV 60

Query: 67  FK-VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPVITRYTQN 119
            + +E           V   ++  K ++++ + QK+ E+G        + R V     + 
Sbjct: 61  AELLEELPIETELPIHVTIAYALPKGDKVELVAQKATELGVSRLLVFESARSVSKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS---EN 176
               ++R++  +  AAEQ     LP I   T  E L    D+   ++  +E+        
Sbjct: 121 IPKKLERLQKISKEAAEQSYRAHLPTIEYVTYDEVLQCAADYTACLIAYEESAKEGEAAA 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L  +    ++ ++IGPEGG    E   L +  FV P SLG RILR++TA +  ++ 
Sbjct: 181 FASTLSRLQSGDSLLVVIGPEGGLTETEVTRLTAGGFV-PASLGRRILRTETAPLYVLSA 239

Query: 237 VQAIC 241
           V    
Sbjct: 240 VSYHF 244


>gi|307308472|ref|ZP_07588176.1| protein of unknown function DUF558 [Sinorhizobium meliloti BL225C]
 gi|307319035|ref|ZP_07598466.1| protein of unknown function DUF558 [Sinorhizobium meliloti AK83]
 gi|306895449|gb|EFN26204.1| protein of unknown function DUF558 [Sinorhizobium meliloti AK83]
 gi|306901075|gb|EFN31683.1| protein of unknown function DUF558 [Sinorhizobium meliloti BL225C]
          Length = 245

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 148/226 (65%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLF++ PL    + +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++I+ 
Sbjct: 1   MRANFRMQRLFIENPLHAGAKHEATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEIAM 60

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +     V   Q+R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              +++RVR   I AAEQC +L +P +  P  LE LL +W  + +IVF DE   S+N L 
Sbjct: 121 KIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGNDSQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L  IA    +A+LIGPEGG+   E++ L S  FVT + LGPRILR
Sbjct: 181 ILEGIAE-RRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILR 225


>gi|301154799|emb|CBW14262.1| predicted protein [Haemophilus parainfluenzae T3T1]
          Length = 244

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  ++  + S D  +++  VLRM EG+ I LF+G +  + +KI    K 
Sbjct: 1   MRIPRIYHPKSLKNQSTCQLSEDAANHVGRVLRMTEGEQIELFDGSNHIYPAKIIEASKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  AVKVEILGCELSDKESNLSIHLGQVISRGDRMEFTIQKSVELGVNVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 121 GERMDKKIQQWQKIAIAACEQCGRNVVPEIRPLMKLQDWCAENDGALKLNLHPRAQYSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  +        V +LIG EGG   +E        F T + LG R+LR++TA++AA++ 
Sbjct: 181 TLPSIPK----EGVRLLIGSEGGLSPQEIAQTEQQGF-TEILLGKRVLRTETASLAAISA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQICFGD 242


>gi|229163256|ref|ZP_04291211.1| RNA methyltransferase, RsmE [Bacillus cereus R309803]
 gi|228620319|gb|EEK77190.1| RNA methyltransferase, RsmE [Bacillus cereus R309803]
          Length = 249

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 103/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSVGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL   +     + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSNEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEIAMLREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|23010926|ref|ZP_00051451.1| COG1385: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 250

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 106/240 (44%), Positives = 140/240 (58%), Gaps = 4/240 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSIR 66
            RLFV+  L           Q +YL  VLR  E D +LLFNG+DGEW ++I     KS  
Sbjct: 9   PRLFVESDLAEGLILPLERAQANYLLTVLRRSETDPVLLFNGRDGEWRAEIVPQGRKSAD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            +V  ++R Q    D+ Y+F+P+KT RLDYM QK+VEMG G IRPV TR+TQ     ++R
Sbjct: 69  LRVVTRTRPQPAPPDLHYLFAPLKTGRLDYMAQKAVEMGAGLIRPVFTRFTQGERIKLER 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   + AAEQC IL++P I  P  L   L        +VF DE     + +  L A A 
Sbjct: 129 LRANAVEAAEQCGILSIPEIAEPARLPACLDALAPERLLVFCDEDAPVSDPVAALRAAAD 188

Query: 187 IPNVA---ILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
             +     +L+GPEGG+H EE+  + + P    LSLGPRILR+DTAAVA + LVQA+ GD
Sbjct: 189 PAHPPPLAVLVGPEGGFHEEERALIAARPNTVALSLGPRILRADTAAVAVLTLVQAVLGD 248


>gi|323498678|ref|ZP_08103669.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio sinaloensis DSM
           21326]
 gi|323316278|gb|EGA69298.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio sinaloensis DSM
           21326]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S D   ++  VLRMKEG  +LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPDAITQLGSLMLSDDAAGHIGRVLRMKEGQQVLLFDGSGSEFPATISSVSKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVEVEVTERIERSAESPLDLHLGQVVSRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     M + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 QKRFEKKMAQWQKIAISACEQCGRNTVPEIRPIMQLEDWCGEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVERVRLLIGPEGGLSAEEISMTEKYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|310643066|ref|YP_003947824.1| protein [Paenibacillus polymyxa SC2]
 gi|309248016|gb|ADO57583.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 254

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 105/251 (41%), Gaps = 15/251 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+     ++     +G+   ++A V+R + GD I++ +G   E L+ +  + +   
Sbjct: 1   MQRYFIPAEQFLEDHVIVTGEDARHIAKVMRGRSGDKIIVSDGVSREALAALDTIEQDHV 60

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E    +      +    S  K ++++ ++QK  E+G     P ++  T   +   
Sbjct: 61  KATIIEPLEMTSEPYVQITIAQSLPKGDKMETVMQKCTEIGATGFVPFLSERTVVQYDAK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R R     AAEQ     +P +  P T + LL ++     I +  E        
Sbjct: 121 KEGKRLERWRKIVKEAAEQSHRNRIPEVSAPLTWKELLASFAGYDLICYCYEKEQGRQLR 180

Query: 179 EKLHAIA------HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           + +   A        P V +++GPEGG+   E              LG RILR++TA + 
Sbjct: 181 DVIQPFAGHWASTDKPRVLVVVGPEGGFTEAESLEAEQAG-AQSTGLGRRILRAETAGMV 239

Query: 233 AMALVQAICGD 243
           A+A +    G+
Sbjct: 240 ALACILYETGE 250


>gi|260767459|ref|ZP_05876396.1| ribosomal RNA small subunit methyltransferase E [Vibrio furnissii
           CIP 102972]
 gi|260617571|gb|EEX42753.1| ribosomal RNA small subunit methyltransferase E [Vibrio furnissii
           CIP 102972]
 gi|315181239|gb|ADT88153.1| hypothetical protein vfu_A03045 [Vibrio furnissii NCTC 11218]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+        S D   ++A VLRM+EG  +L+F+G   E+ + I   GK 
Sbjct: 1   MRVPRIYHPHPITHLGPLALSDDAAGHIARVLRMQEGQEVLVFDGSGAEFPAIIHEAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E    +     ++       + +++++ IQKSVE+G+  I P+++        
Sbjct: 61  QVVVDLAERIDTNLESPLNLHLGQVISRGDKMEFTIQKSVELGVNTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  TLE          ++        S N
Sbjct: 121 AKRFEKKLQQWQKIAISACEQCGRNVVPDIRPIMTLEAWCAEQTDALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  +EE +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVTKVRLLIGPEGGLSAEEIDMTQQYHFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|332162804|ref|YP_004299381.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318604355|emb|CBY25853.1| ribosomal RNA small subunit methyltransferase E [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325667034|gb|ADZ43678.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330858994|emb|CBX69352.1| ribosomal RNA small subunit methyltransferase E [Yersinia
           enterocolitica W22703]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I  V K 
Sbjct: 1   MRIPRIYHPQPLQANTELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIIRVDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NLIVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVDVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     L       D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCTEQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PSSLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|254360572|ref|ZP_04976721.1| hypothetical protein MHA_0127 [Mannheimia haemolytica PHL213]
 gi|153091112|gb|EDN73117.1| hypothetical protein MHA_0127 [Mannheimia haemolytica PHL213]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 109/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL        S D  +++  VLRMK+G+ I+LF+G +  + + +  V K 
Sbjct: 1   MRIPRIYQPQPLAGLQSCVLSEDAANHVGRVLRMKQGEQIILFDGSNHVFHATLQAVEKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAKIDSSELDDRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +        V +LIG EGG  +EE     S  F T + LG R+LR++TA++AA+  
Sbjct: 181 ELPNVPK----AGVRLLIGSEGGLSAEEIAMTESEGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|293607138|ref|ZP_06689480.1| 16S rRNA methyltransferase RsmE [Achromobacter piechaudii ATCC
           43553]
 gi|292814472|gb|EFF73611.1| 16S rRNA methyltransferase RsmE [Achromobacter piechaudii ATCC
           43553]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 114/241 (47%), Gaps = 10/241 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R F D PL    +        H+   VLR+K G++++LFNG+ GE+ + +   GK+   
Sbjct: 4   PRFFCDIPLSAGARIALPDALAHHALRVLRLKAGESVVLFNGQGGEYPAVLDVDGKAGYA 63

Query: 68  KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
           ++ ++ +R       +  +      +++D++++K+VE+G   + P+  + +         
Sbjct: 64  QLGDFSAREAELAGRITLVQGLPSGDKMDWVVEKAVELGASRVSPIAAQRSVLQLSGPRL 123

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +   +    SAAEQC    L  +  P +L   L       +++   E    E+   K
Sbjct: 124 DKRVAHWQRIAQSAAEQCGRNRLMAVDAPRSLADWLAEPAEGLRLLCHPEAG--EDLAGK 181

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           L A   +  + +L+GPEGG+  +E E       V  +  GPR+LR++TA +A ++ V A+
Sbjct: 182 LRAAPGLTALTLLVGPEGGWSDKELELARQAG-VQAVRFGPRVLRTETAGLALVSAVSAL 240

Query: 241 C 241
            
Sbjct: 241 L 241


>gi|311695817|gb|ADP98690.1| ribosomal RNA small subunit methyltransferase E [marine bacterium
           HP15]
          Length = 244

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 117/247 (47%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ +  L   +  +   +   ++  VLRM+ G  +LLFNG   ++ + IS   K 
Sbjct: 1   MRIPRIYTNSALAQGSTAELDDNAAQHVGRVLRMQAGQELLLFNGDGNDYPATISSASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                     + T +S ++ +      K +R+DY +QK+VEMG+  I P+ T        
Sbjct: 61  NVEVQVGTPEANTTESPLEIVLGQTLSKGDRMDYAVQKAVEMGVTRIVPLTTERCDVKLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   ++  ISAAEQC    +P I P  T+   L++       +          
Sbjct: 121 GDREDKRLRHWQSVAISAAEQCGRARVPEILPVMTVSEWLEHSRDCEVRLVL-----HHR 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +   L +I     VA++IGPEGG   EE        F+ P++LGPR+LR++TA VAAMAL
Sbjct: 176 TEHALKSIIPPERVALMIGPEGGLSPEEIAHAEKEGFL-PVALGPRVLRTETAPVAAMAL 234

Query: 237 VQAICGD 243
            Q + GD
Sbjct: 235 CQWLWGD 241


>gi|237747297|ref|ZP_04577777.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378648|gb|EEO28739.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 122/243 (50%), Gaps = 13/243 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RLF DFPL +        D   ++  V+R+  G+ I LFNG+ GE+ ++I   G++  
Sbjct: 1   MTRLFCDFPLAVGACLDLPKDTARHIM-VVRLSRGEAITLFNGQGGEYRARILETGRNRV 59

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               V +         ++  +    +  ++D++I+K+ E+G+  I P+ T+ +       
Sbjct: 60  RAEIVSFSPHEVELPYEISLVQGIPEAGKMDWIIEKAAELGVHRIVPLATQRSVVRVNAD 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R ++  +SA+EQC    L  I  P   +  L+N     +I+F+        SL
Sbjct: 120 RIEKRLARWQSIVVSASEQCGRNRLLAIGQPVNFDAYLQNSPEPSKIMFSPRASH---SL 176

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      +++LIGPEGG+ +EE+E       VT LS+GPRILR++TA +AA++ + 
Sbjct: 177 ASWATGQKPHAISLLIGPEGGFSAEEEELARQKG-VTFLSMGPRILRTETAGLAAVSAIN 235

Query: 239 AIC 241
           AI 
Sbjct: 236 AIW 238


>gi|170740484|ref|YP_001769139.1| hypothetical protein M446_2244 [Methylobacterium sp. 4-46]
 gi|168194758|gb|ACA16705.1| protein of unknown function DUF558 [Methylobacterium sp. 4-46]
          Length = 265

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 102/249 (40%), Positives = 139/249 (55%), Gaps = 13/249 (5%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIR 66
            RLF+D P+           Q +YL  VLR  EGD +L+FNG+DGEW ++I     K+  
Sbjct: 9   PRLFLDVPMAEGVVHGLDRAQANYLLGVLRRGEGDGVLVFNGRDGEWWAEIRPTGRKAGD 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             +  ++R QT+  D+ Y+F+P+K  RLDY+ QK+VEMG   IRPVITR TQ     +DR
Sbjct: 69  LVLRRRTRPQTEPGDLHYLFAPLKAARLDYVAQKAVEMGASLIRPVITRRTQGDRIKLDR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI-- 184
           +R   + AAEQC IL +P I     L   L   + +  +VF DE     + +  L     
Sbjct: 129 LRANAVEAAEQCGILAIPEIAEAAPLTEALAALEADRLLVFCDEDAPVRDPVAALRQGVA 188

Query: 185 ----------AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                          +A++IGPEGG+  EE+  +   P    LSLGPRILR+DTAAVA +
Sbjct: 189 RPPAGAGRGGNVPLPLAVVIGPEGGFTPEERALILERPTTIRLSLGPRILRADTAAVAVL 248

Query: 235 ALVQAICGD 243
           ALVQA+ GD
Sbjct: 249 ALVQAVLGD 257


>gi|117921881|ref|YP_871073.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. ANA-3]
 gi|117614213|gb|ABK49667.1| protein of unknown function DUF558 [Shewanella sp. ANA-3]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGDGNDYLAEIVDAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVTVKVLSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLT 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P + P   L+          ++          N
Sbjct: 121 GERLEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQQWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLSH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|220936059|ref|YP_002514958.1| protein of unknown function DUF558 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997369|gb|ACL73971.1| protein of unknown function DUF558 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 244

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 116/247 (46%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               RL+++  L +    +     + ++  VLR++ G  ++LFNG+ GE+ + ++   K 
Sbjct: 1   MRTTRLYLNQSLSVGDTIELDERAHRHVVQVLRLRPGAELVLFNGQGGEYRATLTEAQKR 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                   +  R       V  +    K +R+DY +QK+ E+G+  I+PV+T+ +Q    
Sbjct: 61  HSSVSLTGFDPRDTRPALPVTLVQGISKGDRMDYSLQKATELGVSRIQPVLTQRSQAPGD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  ++  R   ISA EQC    LP +    + +  L +   +   +  D    +  
Sbjct: 121 PRRLDNRLEHWRGVVISACEQCGRNELPELGGVISFQAWLGSEPDSGLGLVLDPRAETGL 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S            V++LIGPEGG    E        F TP+ LGPRILR++TA VAA+A+
Sbjct: 181 SGLV----PPEGEVSLLIGPEGGLDEAEILAARHRGF-TPVRLGPRILRTETAGVAALAV 235

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 236 IQGLWGD 242


>gi|229594326|ref|YP_001499059.2| 16S ribosomal RNA methyltransferase RsmE [Rickettsia massiliae
           MTU5]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 138/244 (56%), Gaps = 8/244 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK +    R++++  L   ++ + + D  HY+  VLR+K  D + LFNG DGE+L++I+ 
Sbjct: 1   MKYN----RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQIND 56

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           +GK+    +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR  Q 
Sbjct: 57  IGKNNLSVRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRRCQF 116

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N++R+    I A EQ + LT P I    T++  LK   +N  +++A+E    +NS+ 
Sbjct: 117 RSVNIERLTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEDNSIL 174

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           ++ +     ++ I++GPEGG+ ++E E L S      +SLG  ILR++TAA+ A+  V+ 
Sbjct: 175 RISSSLSNSDITIIVGPEGGFTNDELELLASYKNTKSISLGRNILRAETAAITAIVQVR- 233

Query: 240 ICGD 243
           + G 
Sbjct: 234 LLGR 237


>gi|237808014|ref|YP_002892454.1| hypothetical protein Tola_1251 [Tolumonas auensis DSM 9187]
 gi|237500275|gb|ACQ92868.1| protein of unknown function DUF558 [Tolumonas auensis DSM 9187]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ + PL +        D  +++  VLRM     I LFNG+ G++ + I+  GK 
Sbjct: 1   MRVPRIYQNSPLNVGASVSLDDDAANHVGRVLRMVPDQEICLFNGQGGQYQAVITESGKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   + + S      +       + +++++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKITDFSAHSVESPLSIHLGQVISRGDKMEFTIQKSVELGVNVITPLWSSRCGVKLQ 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +++ +   ISA EQC   ++P I P  +LE  L       ++        S  
Sbjct: 121 GDRLDKKLEQWQKIAISACEQCGRNSVPLIRPVMSLENWLAEPTDELKLTLHPRAQYSVG 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +         V ++IGPEGG   +E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PTHGVRLVIGPEGGLSDDEIALTEQYNFQEML-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQCRFGD 241


>gi|240850045|ref|YP_002971438.1| hypothetical protein Bgr_04270 [Bartonella grahamii as4aup]
 gi|240267168|gb|ACS50756.1| hypothetical protein Bgr_04270 [Bartonella grahamii as4aup]
          Length = 247

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 108/226 (47%), Positives = 137/226 (60%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  ILLFNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQTLALNEEIKIEGAQASYLVHVLRMKEGAEILLFNGQDGEWLAKLII 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K     ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGVSILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL  WD    + F DE   S N L 
Sbjct: 121 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLARWDETQPLFFCDEEHKSHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
                       ILIGPEGG+  EE+  L   PFV P+SLGPRILR
Sbjct: 181 SFKKRDVTTP-GILIGPEGGFSEEERSFLKKHPFVVPISLGPRILR 225


>gi|254421059|ref|ZP_05034783.1| conserved hypothetical protein TIGR00046, putative [Brevundimonas
           sp. BAL3]
 gi|196187236|gb|EDX82212.1| conserved hypothetical protein TIGR00046, putative [Brevundimonas
           sp. BAL3]
          Length = 298

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 97/284 (34%), Positives = 138/284 (48%), Gaps = 46/284 (16%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           + RL V  PL        + DQ  YL  V+R+K GD +L+FNG+DGEW   ++ V  K +
Sbjct: 13  MIRLHVPSPLAAAAAVAPTLDQSRYLTQVMRLKVGDELLVFNGRDGEWRCTVAEVLKKGV 72

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             + E Q+R QT   D++ I + +K  R++ +++K+ E+G   +R V+T+ T      +D
Sbjct: 73  ILRAEEQARPQTYGPDLELIVAVVKKARVETIVEKAAELGARRVRLVLTKRTNADRIRLD 132

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+      AAEQ   L +P +  P  L+ LL  W+   +++F DET G+           
Sbjct: 133 RLDAIAEEAAEQTGRLDVPPVDDPVKLDALLDEWEAGRRLMFCDETGGAPAMRALAPYSP 192

Query: 186 HI---------------------------------------------PNVAILIGPEGGY 200
                                                          P  +ILIGPEGG+
Sbjct: 193 SPLRGGALARSDDGVGRAEQPDALPGPAHPASAAPSPPSPDGEGEGQPKWSILIGPEGGF 252

Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             EE E L SLPF T +SLGPRILR+DTAA+AAM L QA  GDW
Sbjct: 253 SPEEGERLRSLPFTTAVSLGPRILRADTAAIAAMTLWQAAVGDW 296


>gi|238787363|ref|ZP_04631162.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           frederiksenii ATCC 33641]
 gi|238724625|gb|EEQ16266.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           frederiksenii ATCC 33641]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I  V K 
Sbjct: 1   MRIPRIYHPQPLQANTELTLSDEAANHVGRVLRMGEGQSLQLFDGSNQVFAAEIIRVDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  NLTVRLAEGQPEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   T+P I     L       D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNTVPEIREAMQLSDWCAEQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      A +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PASLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|268593084|ref|ZP_06127305.1| 16S rRNA methyltransferase RsmE [Providencia rettgeri DSM 1131]
 gi|291311353|gb|EFE51806.1| 16S rRNA methyltransferase RsmE [Providencia rettgeri DSM 1131]
          Length = 243

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLQINTTISLGDDAANHVGRVLRMTAGQKLELFDGSNQTFSAEITEATKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
             F      Q   +    D+       +  ++++ IQKSVE+G+  I P+++        
Sbjct: 61  NVFVHIENSQIDDRESPLDLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I+A EQC    +P I P  TLE      D   ++        S N
Sbjct: 121 GERLEKKLLQWQKIAIAACEQCGRNRIPEIRPVQTLEAWCTENDGAFKVNLHPRATESIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PTELKKVRLLIGPEGGLSADEIAMTANYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRLGD 241


>gi|156932614|ref|YP_001436530.1| hypothetical protein ESA_00396 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530868|gb|ABU75694.1| hypothetical protein ESA_00396 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 111/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL +  +     D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 1   MSMRIPRIYHPEPLVVGREIALDEDAANHVGRVLRMSAGQALQLFDGSNHVFAAEITQAS 60

Query: 63  KSIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       V  +  ++     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 61  KKSVLVNVVSREEANRESPLFLHLGQVMSRGEKMEFTIQKSIELGVSVITPLFSERCGVK 120

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 121 LDEERLNKKLQQWQKIAIAACEQCGRNVVPEIRPAMELEAWCAEPDSGLKLNLHPRAAHS 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 181 INTL-----PQPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 234

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 235 TALQVRFGD 243


>gi|212638681|ref|YP_002315201.1| hypothetical protein Aflv_0838 [Anoxybacillus flavithermus WK1]
 gi|212560161|gb|ACJ33216.1| Uncharacterized protein conserved in bacteria [Anoxybacillus
           flavithermus WK1]
          Length = 252

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 91/247 (36%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L+R FV     +      SGD  H++  V+RM EGD +L  N +    L +I  +     
Sbjct: 4   LQRYFVRNEQIVGDHVMISGDDVHHIGRVMRMNEGDRLLCCNERSETMLCEIEQISNDFV 63

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                Q      +  V    +        Y +               +   R ++    +
Sbjct: 64  RCRIIQWIEANVELPVHVYVASGLLKGDKYELVLQKGTELGAKGFLPLITSRSIVKWDEK 123

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----GS 174
                ++R +     AAEQ     +P +Y P T+  L+           A E        
Sbjct: 124 KGDKKVERWQKIVKEAAEQSHRAYMPSVYAPMTIRELIAWAHDIHYKCIAYEEEAKEGHH 183

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            +    L  +    ++ I+ GPEGG   +E   L    FV   SLGPRILR++TA + A+
Sbjct: 184 RSFAHLLQTMNKEDSLLIVFGPEGGLSEQEVALLKEHGFV-ACSLGPRILRAETAPLYAL 242

Query: 235 ALVQAIC 241
           + V    
Sbjct: 243 SAVSYEW 249


>gi|33152802|ref|NP_874155.1| hypothetical protein HD1793 [Haemophilus ducreyi 35000HP]
 gi|33149026|gb|AAP96544.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 243

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 115/247 (46%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL  +T    S D  +++  VLRM  G+ I+LF+G +  + + +  V K 
Sbjct: 1   MRIPRIYHPEPLKNQTSCSLSEDATNHIGRVLRMNVGEKIILFDGSNHIFHAVLETVQKK 60

Query: 65  I-RFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
             + K+ + +   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIQVKILHSELDDRESNLPIHLGQVISRGDRMEFTIQKSVELGVKIITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC+   +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCERNQVPQIRPIMKLTDWCKEQDEMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L ++        V +LIG EGG  +EE     +  F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPQIP----TAGVRLLIGSEGGLSAEEIAMTENQGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|23099420|ref|NP_692886.1| hypothetical protein OB1965 [Oceanobacillus iheyensis HTE831]
 gi|22777649|dbj|BAC13921.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 255

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/249 (22%), Positives = 103/249 (41%), Gaps = 15/249 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           ++R FV      +   +  GD  H++  V+R + G+ ++  +      L+ I  +     
Sbjct: 1   MQRYFVSQENVTENSIRIIGDDVHHIQRVMRAQVGEKLICVSDNGRAALTYIIKLSDDYV 60

Query: 66  RFKVE-YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-------T 117
             ++E +   S      V       K ++ D ++QK  E+G  A  P             
Sbjct: 61  DVEIEKWLEESNELPVSVTIAQGIPKGDKFDLILQKGTELGADAFIPFQAERSVALWNDE 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----- 172
           +  H  + R +     A+EQ     +P ++    L+ +L         +FA E       
Sbjct: 121 KKYHKKVKRFQKILKEASEQSHRNRIPSLHSVMNLKQILDEASAYTVKLFAYEEEAKTEK 180

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
            S N +  L  I     + + IGPEGG+  +E + L    F+ P+ LG RILR++TAA+ 
Sbjct: 181 MSSNLVNTLQNILSHDKIILCIGPEGGFSIKEADQLRENGFI-PIRLGKRILRTETAALY 239

Query: 233 AMALVQAIC 241
           A++ +    
Sbjct: 240 ALSSISYQL 248


>gi|113969034|ref|YP_732827.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. MR-4]
 gi|113883718|gb|ABI37770.1| protein of unknown function DUF558 [Shewanella sp. MR-4]
          Length = 243

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGDGNDYLAEIVDAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVTVKVLSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLT 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P + P   L+          ++          N
Sbjct: 121 GERLEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQEWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLSH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|158521743|ref|YP_001529613.1| hypothetical protein Dole_1732 [Desulfococcus oleovorans Hxd3]
 gi|158510569|gb|ABW67536.1| protein of unknown function DUF558 [Desulfococcus oleovorans Hxd3]
          Length = 245

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/245 (28%), Positives = 109/245 (44%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+D           +G   +++ +VLRMK GD I LFNG   E+   I  V     
Sbjct: 1   MRRFFIDAAAAAGAICPITGPDANHIKNVLRMKPGDAIWLFNGAGMEFKGVIHSVDSEAV 60

Query: 67  FKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
                   S +      +    + +K  ++D +++++ E+G+    PV T+ T       
Sbjct: 61  TVEITGAFSCATESPIRLTLAQAFLKDKKMDALVRQATELGVTRWIPVFTQRTIPRPDAR 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                M+R +     + +QC    LP I PP   E LL   D     +   +      + 
Sbjct: 121 RVSSRMERWQAIAAESLKQCGRGRLPEIEPPILFEDLLSRSDDWSLKIIFADAKAPGLND 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                 A +  V ++IGPEGG+  EE +      F+   SLGPRIL++DTA V A A+VQ
Sbjct: 181 TLPSQEATVRRVLVMIGPEGGFTPEEIDRAIKKGFI-AASLGPRILKADTATVGACAIVQ 239

Query: 239 AICGD 243
            + GD
Sbjct: 240 HLLGD 244


>gi|118590628|ref|ZP_01548029.1| hypothetical protein SIAM614_05658 [Stappia aggregata IAM 12614]
 gi|118436604|gb|EAV43244.1| hypothetical protein SIAM614_05658 [Stappia aggregata IAM 12614]
          Length = 252

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 96/233 (41%), Positives = 145/233 (62%), Gaps = 6/233 (2%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           K   +++RLF+   L    + +A   Q +YL +VLR+K+GD +L+FNG DGEWL+KI   
Sbjct: 3   KYEFNMQRLFLRHILADGARIEADRSQANYLLNVLRLKDGDYVLVFNGTDGEWLAKIVSN 62

Query: 62  -GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
             +    ++  ++R QT  +D+ Y+F+P+K  RLDYM+QK+VEMG G+++PV+T++TQ +
Sbjct: 63  GRRDCTLQLMERTREQTSANDLMYMFAPLKHARLDYMVQKAVEMGAGSLKPVLTQHTQAS 122

Query: 121 HYNMDRVRTYTISAAEQCDILTLPF---IYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
             N++R+    I AAEQC +L +P      P   +  +        +++F DE  G+ N 
Sbjct: 123 RINLERMEANVIEAAEQCGVLAVPEVLAPQPLADVLSVWAEAQPGRRLLFCDEAEGTNNP 182

Query: 178 LEKLHAIAHI--PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDT 228
           L  L  +       +AILIGPEGG+  EE+  L SL FVTP+ LGPRILR+DT
Sbjct: 183 LLSLAQMKENGPQPLAILIGPEGGFSEEERSLLRSLDFVTPIPLGPRILRADT 235


>gi|114048821|ref|YP_739371.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. MR-7]
 gi|113890263|gb|ABI44314.1| protein of unknown function DUF558 [Shewanella sp. MR-7]
          Length = 243

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL +  Q     D   ++  VLRM  G++I LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAVNQQLNLDEDGAAHIGKVLRMGSGEHISLFNGNGNDYLAEIVDAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVTVKVLSCEANPSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLT 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P + P   L+          ++          N
Sbjct: 121 GERLEKKIQQWQKIVISACEQSGRSQVPIVRPAMELQEWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLSH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|323527358|ref|YP_004229511.1| hypothetical protein BC1001_3037 [Burkholderia sp. CCGE1001]
 gi|323384360|gb|ADX56451.1| protein of unknown function DUF558 [Burkholderia sp. CCGE1001]
          Length = 246

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/248 (22%), Positives = 106/248 (42%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV  PL      +   D   ++  VLR++ GD+I+LFNG+ GE+ +++  + +   
Sbjct: 1   MPRFFVGTPLSPDDIVQLPDDVVRHVL-VLRLQTGDSIVLFNGEGGEYSAELVAIERRAV 59

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E++         +         +++D++I+K+VE+G  +  P+ T  +      +
Sbjct: 60  TVKIREFRDIEVEPPYRLTLAQGIASGDKMDWLIEKAVELGASSFVPLTTTRSVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFL--LKNWDHNCQIVFADETCGSEN 176
                         ++ EQC    LP + P   +               +    +  +  
Sbjct: 120 RALRRHAHWEGIVRASCEQCGRNRLPEVMPVREIATWLGAMPRVPAGDELRILLSPRASI 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L A      V +L+GPEGG+ + E+       F   + LGPR+LR++TA +A ++ 
Sbjct: 180 HFSALPASPPKGPVTVLVGPEGGFSAAEEAAAMDHGF-QAVGLGPRVLRTETAGIAVLSA 238

Query: 237 VQAICGDW 244
           + A  G W
Sbjct: 239 LAATWGGW 246


>gi|259909605|ref|YP_002649961.1| hypothetical protein EpC_29800 [Erwinia pyrifoliae Ep1/96]
 gi|224965227|emb|CAX56759.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
 gi|310766488|gb|ADP11438.1| conserved uncharacterized protein [Erwinia sp. Ejp617]
          Length = 243

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL        S +  H++  VLRM  G  + LF+G    + ++I    K 
Sbjct: 1   MRIPRIYQPEPLQTGNDIALSEEAAHHVGRVLRMGTGQMLELFDGTGLVFAAEIIQADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   SR  +++S +         +  ++++ IQK+VE+G+  I P+ +        
Sbjct: 61  NVCVKINASREDSRESPLHLHLGQVMSRGEKMEFTIQKAVELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P +     L+      +   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAIAACEQCGRNGIPEVRNAMALDAWCAEPEPGLKLNLHPRAKHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEITMTAQHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|294501300|ref|YP_003565000.1| ribosomal RNA small subunit methyltransferase E [Bacillus
           megaterium QM B1551]
 gi|294351237|gb|ADE71566.1| ribosomal RNA small subunit methyltransferase E [Bacillus
           megaterium QM B1551]
          Length = 250

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 103/246 (41%), Gaps = 13/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+      +     + D  H+++ V+RM EG   +  N +    L KI  +  +  
Sbjct: 1   MQRYFLPNDQFQEQSVIVTQDDAHHISRVMRMNEGSQFIACNEQGQAALCKIENISANEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVI------TRYTQ 118
               +E+ S  +     V  +    K ++L+ +IQK  E+G     P I          +
Sbjct: 61  KASIIEWISEEKELPVHVTIVNGLPKGDKLELIIQKGTELGAYKFIPFIAARSVVKWDDK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
            +   +DR       AAEQ     +P +  P + + L++        V A E    +   
Sbjct: 121 KSQKKLDRWNKIAKEAAEQSHRTIVPAVEAPISFKKLVEISGDYTHKVVAYEERAKQGET 180

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            +    L A+    +V +++GPEGG   +E E L    F      GPRILR++TA + A+
Sbjct: 181 SHLHAVLSALKPGNSVLVVVGPEGGLTEQEVEVLEENEFTIS-GFGPRILRAETAPLYAL 239

Query: 235 ALVQAI 240
           + +   
Sbjct: 240 SAISYQ 245


>gi|293390908|ref|ZP_06635242.1| 16S rRNA methyltransferase RsmE [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951442|gb|EFE01561.1| 16S rRNA methyltransferase RsmE [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 244

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 112/247 (45%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T    S D  +++  VLRM+ GD + LF+G +  + + I+ V K 
Sbjct: 1   MRVPRIYHPIPLNQHTTCALSEDGANHVGRVLRMRAGDQLELFDGSNHIYQAVITAVTKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  Q  ++     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVEVDILNRQFDNRESHLTIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 121 GERMEKKIQQWQKIAIAACEQCGRNKIPEIRPLMKLQQWCAERDEALKLNLHPRASYSIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L ++ A      V +LIG EGG   +E        FV  + LG R+LR++TAA+AA+ +
Sbjct: 181 TLPEIPA----AGVRLLIGSEGGLSPQEIAQTEQQGFVE-VLLGKRVLRTETAAIAAITV 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|325983172|ref|YP_004295574.1| ribosomal RNA small subunit methyltransferase E [Nitrosomonas sp.
           AL212]
 gi|325532691|gb|ADZ27412.1| Ribosomal RNA small subunit methyltransferase E [Nitrosomonas sp.
           AL212]
          Length = 248

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 122/249 (48%), Gaps = 12/249 (4%)

Query: 7   LK-RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           +  R +    +      + S +  H+   VLR+K G+ I +FNG  GE+ + I  + KS 
Sbjct: 1   MHARFYHPEEITPGKIIELSAENKHHATRVLRLKNGNPITIFNGLGGEFSAHIEAISKSS 60

Query: 66  RFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT--- 120
              +        ++S   ++   +     ++D++IQKSVE+G+  I+PV T  +      
Sbjct: 61  ATVLIDAYHHTDRESPLSIELAQAICINEKMDWIIQKSVELGITRIQPVFTARSIVHLSD 120

Query: 121 ---HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFL--LKNWDHNCQIVFADETCGSE 175
              +  +   +   ISA EQC    LP + P   L      K   H    V    +  + 
Sbjct: 121 ERSYKRLQHWKKIIISACEQCGRNCLPQVLPLIPLAEWLSQKKTSHCANDVHLMLSTRTT 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N L+ +   A   N+ ++IGPEGG+ +EE+  +    F+ PL LG RILR+++AA+A +A
Sbjct: 181 NGLKNISKPAADANITLVIGPEGGFTAEEETAISYSGFI-PLRLGKRILRTESAALATIA 239

Query: 236 LVQAICGDW 244
            +QA+ GD+
Sbjct: 240 AMQALWGDY 248


>gi|119773713|ref|YP_926453.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella amazonensis
           SB2B]
 gi|119766213|gb|ABL98783.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 243

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F    L    +     D + ++  VLRM EG+ I +FNG   ++L+ I   GK 
Sbjct: 1   MRIPRIFQPLDLSPSAEFALDEDGFAHVGRVLRMGEGEQIRVFNGDGKDYLADIVSAGKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 V  +         +       + +R+D+ +QKSVE+G+  I P+ +        
Sbjct: 61  SLTVKVVAVEDNQSESPLHLHLGQVISRGDRMDFTLQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P + P   L           ++          N
Sbjct: 121 GERLDKKIAQWQKIVISACEQCGRATVPVVRPVMDLAEWCAEQTSALKLNLHPRADHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L         P V +LIGPEGG  +EE     +  F T + LGPR+LR++TAA+ A+  
Sbjct: 181 GLVL-----DNPRVRLLIGPEGGLSAEEIAMTETHKF-TEVLLGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQMKFGD 241


>gi|300118699|ref|ZP_07056427.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus cereus SJ1]
 gi|298723948|gb|EFI64662.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus cereus SJ1]
          Length = 249

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSVGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      +       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFMTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|238763255|ref|ZP_04624220.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           kristensenii ATCC 33638]
 gi|238698528|gb|EEP91280.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           kristensenii ATCC 33638]
          Length = 243

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I  V K 
Sbjct: 1   MRIPRIYHPQPLQANTELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIIRVDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  NLIVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVDVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     L         + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLADWCAEQGDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PSSLSKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|27382634|ref|NP_774163.1| 16S ribosomal RNA methyltransferase RsmE [Bradyrhizobium japonicum
           USDA 110]
 gi|27355806|dbj|BAC52788.1| blr7523 [Bradyrhizobium japonicum USDA 110]
          Length = 252

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               RLFVD PL    +     DQ +YL +VLR+  G  +L FNG+DGEW + I    + 
Sbjct: 7   FRAPRLFVDAPLAQDARVPLDRDQSNYLGNVLRLAAGAEVLAFNGRDGEWQAAIEGRKRP 66

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +  Q+R Q + +D+ Y+F+P+K  RLDYM+QK++EMG   ++PV+TR+TQ +  N 
Sbjct: 67  DGLVILQQTRPQDRLADLTYVFAPLKHARLDYMVQKAIEMGAAGLQPVLTRFTQASRVNT 126

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH-A 183
           +R+R   + A+EQC IL++  +  P  LE  L        ++F DE    EN ++ L  A
Sbjct: 127 ERMRANVVEASEQCGILSIATVAEPVPLERFLSQRAAGRLLIFCDEAAEVENPVQSLQGA 186

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
                 + +LIGPEGG+  EE+  L   P +  L+LGPRI+R+DTAAVAA+ALVQ + GD
Sbjct: 187 REAGQGIDVLIGPEGGFAEEERALLLRQPKILRLALGPRIMRADTAAVAALALVQTVLGD 246

Query: 244 W 244
           W
Sbjct: 247 W 247


>gi|150390795|ref|YP_001320844.1| hypothetical protein Amet_3045 [Alkaliphilus metalliredigens QYMF]
 gi|149950657|gb|ABR49185.1| protein of unknown function DUF558 [Alkaliphilus metalliredigens
           QYMF]
          Length = 254

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 113/251 (45%), Gaps = 15/251 (5%)

Query: 7   LKRLFVDFPLCIKT--QGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + R FV      +        GD   ++  VLR+  GD + + +G+  E++ +I  + K 
Sbjct: 1   MNRFFVVPSQVNQQARTISIVGDDVKHIGKVLRLVVGDLVEVCDGQALEYIGRIDEISKE 60

Query: 65  IRFKVEYQSRSQTKQSDVQ--YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
                  +  +   +  +Q        K  +++ +IQK+ EMG+  I PV+T  T     
Sbjct: 61  QVTLSIEKQENIFTEPPIQVRLYQGIPKATKMELIIQKTTEMGISDIIPVMTDRTIVQFN 120

Query: 123 -------NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS- 174
                   ++R +     A++Q     +P I+ P T    L+  + N   V A E   + 
Sbjct: 121 NEKDREKKVERWQKIADEASKQSKRGKIPRIHIPMTYTKALEACNENDLNVLAYEKEKTM 180

Query: 175 --ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
             +  +  L  I  + ++ I IGPEGG+  +E E   S   V  ++LGPRILR++TA  A
Sbjct: 181 GLKALIASLVEITEVKSIGIWIGPEGGFTGKEIEKALSHD-VRSITLGPRILRTETAGFA 239

Query: 233 AMALVQAICGD 243
            ++++    GD
Sbjct: 240 VLSMLMYELGD 250


>gi|56421036|ref|YP_148354.1| 16S ribosomal RNA methyltransferase RsmE [Geobacillus kaustophilus
           HTA426]
 gi|56380878|dbj|BAD76786.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 258

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 91/247 (36%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV            SGD  +++A V+RMK GD I+         + +I  +     
Sbjct: 1   MQRYFVSGQAQQGGIVAISGDDAYHIARVMRMKPGDGIICVFPDGRTAVCEIEQIANEHV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                Q + +  +  V+   +        + +                 A R V+    +
Sbjct: 61  QARIVQWKEERSELPVRIYIAQGLPKGEKWELVIQKGTELGAAGFLPFEAARSVVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE----TCGS 174
                ++R +     AAEQ +   +P +  P +   LL         +FA E        
Sbjct: 121 KAEKKVERWKKIAKEAAEQAERTVVPDVRAPLSFVELLSFGQTVDVRLFAYEKEARNARH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  +     +  + GPEGG+  EE E L    F +P SLGPRILR++TA +  +
Sbjct: 181 AALPALLSRLRPGGALLAVFGPEGGFSPEEAEQLRQHGF-SPCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           +      
Sbjct: 240 SAASYEW 246


>gi|294142457|ref|YP_003558435.1| hypothetical protein SVI_3686 [Shewanella violacea DSS12]
 gi|293328926|dbj|BAJ03657.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 242

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ D PL +        +   ++  VLRM +G+ I LFNG + ++L++I    K 
Sbjct: 1   MRIPRIYQDSPLAVGDTLALHDEAASHIGRVLRMSQGEQISLFNGSEHDYLAEIISASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S   + +S +         + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NVSVKILSSSINSSESPLHIHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I A EQ     +P I P  +LE        + ++           
Sbjct: 121 GERLEKKIHQWQKIVIGACEQSGRSRVPEIRPAMSLEAWCGEQTDSLKLNLHPRASHGIQ 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L        +P V +LIGPEGG    E        F T + LGPR+LR++TAA+ A++ 
Sbjct: 181 GLSL-----DVPKVRLLIGPEGGLSETEILKTEQDKF-TDILLGPRVLRTETAALTAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|241203235|ref|YP_002974331.1| 16S ribosomal RNA methyltransferase RsmE [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857125|gb|ACS54792.1| protein of unknown function DUF558 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 245

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 99/226 (43%), Positives = 143/226 (63%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RLFVD PL      +A+ DQ++YLA+VLRM++G  ILLFNG+DGEW +    
Sbjct: 1   MRANFRMQRLFVDAPLTRGAGVEANADQFNYLANVLRMEDGGEILLFNGRDGEWKATLTF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I      ++R Q +  D+ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   I AAEQC IL +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KVTNLDKLRANVIEAAEQCGILGIPDVAEPVRLLDLLDRWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLSAIRERH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|85711779|ref|ZP_01042835.1| hypothetical protein OS145_07806 [Idiomarina baltica OS145]
 gi|85694394|gb|EAQ32336.1| hypothetical protein OS145_07806 [Idiomarina baltica OS145]
          Length = 249

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 107/247 (43%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F   PL + +    S D + +   VLRM+EG  + LF   D  + + ++ V K 
Sbjct: 1   MRVPRIFHPEPLTVNSTVSLSDDAFQHTIKVLRMQEGQALELFCNDDFNYAAVLTSVAKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q  S      V       + +R+D+ +QKSVE+G+ AI P+ +        
Sbjct: 61  SAQVEITGAQLNSTESPLFVHLGQVVSRGDRMDFALQKSVELGVNAITPLFSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   ISA EQ     +P + P   ++  +K      ++           
Sbjct: 121 GDRLEKKQQQWQKIVISACEQSGRSHVPIVLPAILVDDFVKTPFDGLRLTLDPYA---RV 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L ++        + ++IGPEGG+   E E      F  P+ LGPRILR++TAA+ A+A 
Sbjct: 178 PLNQIEGANLAQRIQLMIGPEGGFTDIEVEHARHHHF-KPIRLGPRILRTETAAMTALAA 236

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 237 IQYEFGD 243


>gi|86356450|ref|YP_468342.1| hypothetical protein RHE_CH00804 [Rhizobium etli CFN 42]
 gi|86280552|gb|ABC89615.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 245

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 140/226 (61%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-IS 59
           M+ +  ++RLFV  PL      +A+ DQ++YLA+VLRM++G  ILLFNG+DGEW +    
Sbjct: 1   MRANFRMQRLFVYAPLSAGAAVEANADQFNYLANVLRMEDGAEILLFNGRDGEWKATLSF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I       +R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PTRKRILLTAIEATRPQPAPCDLHYLFAPLKVGRLDYLVQKAVEMGAGRLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D++R   + AAEQC +L +P +  P  L  LL  W    +I++ DE    +N L 
Sbjct: 121 KITNLDKLRANVVEAAEQCGVLAIPEVAEPVKLSDLLDRWPSERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 VLAAIQERH-LALLVGPEGGFSEEERARLRSLDFVTAIPLGPRILR 225


>gi|308069954|ref|YP_003871559.1| hypothetical protein PPE_03203 [Paenibacillus polymyxa E681]
 gi|305859233|gb|ADM71021.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 254

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 107/251 (42%), Gaps = 15/251 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+     ++     +G+   ++A V+R + GD I++ +G   E L  +  + +   
Sbjct: 1   MQRYFIPAEQFLEDHVIVAGEDARHIAKVMRGRSGDKIIVSDGVSREALVALDTIEQDHV 60

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E    +      V    S  K ++++ ++QK  E+G     P ++  T   +   
Sbjct: 61  TATIIEPLKMTSEPYVQVTIAQSLPKGDKMETVMQKCTEIGATGFVPFLSERTVVQYDAK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R R     AAEQ     +P I  P T + LL ++     I +  E    +   
Sbjct: 121 KEGKRLERWRKIVKEAAEQSHRNRIPEISAPMTWKELLASFAGYDLICYCYEKEQGKQLR 180

Query: 179 EKLH------AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           + +       A   +P V +++GPEGG+   E              LG RILR++TA +A
Sbjct: 181 DVIQPLAEQWASTDMPRVLLVVGPEGGFTEAESLEAEQAG-AQSTGLGRRILRAETAGMA 239

Query: 233 AMALVQAICGD 243
           A+A +    G+
Sbjct: 240 ALACILYETGE 250


>gi|123443620|ref|YP_001007592.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090581|emb|CAL13450.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 243

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   ++   S +  +++  VLRM EG ++ LF+G +  + ++I  V K 
Sbjct: 1   MRIPRIYHPQPLQANSELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIIRVDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  NLIVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVDVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     L       D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCAAQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PSSLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|119475424|ref|ZP_01615777.1| hypothetical protein GP2143_16431 [marine gamma proteobacterium
           HTCC2143]
 gi|119451627|gb|EAW32860.1| hypothetical protein GP2143_16431 [marine gamma proteobacterium
           HTCC2143]
          Length = 241

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 109/247 (44%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L      +      H+L+ VLR+K G +++LFNG   ++   I+ +GK 
Sbjct: 1   MRISRIYTQATLQASQSVELEEKPSHHLSKVLRLKVGSDVILFNGDGYDYSGHINAIGKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    + +       +    +  K +R+D++IQKS E+G+  I P++T  T     
Sbjct: 61  SVGIYIDSREIKHSESSLKIHLGVAVSKGDRMDWIIQKSTELGVDEITPLLTERTELKLK 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQ     LP I     L   ++  +   + V    +     
Sbjct: 121 GDRKEKKQHHWQQIAISACEQSGRAQLPSINRIQHLSEWIQTIEATRKFVLHHRSTA--- 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L++   + +  +LIGPEGG   +E        F   L LGPRILR++TA +AA+++
Sbjct: 178 ---LLNSNDDVSSACLLIGPEGGLSEDEIALAEHYHF-DALQLGPRILRTETAPLAAISI 233

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 234 LQHHWGD 240


>gi|206969964|ref|ZP_03230918.1| RNA methyltransferase, RsmE family [Bacillus cereus AH1134]
 gi|228954597|ref|ZP_04116621.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229071816|ref|ZP_04205030.1| RNA methyltransferase, RsmE [Bacillus cereus F65185]
 gi|229081573|ref|ZP_04214070.1| RNA methyltransferase, RsmE [Bacillus cereus Rock4-2]
 gi|229180588|ref|ZP_04307930.1| RNA methyltransferase, RsmE [Bacillus cereus 172560W]
 gi|229192522|ref|ZP_04319484.1| RNA methyltransferase, RsmE [Bacillus cereus ATCC 10876]
 gi|206735652|gb|EDZ52820.1| RNA methyltransferase, RsmE family [Bacillus cereus AH1134]
 gi|228590946|gb|EEK48803.1| RNA methyltransferase, RsmE [Bacillus cereus ATCC 10876]
 gi|228603012|gb|EEK60491.1| RNA methyltransferase, RsmE [Bacillus cereus 172560W]
 gi|228701729|gb|EEL54218.1| RNA methyltransferase, RsmE [Bacillus cereus Rock4-2]
 gi|228711295|gb|EEL63256.1| RNA methyltransferase, RsmE [Bacillus cereus F65185]
 gi|228805043|gb|EEM51638.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|229086882|ref|ZP_04219041.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-44]
 gi|228696392|gb|EEL49218.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-44]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+         +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNDASIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAMCTIDEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  STIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPDVHAPASFKQLLAMSSDYDVCLVAYEEEAKQGEKA 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  + H   + I+ GPEGG   +E   L    F+ P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTLEHGQKLLIVFGPEGGLSEDEISALREYKFL-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|260599273|ref|YP_003211844.1| ribosomal RNA small subunit methyltransferase E [Cronobacter
           turicensis z3032]
 gi|260218450|emb|CBA33577.1| Ribosomal RNA small subunit methyltransferase E [Cronobacter
           turicensis z3032]
          Length = 243

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL + ++     D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLVVGSEIALDEDAANHVGRVLRMSAGQALQLFDGSNQVFAAEITQANKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 V  +  ++     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVLVNVVSAEEANRESPLFLHLGQVMSRGEKMEFTIQKSIELGVSVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 EERLNKKLQQWQKIAIAACEQCGRNVVPEIRPAMDLEAWCAEPDTGLKLNLHPRAAHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|228923064|ref|ZP_04086356.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836562|gb|EEM81911.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TTIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|330501385|ref|YP_004378254.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas mendocina
           NK-01]
 gi|328915671|gb|AEB56502.1| 16S ribosomal RNA methyltransferase RsmE [Pseudomonas mendocina
           NK-01]
          Length = 239

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 108/247 (43%), Gaps = 17/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +    +    Q HY+  VLR   GD + LF+G   E+L ++  VGK 
Sbjct: 1   MRLSRFFIDAPLSLGQH-ELPEAQAHYIGRVLRHAVGDAVQLFDGSGQEYLGELIEVGKK 59

Query: 65  IRFKVEYQSRS--QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +S +        +       +  R+D+ IQK+ E+G   I P+++   +    
Sbjct: 60  SVRVELRESIAGLAESPLRIHLGQGLSRGERMDWAIQKATELGASEITPIVSTRCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  M   R   ISA EQC    LP I+ P  L+  L+  + + ++V          
Sbjct: 120 DERADKRMAHWRQVAISACEQCGRSVLPLIHAPLELDAWLQQIEADLKLVLHPVAEPWV- 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                   A    +A LIGPEGG    E +      F     LGPR+LR++TA V A+++
Sbjct: 179 ------GHAPPRALAFLIGPEGGLSDAEVDQAKGAGF-HAARLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGD 243
            Q + GD
Sbjct: 232 AQQLWGD 238


>gi|229129591|ref|ZP_04258560.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-Cer4]
 gi|229152513|ref|ZP_04280704.1| RNA methyltransferase, RsmE [Bacillus cereus m1550]
 gi|228630944|gb|EEK87582.1| RNA methyltransferase, RsmE [Bacillus cereus m1550]
 gi|228653859|gb|EEL09728.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-Cer4]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDTCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|291522746|emb|CBK81039.1| RNA methyltransferase, RsmE family [Coprococcus catus GD/7]
          Length = 246

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV            +G   +++ +VLRM  G+ + + +G+  ++  +I+ + K   
Sbjct: 1   MPRFFVGAEQISDKDIVITGTDVNHIRNVLRMTPGEEVTVSDGQGMDYFCRIAELTKEEV 60

Query: 67  FKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
                 S        + +       K ++++ +IQK+VE+G+  I PV T+        +
Sbjct: 61  RLDIVDSWHSFVELPTKIYLFQGLPKADKMELIIQKAVELGVYEIVPVATKRAVVKLDPK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                  R ++   SAA+Q     +P I    + E  L+  +     +   E   G +++
Sbjct: 121 KEEKKRLRWQSIAESAAKQAGRALIPQIATCISFEKALRMCNGLDAALIPYEKAEGMQHA 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            +++ A+    ++ I IGPEGG+   E E   +   + P++LG RILR++TA +  ++++
Sbjct: 181 RDQVRALHGKHSIGIFIGPEGGFEESEIEAARAAGAI-PITLGHRILRTETAGLTMLSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MFEL 243


>gi|323704198|ref|ZP_08115777.1| protein of unknown function DUF558 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536264|gb|EGB26036.1| protein of unknown function DUF558 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 248

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 111/247 (44%), Gaps = 8/247 (3%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S ++RLF+          +  GD  H++  VLR++ G ++++ NG      S +S    
Sbjct: 1   MSAVRRLFIKDEDIKDGIVRIYGDDAHHIKDVLRLRIGTDLVVSNGVKQYNASILSIEST 60

Query: 64  SIRFKVEYQSRSQTKQ-SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH- 121
           S+  K+  +     +   +V       K++++D ++QK  E+G+  I PV T ++     
Sbjct: 61  SVLLKIVDELHQVVESSINVTLFQGLPKSDKMDLIVQKCTEIGIKKIVPVETEFSIIKVK 120

Query: 122 -----YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  ++R    +  A++Q   L +P +  P +    +   +     V   E   +  
Sbjct: 121 EKSIGNKINRWNKISQEASKQSGRLIVPEVLEPISFTIAVNYINEFDLCVMPYERETNVR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             + L       N+ I IGPEGG+   E +T      V  ++LGPRILR++TA + A ++
Sbjct: 181 LKDVLKENNGAKNICIFIGPEGGFSHSEVDTATKNGAV-IVTLGPRILRTETAGIVAGSI 239

Query: 237 VQAICGD 243
           +    GD
Sbjct: 240 ILYELGD 246


>gi|229198439|ref|ZP_04325143.1| RNA methyltransferase, RsmE [Bacillus cereus m1293]
 gi|228584942|gb|EEK43056.1| RNA methyltransferase, RsmE [Bacillus cereus m1293]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIH 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVETSSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHTPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|218233104|ref|YP_002369120.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus cereus B4264]
 gi|228960579|ref|ZP_04122227.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229051300|ref|ZP_04194818.1| RNA methyltransferase, RsmE [Bacillus cereus AH676]
 gi|229111784|ref|ZP_04241331.1| RNA methyltransferase, RsmE [Bacillus cereus Rock1-15]
 gi|229148158|ref|ZP_04276464.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST24]
 gi|296504805|ref|YP_003666505.1| surface protein [Bacillus thuringiensis BMB171]
 gi|218161061|gb|ACK61053.1| RNA methyltransferase, RsmE family [Bacillus cereus B4264]
 gi|228635298|gb|EEK91822.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST24]
 gi|228671658|gb|EEL26955.1| RNA methyltransferase, RsmE [Bacillus cereus Rock1-15]
 gi|228722058|gb|EEL73485.1| RNA methyltransferase, RsmE [Bacillus cereus AH676]
 gi|228799092|gb|EEM46061.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|296325857|gb|ADH08785.1| surface protein [Bacillus thuringiensis BMB171]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDACLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|217961801|ref|YP_002340371.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus cereus AH187]
 gi|228987562|ref|ZP_04147680.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229141049|ref|ZP_04269591.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST26]
 gi|217064535|gb|ACJ78785.1| RNA methyltransferase, RsmE family [Bacillus cereus AH187]
 gi|228642327|gb|EEK98616.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST26]
 gi|228772160|gb|EEM20608.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 249

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVETSSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|223042063|ref|ZP_03612239.1| hypothetical protein AM202_0654 [Actinobacillus minor 202]
 gi|223017138|gb|EEF15574.1| hypothetical protein AM202_0654 [Actinobacillus minor 202]
          Length = 243

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 107/247 (43%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL  KT    S D  +++  VLRM  G+ I LF+G +  + + +  V K 
Sbjct: 1   MRIPRIYHPEPLIGKTTCILSEDATNHVGRVLRMTAGEQITLFDGSNHVFHATLQAVEKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAEITSSELDDRESPLSIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  + A      V +LIG EGG   EE        F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPNMPA----AGVRLLIGSEGGLSPEEIAMTEKEGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|317405816|gb|EFV86104.1| hypothetical protein HMPREF0005_02771 [Achromobacter xylosoxidans
           C54]
          Length = 243

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 109/242 (45%), Gaps = 10/242 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R F D PL    +        H+   VLR++ G+ ++LFNG+ GE+ + +   GK+   
Sbjct: 4   PRFFCDAPLSAGARIALPEALAHHAIRVLRLRAGEPMVLFNGQGGEYPAVLEIEGKAGFA 63

Query: 68  KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
           ++  +  R       +  +      +++D++++K+VE+G   + P+  + +         
Sbjct: 64  QLGAFDPREAELAGRITLVQGLPAGDKMDWVVEKAVELGAAHVCPIAAQRSVLQLAGPRL 123

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +   +    SAAEQC    L  +  P  L   L       +++   +     +   +
Sbjct: 124 EKRVAHWQRIAQSAAEQCGRNRLMAVDAPMALADWLAQPADGLRLLCHPDA--DADLAGR 181

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           L A   + ++ +L+GPEGG+  +E         V  +  GPR+LR++TA +A ++   A+
Sbjct: 182 LGATPGLQSLTLLVGPEGGWSDKELALAREAG-VQAVRFGPRVLRTETAGLALISAAGAL 240

Query: 241 CG 242
            G
Sbjct: 241 LG 242


>gi|209886372|ref|YP_002290229.1| hypothetical protein OCAR_7260 [Oligotropha carboxidovorans OM5]
 gi|209874568|gb|ACI94364.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 246

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 105/237 (44%), Positives = 145/237 (61%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            RLFVD PL    +   + +Q HYL +VLR+   D +L+FNG+DGEW ++I+   +  + 
Sbjct: 9   PRLFVDAPLGAGREVALAREQGHYLGNVLRLSASDTVLVFNGRDGEWRAQITGRKRLEQL 68

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
               Q+R Q    D+  +F+P+K  RLDYM+QK+VEMG   + P +T++TQ +  N++R+
Sbjct: 69  TPLEQTRPQDPPCDLHLLFAPLKHARLDYMVQKAVEMGASRLTPTLTQFTQVSRINLERM 128

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R   I AAEQC IL LP I  P  L   L   D    +VF DE     + L  L   A+ 
Sbjct: 129 RANAIEAAEQCGILNLPEIDEPLPLTGRLAERDGKRLLVFCDEAAPQASPLAALKEAAND 188

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             + +LIGPEGG+  +E+  L + P +  LSLGPRILR+DTAAVAA+ALVQA  GDW
Sbjct: 189 GGLDVLIGPEGGFSEDERAALLAQPRLVRLSLGPRILRADTAAVAALALVQAALGDW 245


>gi|329851437|ref|ZP_08266194.1| RNA methyltransferase, RsmE family protein [Asticcacaulis
           biprosthecum C19]
 gi|328840283|gb|EGF89855.1| RNA methyltransferase, RsmE family protein [Asticcacaulis
           biprosthecum C19]
          Length = 248

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 87/248 (35%), Positives = 135/248 (54%), Gaps = 11/248 (4%)

Query: 7   LKRLFVDF---PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
           + RLF+     P         + DQ  YLA V+R+   D + +FNG+DGEW +++S V  
Sbjct: 1   MIRLFISETTPPFAEGLSVILNPDQSRYLAAVMRLSVDDTVSIFNGRDGEWGARLSEVGK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           K+++  +  Q+R Q          + IK + L+Y+++K+ E+G G I+ + TR T  +H 
Sbjct: 61  KAVKLDLIEQTRPQPTGQGPILAVALIKRSALEYIVEKATELGAGTIQLLTTRRTNASHT 120

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE------N 176
           N++R+ +    +AEQ + L +P I  P  L+  L     +  I F DE    E       
Sbjct: 121 NVERLVSIAKESAEQTERLDVPEILAPVKLDRFLAAAAFDRLI-FGDENSTHEGTRETLP 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+ L   A +    ILIGPEGG+  +E+  L   P   P++LGPRILR+DTAA++A+ L
Sbjct: 180 LLQALKTTAAVERSVILIGPEGGFDDDERLALRGRPDCIPVNLGPRILRADTAAISALTL 239

Query: 237 VQAICGDW 244
            QA+ GDW
Sbjct: 240 YQAVVGDW 247


>gi|220932114|ref|YP_002509022.1| conserved hypothetical protein TIGR00046 [Halothermothrix orenii H
           168]
 gi|219993424|gb|ACL70027.1| conserved hypothetical protein TIGR00046 [Halothermothrix orenii H
           168]
          Length = 249

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 112/247 (45%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV             G+ Y+++ + LR+  GD +++  G   ++++ I  + ++  
Sbjct: 1   MHRFFVSEEQIRDDLVIIKGNDYNHIVNSLRLNPGDKLIVCPGNCRDYVATIEEIKENQI 60

Query: 67  FKVEYQSRSQTKQS--DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
                +      +   ++    +  K  ++D +IQK+ E+G+ +I P+ T         +
Sbjct: 61  TGKIIKEYKNRNEPSLNITLAQALPKKRKMDLVIQKATEIGVRSIIPLKTTRTIVRLNKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 DR +     AA+Q     +P +    +L+ L +   +   I+   E    +N  
Sbjct: 121 KERKKTDRWQKIAKEAAKQSGRGRIPTVERVYSLKELTQFKSNFDLIIIPWEEEQGKNLK 180

Query: 179 EKLHAIA--HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
             L  +    I  + ++IGPEGG+  EE + +  L  + P++LGPRILR++TA +  + +
Sbjct: 181 NVLSTVNVSEISKILVIIGPEGGFPPEEIKFIEQLGGI-PITLGPRILRTETAGLVVLTM 239

Query: 237 VQAICGD 243
           +    GD
Sbjct: 240 LLYESGD 246


>gi|238795147|ref|ZP_04638737.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           intermedia ATCC 29909]
 gi|238725546|gb|EEQ17110.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           intermedia ATCC 29909]
          Length = 243

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG ++ LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPQPLQANTELALSDEAANHVGRVLRMTEGQSLQLFDGSNQVFAAEIVRSDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  SLLVRLGEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     L       D + ++        S N
Sbjct: 121 GERLAKKLQQWQKIAIAACEQCGRNRIPEIRSAMQLSDWCAEQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        + NV +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PPTLNNVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|228910148|ref|ZP_04073967.1| RNA methyltransferase, RsmE [Bacillus thuringiensis IBL 200]
 gi|228849431|gb|EEM94266.1| RNA methyltransferase, RsmE [Bacillus thuringiensis IBL 200]
          Length = 249

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPDQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|229019535|ref|ZP_04176352.1| RNA methyltransferase, RsmE [Bacillus cereus AH1273]
 gi|229025777|ref|ZP_04182176.1| RNA methyltransferase, RsmE [Bacillus cereus AH1272]
 gi|228735485|gb|EEL86081.1| RNA methyltransferase, RsmE [Bacillus cereus AH1272]
 gi|228741791|gb|EEL91974.1| RNA methyltransferase, RsmE [Bacillus cereus AH1273]
          Length = 249

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T+ +  GD  H++  V+RM  GD+I    NGK  E            
Sbjct: 1   MQRYFVEEKHVSETKIRIVGDDVHHIGRVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P + + LL   +     + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPEVHAPASFKQLLAMSNEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|42783438|ref|NP_980685.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus cereus ATCC
           10987]
 gi|42739367|gb|AAS43293.1| conserved hypothetical protein TIGR00046 [Bacillus cereus ATCC
           10987]
          Length = 249

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|91228680|ref|ZP_01262594.1| hypothetical protein V12G01_13994 [Vibrio alginolyticus 12G01]
 gi|91187751|gb|EAS74069.1| hypothetical protein V12G01_13994 [Vibrio alginolyticus 12G01]
          Length = 243

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R++    +        S D   ++  VLRMKEG ++LLF+G   E+ + IS V K 
Sbjct: 1   MRTPRIYHPETIHQLGSLALSDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISDVSKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E    +     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVLVNITERLENNIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   K      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEEWCKEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|322383638|ref|ZP_08057389.1| 16S ribosomal RNA methyltransferase RsmE-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151850|gb|EFX44793.1| 16S ribosomal RNA methyltransferase RsmE-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 255

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/252 (21%), Positives = 103/252 (40%), Gaps = 16/252 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK--S 64
           ++R F+       T  +  GD  H+L  V+R + G+ I++ +G   E L++I+ V K   
Sbjct: 1   MQRYFIPKEQFGSTSVRIEGDDAHHLVRVMRAQAGNKIIVSDGLSREALAQITEVDKAVV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E +  +   +  V    S  K ++++ +IQK  E+G     P ++  T   +   
Sbjct: 61  TAAIIEERPMTAEPRIQVWVAQSLPKADKMETVIQKGTEIGAARFLPFVSERTVVQYDAK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                  R +     AAEQ     +P +    + + +L+            E   S    
Sbjct: 121 KETKRTQRWQKIAKEAAEQAHRNRIPVVEGVHSWKQILEQAARMDAAWICYEKEDSLQIR 180

Query: 179 EKL-------HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
           + L               + +++GPEGG+  +E E          + LG RILR++TAA+
Sbjct: 181 DALFQADALKRNDDKPVRIMLIVGPEGGFTEKEIEQAEESG-CLSIGLGTRILRTETAAM 239

Query: 232 AAMALVQAICGD 243
             +  +    G+
Sbjct: 240 VGLTCILYETGE 251


>gi|229157925|ref|ZP_04285998.1| RNA methyltransferase, RsmE [Bacillus cereus ATCC 4342]
 gi|228625533|gb|EEK82287.1| RNA methyltransferase, RsmE [Bacillus cereus ATCC 4342]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHTPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|324328215|gb|ADY23475.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIH 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSHEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|240949405|ref|ZP_04753746.1| 16S rRNA m3U1498 methyltransferase [Actinobacillus minor NM305]
 gi|240296154|gb|EER46810.1| 16S rRNA m3U1498 methyltransferase [Actinobacillus minor NM305]
          Length = 243

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL  KT    S D  +++  VLRM  G+ I+LF+G +  + + +  V K 
Sbjct: 1   MRIPRIYHPEPLIGKTTCILSEDATNHVGRVLRMTAGEQIILFDGSNHVFHATLQAVEKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAEITSSELDDRESPLSIHLGQVISRGDRMEFTIQKSVELGVKVITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +     +  V +LIG EGG   EE        F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPNMP----VAGVRLLIGSEGGLSPEEIAMTEKEGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|120597613|ref|YP_962187.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella sp. W3-18-1]
 gi|146294248|ref|YP_001184672.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella putrefaciens
           CN-32]
 gi|120557706|gb|ABM23633.1| protein of unknown function DUF558 [Shewanella sp. W3-18-1]
 gi|145565938|gb|ABP76873.1| protein of unknown function DUF558 [Shewanella putrefaciens CN-32]
          Length = 243

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I        D   ++  VLRM  G+NI LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAINQLLNLDEDGAAHIGKVLRMGNGENISLFNGDGNDYLAEIVDAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQ     +P + P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVVSACEQSGRSQVPVVRPAMDLHDWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLAH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|218899479|ref|YP_002447890.1| RNA methyltransferase, RsmE family [Bacillus cereus G9842]
 gi|218543817|gb|ACK96211.1| RNA methyltransferase, RsmE family [Bacillus cereus G9842]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD I    NGK               
Sbjct: 1   MQRYFVEEKHVSEAKIRIVGDDVHHIARVMRMTAGDQIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEVSSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLTMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|16079598|ref|NP_390422.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221310469|ref|ZP_03592316.1| 16S rRNA m3U1498 methyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314792|ref|ZP_03596597.1| 16S rRNA m3U1498 methyltransferase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319715|ref|ZP_03601009.1| 16S rRNA m3U1498 methyltransferase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323992|ref|ZP_03605286.1| 16S rRNA m3U1498 methyltransferase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|1730989|sp|P54461|RSME_BACSU RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|1303811|dbj|BAA12467.1| YqeU [Bacillus subtilis]
 gi|1890060|dbj|BAA12079.1| YqeU [Bacillus subtilis]
 gi|2634990|emb|CAB14486.1| methylase of U1498 in 16S rRNA [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 256

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 106/249 (42%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +        +G++ H++ +V+RM EGD I+  +    E   ++  V K
Sbjct: 1   MQRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSK 60

Query: 64  SI--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +E+ + ++     V       K ++L+++IQK  E+G  A  P     +    
Sbjct: 61  DKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P +    + + LL+      + V A E    +
Sbjct: 121 DDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESSKQ 180

Query: 176 NSLEKLHAI----AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             +    AI        ++ I+ GPEGG    E E L     VT   LGPRILR++TA +
Sbjct: 181 GEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVT-CGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A++ +   
Sbjct: 240 YALSAISYQ 248


>gi|238798622|ref|ZP_04642097.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           mollaretii ATCC 43969]
 gi|238717508|gb|EEQ09349.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           mollaretii ATCC 43969]
          Length = 243

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG N+ LF+G +  + ++I  V K 
Sbjct: 1   MRIPRIYHPQPLQANTELALSDEAANHVGRVLRMSEGQNLQLFDGSNQVFTAEIIRVDKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  SLVVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   T+P I     L       D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNTIPEIRAAMQLSDWCAEQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG   +E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PPSLNKVRLLIGPEGGLSVDEIAMTSHLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|315924412|ref|ZP_07920634.1| RsmE family RNA methyltransferase [Pseudoramibacter alactolyticus
           ATCC 23263]
 gi|315622291|gb|EFV02250.1| RsmE family RNA methyltransferase [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 245

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/245 (18%), Positives = 93/245 (37%), Gaps = 10/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLS--KISYVGKS 64
           + R FV        Q    G+++ + A  +R+++ +   + +G   ++          + 
Sbjct: 1   MHRFFVKPEQIHGDQIIIDGEEFKHAAKAVRIRDNELFEVCDGSGFDYHCLITCREKEQL 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGA-------IRPVITRYT 117
                E +  +      V       K  ++D ++QK+ E+G+ +                
Sbjct: 61  TAVIQEKRPSAGELPYTVTLFQGLPKGQKMDEIVQKNTELGISSVVPFVSAFCVAKLEEP 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                   R +     AA+Q     +P ++ P   + + +       ++ A E       
Sbjct: 121 DKVARKCGRWQRIAFEAAKQSKRGKIPQVHEPVAFQRMCEIAADFDLVIIAYEHEMDRPL 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              L       N+A+++G EGG+  EE E L +      +SLG RILR++TA +  +A +
Sbjct: 181 QTVLEGRTQYRNIAVIVGSEGGFSREEVERLEAAG-AKSVSLGRRILRTETAGMVLLAQI 239

Query: 238 QAICG 242
               G
Sbjct: 240 NYAFG 244


>gi|206978414|ref|ZP_03239283.1| RNA methyltransferase, RsmE family [Bacillus cereus H3081.97]
 gi|206743370|gb|EDZ54808.1| RNA methyltransferase, RsmE family [Bacillus cereus H3081.97]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVETSSELSVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|163942067|ref|YP_001646951.1| hypothetical protein BcerKBAB4_4162 [Bacillus weihenstephanensis
           KBAB4]
 gi|229135136|ref|ZP_04263937.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST196]
 gi|163864264|gb|ABY45323.1| protein of unknown function DUF558 [Bacillus weihenstephanensis
           KBAB4]
 gi|228648313|gb|EEL04347.1| RNA methyltransferase, RsmE [Bacillus cereus BDRD-ST196]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 68/246 (27%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E            
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TTIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P++ + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|258516359|ref|YP_003192581.1| 16S ribosomal RNA methyltransferase RsmE [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780064|gb|ACV63958.1| protein of unknown function DUF558 [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 257

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 54/248 (21%), Positives = 108/248 (43%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R++V        Q   +G +  ++  VLR+  GD + + +G+ G + ++I+   K   
Sbjct: 1   MTRVYVPPTRIKGRQACITGTEMEHVNRVLRLAAGDEVTIIDGEGGVFSARITGKNKEKV 60

Query: 67  FKVEYQS--RSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
           F                +  +    K++++D ++QK  E+G+  + P+           +
Sbjct: 61  FCEITAEGLPDNEPPVKITLVQGLPKSDKMDLIVQKGTELGLSTLIPLQCERAIVRLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS---E 175
                 +R +   + AA+QC     P +    + + +L++       +   E   +   +
Sbjct: 121 KAAQRQERWQRIAMEAAKQCKRGKHPSVERAMSWQEVLESLPEKALCLLPWEEETARGLK 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           +  + L A      + I IGPEGG+   E         V P+SLGPRILR++TA +A ++
Sbjct: 181 SLRDNLEAKVPPFEIYIFIGPEGGFTRSEAAQARQYG-VIPVSLGPRILRTETAGIAVLS 239

Query: 236 LVQAICGD 243
           ++    GD
Sbjct: 240 IIMYEFGD 247


>gi|239827772|ref|YP_002950396.1| 16S ribosomal RNA methyltransferase RsmE [Geobacillus sp. WCH70]
 gi|239808065|gb|ACS25130.1| protein of unknown function DUF558 [Geobacillus sp. WCH70]
          Length = 249

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 106/247 (42%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV        +    GD YH++  V+RM++G  ++     +   L KI  +     
Sbjct: 1   MQRYFVSDDQVKNDRLIIQGDDYHHIVRVMRMEKGSELICVLPSNKAVLCKIEQITNEHV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPV------ITRYTQ 118
                +   +  +  +Q   +    K ++L+++IQK  E+G  +  P       +    +
Sbjct: 61  IVRVVKWIDEQTELPIQIYIAHGLPKGDKLEFVIQKGTELGASSFIPFVAARSIVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
             +  ++R +     AAEQ     +P ++ P T+  L++        VFA E    + + 
Sbjct: 121 KANKKLERWKKIAKEAAEQSHRGKIPDVHAPMTIHELIEFAKTVDYRVFAYEEEAKQGNH 180

Query: 179 EKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
           + L      +    ++  + GPEGG+  EE E      F    SLGPRILR++TA +  +
Sbjct: 181 QTLAAVFQQMKRGHSLLAVFGPEGGFSDEEVELFKHHGFF-SCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           A+     
Sbjct: 240 AVASYQF 246


>gi|254464533|ref|ZP_05077944.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           Y4I]
 gi|206685441|gb|EDZ45923.1| conserved hypothetical protein TIGR00046 [Rhodobacterales bacterium
           Y4I]
          Length = 221

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 90/221 (40%), Positives = 126/221 (57%), Gaps = 2/221 (0%)

Query: 25  SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RFKVEYQSRSQTKQSDVQ 83
             DQ HYL  V+R+  G  + LFNGKDGEWL++++  GK       + Q++      D+ 
Sbjct: 2   DRDQAHYLFGVMRLAAGAAVALFNGKDGEWLAEVAEAGKRGGTLVCQEQTKPLQLPPDLW 61

Query: 84  YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTL 143
            +F+PIK  R D++++K+ EMG   I PV T +T +     DR++ + + AAEQC    +
Sbjct: 62  LLFAPIKKARTDFIVEKAAEMGAARILPVQTEFTNSERIRQDRLQAHAVEAAEQCGGTYV 121

Query: 144 PFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSE 203
           P +     L  LL  W    Q++F DE     N+L+           AILIGPEGG+   
Sbjct: 122 PEVADSQKLSRLLDQWPRERQLMFCDEAEVG-NALQLAAETQKDVPWAILIGPEGGFSEA 180

Query: 204 EKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
           E++ LH+LP    +SLGPRILR+DTAAVAAM L Q   GDW
Sbjct: 181 ERKRLHALPQSHVVSLGPRILRADTAAVAAMTLWQQALGDW 221


>gi|167622641|ref|YP_001672935.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella halifaxensis
           HAW-EB4]
 gi|167352663|gb|ABZ75276.1| protein of unknown function DUF558 [Shewanella halifaxensis
           HAW-EB4]
          Length = 243

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 103/247 (41%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ +  L I        +   ++  VLRM  G+ + LFNG   ++L++I    K 
Sbjct: 1   MRVPRIYQESSLVIGQAVALDDEAAGHVGRVLRMSVGEQVSLFNGDGNDYLAEIISASKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++ +      +       + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NVEVKVLSCEANNSESPLHLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQ     +P I P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVVSACEQSGRSVVPVIRPAMQLSDWCAEPSDAVKLNLHPRASHGVN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L           V ++IGPEGG  + E        F T + LGPR+LR++TAA+  ++ 
Sbjct: 181 GLTL-----PNNRVRLVIGPEGGLSAPEIAMTEEHQF-TDVLLGPRVLRTETAALTTISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|197284242|ref|YP_002150114.1| hypothetical protein PMI0341 [Proteus mirabilis HI4320]
 gi|227357855|ref|ZP_03842203.1| protein of hypothetical function DUF558 [Proteus mirabilis ATCC
           29906]
 gi|194681729|emb|CAR40885.1| conserved hypothetical protein [Proteus mirabilis HI4320]
 gi|227161965|gb|EEI46983.1| protein of hypothetical function DUF558 [Proteus mirabilis ATCC
           29906]
          Length = 243

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   TQ   + +  +++  VLRM +G  + LF+G +  + + I    K 
Sbjct: 1   MRIPRIYHPEPLSAGTQTSLAEEAANHVGRVLRMSKGQKLALFDGSNQVFDADIIESSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  + +   ++S +         +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVIVQINEGQMDDRESPLDLHLGQVLSRGEKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   ISA EQC    +P + P  +LE      D + ++        S N
Sbjct: 121 PSRLEKKHQQWQKIIISACEQCGRNKIPQLMPVMSLEAWCAQTDDSLKLNLHPRASQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG   EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVKKVRLLIGPEGGLSPEEIAMTAKYHF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|228941478|ref|ZP_04104028.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228967380|ref|ZP_04128414.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228974408|ref|ZP_04134976.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981003|ref|ZP_04141305.1| RNA methyltransferase, RsmE [Bacillus thuringiensis Bt407]
 gi|228778663|gb|EEM26928.1| RNA methyltransferase, RsmE [Bacillus thuringiensis Bt407]
 gi|228785244|gb|EEM33255.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792306|gb|EEM39874.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228818128|gb|EEM64203.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326942094|gb|AEA17990.1| surface protein [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 249

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD I    NGK               
Sbjct: 1   MQRYFVEEKHVSEAKIRIVGDDVHHIARVMRMTAGDQIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLTMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|319427610|gb|ADV55684.1| rRNA base methyltransferase, RsmE [Shewanella putrefaciens 200]
          Length = 243

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I        D   ++  VLRM  G+NI LFNG   ++L++I   GK 
Sbjct: 1   MRVPRIYQPQPLAINQLLNLDEDGAAHIGKVLRMGNGENISLFNGDGNDYLAEIVDAGKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVTVKLLSCEANLSESPLNLHLGQVISRGDRMEFTIQKSVELGVNTITPLFSDRCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   +SA EQ     +P I P   L           ++          N
Sbjct: 121 GERLEKKIQQWQKIVVSACEQSGRSQVPLIRPAMDLHDWCSEPTSALKLNLHPRAAHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+  H       V +LIGPEGG  +EE     +  F T + LGPR+LR++TA++ A+  
Sbjct: 181 GLDLAH-----TRVRLLIGPEGGLSAEEIAMTETYQF-TDVLLGPRVLRTETASLTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLRFGD 241


>gi|229062009|ref|ZP_04199335.1| RNA methyltransferase, RsmE [Bacillus cereus AH603]
 gi|229169059|ref|ZP_04296775.1| RNA methyltransferase, RsmE [Bacillus cereus AH621]
 gi|228614468|gb|EEK71577.1| RNA methyltransferase, RsmE [Bacillus cereus AH621]
 gi|228717318|gb|EEL68991.1| RNA methyltransferase, RsmE [Bacillus cereus AH603]
          Length = 249

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E            
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TTIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P++ + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|15964524|ref|NP_384877.1| hypothetical protein SMc00826 [Sinorhizobium meliloti 1021]
 gi|15073701|emb|CAC45343.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 245

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 96/226 (42%), Positives = 147/226 (65%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLF++  L    + +A+ +Q++YL +VLR+ EG ++L+FNG+DGEW ++I+ 
Sbjct: 1   MRANFRMQRLFIENALHAGAKHEATREQFNYLINVLRLGEGSSLLVFNGRDGEWRAEIAM 60

Query: 61  VGKSIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +     V   Q+R Q    D+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              +++RVR   I AAEQC +L +P +  P  LE LL +W  + +IVF DE   S+N L 
Sbjct: 121 KIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGNDSQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L  IA    +A+LIGPEGG+   E++ L S  FVT + LGPRILR
Sbjct: 181 ILEGIAE-RRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILR 225


>gi|22127196|ref|NP_670619.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis KIM 10]
 gi|45443246|ref|NP_994785.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597516|ref|YP_071707.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806328|ref|YP_650244.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis Antiqua]
 gi|108813291|ref|YP_649058.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis Nepal516]
 gi|145597888|ref|YP_001161964.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis Pestoides
           F]
 gi|149367057|ref|ZP_01889090.1| hypothetical protein YPE_2335 [Yersinia pestis CA88-4125]
 gi|153949952|ref|YP_001399821.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418368|ref|YP_001607686.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis Angola]
 gi|165924866|ref|ZP_02220698.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165937327|ref|ZP_02225891.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010231|ref|ZP_02231129.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212766|ref|ZP_02238801.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399760|ref|ZP_02305278.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421908|ref|ZP_02313661.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167426701|ref|ZP_02318454.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167470902|ref|ZP_02335606.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           FV-1]
 gi|170023088|ref|YP_001719593.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia
           pseudotuberculosis YPIII]
 gi|186896639|ref|YP_001873751.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928106|ref|YP_002345981.1| 16S ribosomal RNA methyltransferase RsmE [Yersinia pestis CO92]
 gi|229837626|ref|ZP_04457788.1| hypothetical protein YPS_1552 [Yersinia pestis Pestoides A]
 gi|229840853|ref|ZP_04461012.1| hypothetical protein YPH_3204 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842587|ref|ZP_04462742.1| hypothetical protein YPF_0928 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229903754|ref|ZP_04518867.1| hypothetical protein YP516_3558 [Yersinia pestis Nepal516]
 gi|270487532|ref|ZP_06204606.1| 16S rRNA methyltransferase RsmE [Yersinia pestis KIM D27]
 gi|294502903|ref|YP_003566965.1| hypothetical protein YPZ3_0793 [Yersinia pestis Z176003]
 gi|21960262|gb|AAM86870.1|AE013933_7 hypothetical protein y3320 [Yersinia pestis KIM 10]
 gi|45438114|gb|AAS63662.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590798|emb|CAH22444.1| Conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108776939|gb|ABG19458.1| hypothetical protein YPN_3131 [Yersinia pestis Nepal516]
 gi|108778241|gb|ABG12299.1| hypothetical protein YPA_0331 [Yersinia pestis Antiqua]
 gi|115346717|emb|CAL19600.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209584|gb|ABP38991.1| hypothetical protein YPDSF_0581 [Yersinia pestis Pestoides F]
 gi|149290671|gb|EDM40747.1| hypothetical protein YPE_2335 [Yersinia pestis CA88-4125]
 gi|152961447|gb|ABS48908.1| ribosomal small subunit methyltransferase RsmE [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351183|gb|ABX85131.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           Angola]
 gi|165914801|gb|EDR33414.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923066|gb|EDR40217.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990717|gb|EDR43018.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206058|gb|EDR50538.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960045|gb|EDR56066.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050468|gb|EDR61876.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167054304|gb|EDR64123.1| ribosomal small subunit methyltransferase RsmE [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169749622|gb|ACA67140.1| protein of unknown function DUF558 [Yersinia pseudotuberculosis
           YPIII]
 gi|186699665|gb|ACC90294.1| protein of unknown function DUF558 [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679524|gb|EEO75627.1| hypothetical protein YP516_3558 [Yersinia pestis Nepal516]
 gi|229690897|gb|EEO82951.1| hypothetical protein YPF_0928 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229697219|gb|EEO87266.1| hypothetical protein YPH_3204 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229704314|gb|EEO91325.1| hypothetical protein YPS_1552 [Yersinia pestis Pestoides A]
 gi|262360938|gb|ACY57659.1| hypothetical protein YPD4_0750 [Yersinia pestis D106004]
 gi|262364878|gb|ACY61435.1| hypothetical protein YPD8_0745 [Yersinia pestis D182038]
 gi|270336036|gb|EFA46813.1| 16S rRNA methyltransferase RsmE [Yersinia pestis KIM D27]
 gi|294353362|gb|ADE63703.1| hypothetical protein YPZ3_0793 [Yersinia pestis Z176003]
 gi|320013984|gb|ADV97555.1| hypothetical protein YPC_0866 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 243

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   + +  +++  VLRM EG ++ LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPQPLQANTELALTDEAANHVGRVLRMTEGQSLQLFDGSNQIFDAEIIRADKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 61  NLIVRLAEGQWEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSARCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   T+P I     L       D + ++        S N
Sbjct: 121 GERLTKKIQQWQKIAIAACEQCGRNTIPEIRDAMQLADWCAESDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      + +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PSSLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|229174986|ref|ZP_04302505.1| RNA methyltransferase, RsmE [Bacillus cereus MM3]
 gi|228608447|gb|EEK65750.1| RNA methyltransferase, RsmE [Bacillus cereus MM3]
          Length = 249

 Score =  145 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAICSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL   +     + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSNEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE  TL    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITTLREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|33595836|ref|NP_883479.1| hypothetical protein BPP1163 [Bordetella parapertussis 12822]
 gi|33600365|ref|NP_887925.1| hypothetical protein BB1379 [Bordetella bronchiseptica RB50]
 gi|33565915|emb|CAE36464.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33567964|emb|CAE31877.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 246

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 105/245 (42%), Gaps = 9/245 (3%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R + D  L    +        H+   VLR++ G  ++LF+G  GE+ + +   GK+
Sbjct: 1   MSLPRFYCDARLAPGERVALPEALAHHAVRVLRLRAGAALVLFDGAGGEYPATLEIEGKA 60

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT--- 120
              ++  +  R       +  +      +++D++++K+VE+G   + P+  + +      
Sbjct: 61  AWAQLGAHVPREAELPGRITLVQGLPAGDKMDWVVEKAVELGAWRVSPIAAQRSVLQLNG 120

Query: 121 ---HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 +   +    +AAEQC    L  +  P  L   L         +         + 
Sbjct: 121 ARAEKRLAHWQRIAQAAAEQCGRNRLMAVDAPQALAAWLAQAPGAALRLLCHPQA-ELDL 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              L   A   ++ +L+GPEGG+  EE E   +   V  +  GPR+LR++TA +A +A V
Sbjct: 180 AGALARHAAHDDICLLVGPEGGWSDEELEQARAAG-VQAVRFGPRVLRTETAGIALIAAV 238

Query: 238 QAICG 242
            AI G
Sbjct: 239 SAIRG 243


>gi|217969920|ref|YP_002355154.1| 16S ribosomal RNA methyltransferase RsmE [Thauera sp. MZ1T]
 gi|217507247|gb|ACK54258.1| protein of unknown function DUF558 [Thauera sp. MZ1T]
          Length = 246

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 113/246 (45%), Gaps = 9/246 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R      L    +        H+   VLR+++G+ ++LF+G  GE  ++++  GK++ 
Sbjct: 2   ISRFHFPDRLPAGGEVALPEALAHHALRVLRLRDGEAVVLFDGSGGEVDARLAVRGKAVF 61

Query: 67  FKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
            ++ E ++  +     +  + +    +++D+++QK+VE+G+ AI+PV    +      + 
Sbjct: 62  ARLGEARAVERESPLRIVLVQALASGDKMDWVVQKAVELGVHAIQPVQAERSVLRLAAER 121

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFAD-ETCGSENSL 178
               +   +   I+A EQC    +P I P   L   L         V A         + 
Sbjct: 122 ADKRVAHWQQVAIAACEQCGRNRVPEIRPLQPLAHWLGAHRAAPGYVLAPGYVLAPGGAK 181

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V +L+GPEGG+   E     +      + LGPR+LR++TA +AA+A +Q
Sbjct: 182 GFADEPEPKDEVHLLVGPEGGWSEGEMAAFDAAG-CRRVRLGPRVLRTETAGLAAVAALQ 240

Query: 239 AICGDW 244
           A  GD+
Sbjct: 241 ARWGDY 246


>gi|300853987|ref|YP_003778971.1| hypothetical protein CLJU_c08010 [Clostridium ljungdahlii DSM
           13528]
 gi|300434102|gb|ADK13869.1| conserved hypothetical protein [Clostridium ljungdahlii DSM 13528]
          Length = 251

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 111/247 (44%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + FV             G+   ++  VLR+K GD I + N    E+L  I  + K   
Sbjct: 1   MNKFFVPQEDINFNTAYIRGEDVKHIRKVLRLKCGDKININNCNGKEFLGAIEKIDKDEV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-----TQN 119
               +E  +     +  +       K+ ++D ++QK+VE+G+  I PV+T          
Sbjct: 61  VVNIIEELTLYNESKIKIYLFQGLPKSGKMDLIVQKAVELGVYEITPVVTSRVVVKNDSG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS---EN 176
               +DR       A +QC    +P +  P + + LL   ++   IV   E   +   + 
Sbjct: 121 EFKKVDRWNKIAKEACKQCKRSIIPKVNVPISFKELLSEGEYMDVIVVPYENESNTGIKK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +  +   +++  +AI+IGPEGG+  +E + L ++      +LGPRILR++TA    ++L
Sbjct: 181 IVNSIKDKSNLEKIAIVIGPEGGFEEQEIDELKNIN-SHIATLGPRILRTETAGFVCISL 239

Query: 237 VQAICGD 243
           +    GD
Sbjct: 240 IMYELGD 246


>gi|269965751|ref|ZP_06179848.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269829619|gb|EEZ83856.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 243

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R++    +        S D   ++  VLRMKEG ++LLF+G   E+ + IS V K 
Sbjct: 1   MRTPRIYHPETIHQLGSLALSDDAAGHIGRVLRMKEGQDVLLFDGSGAEFPAVISDVSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +         + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVLVNITERVESSIESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNVVPEIRPIMSLEEWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  SEE E      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSSEEIEMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|229013531|ref|ZP_04170665.1| RNA methyltransferase, RsmE [Bacillus mycoides DSM 2048]
 gi|228747768|gb|EEL97637.1| RNA methyltransferase, RsmE [Bacillus mycoides DSM 2048]
          Length = 249

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK  E            
Sbjct: 1   MQRYFVEEKYVNETSIRIMGDDVHHIARVMRMSAGDHIYCCVNGKTAECSIAEITSEFVD 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TTIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R++     AAEQ     +P ++ P++ + LL         + A E    +    
Sbjct: 121 ADKKVERLKKIVKEAAEQSHRSEIPEVHVPSSFKQLLSMSSEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  I     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKSLATIKPGQKLLIVFGPEGGLAEEEITALREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|188534950|ref|YP_001908747.1| Conserved hypothetical protein YggJ [Erwinia tasmaniensis Et1/99]
 gi|188029992|emb|CAO97876.1| Conserved hypothetical protein YggJ [Erwinia tasmaniensis Et1/99]
          Length = 243

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL    +   S +  +++  VLRM  G  + LF+G D  + ++I+   K 
Sbjct: 1   MRIPRIYHPAPLDAGNEIALSEEAANHVGRVLRMGPGQRLELFDGTDLTFAAEITQADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 + +R  +++S +         +  ++++ IQK+VE+G+  I P+ +        
Sbjct: 61  NVHVRIHTARDDSRESPLHLHLGQVMSRGEKMEFTIQKAVELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P +    TLE      D   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAIAACEQCGRNRIPEVRQAMTLEAWCAEQDRGLKLNLHPRADHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEISMTARYGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|163803743|ref|ZP_02197601.1| hypothetical protein 1103602000580_AND4_13698 [Vibrio sp. AND4]
 gi|159172462|gb|EDP57330.1| hypothetical protein AND4_13698 [Vibrio sp. AND4]
          Length = 243

 Score =  145 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +          D   ++  VLRMKEG ++LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETIQQLGTIVVREDAASHIGRVLRMKEGQDVLLFDGSGAEFPAVISEVSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +    + +S +   F     + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVLVELSERTENSIESPLDLHFGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   +      ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNIVPEIRPIMSLEAWCQEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG    E +      F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVKKVRLLIGPEGGLSCSEIDMTREYQFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|226942481|ref|YP_002797554.1| 16S ribosomal RNA methyltransferase RsmE [Azotobacter vinelandii
           DJ]
 gi|226717408|gb|ACO76579.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 239

 Score =  145 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 110/248 (44%), Gaps = 17/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R F+D PL +         Q HY+  VLR+  GD + LF+G   E+  ++  VGK 
Sbjct: 1   MRLSRFFIDAPLALGL-LDLPEAQAHYIGRVLRLAPGDAVQLFDGSGREFRGELVEVGKK 59

Query: 65  IRFKVEYQSRS--QTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  +           +       +  R+D+ IQK+ E+G+  I P+++   +    
Sbjct: 60  SVRVELREQLPGLAESPLRIHLGQGLSRGERMDWAIQKATELGVAEITPLLSERCEVRLK 119

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   ISA EQC    LP I+PP  LE  LK  +   ++V          
Sbjct: 120 DERADKRLAHWQQIAISACEQCGRSVLPTIHPPAPLEDWLKGIEAELKLVLHPFAE---- 175

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L + A   ++A LIGPEGG    E +      +     LGPR+LR++TA V A+++
Sbjct: 176 ---PLASHARPASLAFLIGPEGGLSETEVDAARRAGYRAA-RLGPRVLRTETAPVVALSV 231

Query: 237 VQAICGDW 244
            Q + GD+
Sbjct: 232 AQQLWGDF 239


>gi|229031960|ref|ZP_04187946.1| RNA methyltransferase, RsmE [Bacillus cereus AH1271]
 gi|228729350|gb|EEL80341.1| RNA methyltransferase, RsmE [Bacillus cereus AH1271]
          Length = 249

 Score =  145 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 103/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE  TL    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITTLREHKFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|322834233|ref|YP_004214260.1| hypothetical protein Rahaq_3541 [Rahnella sp. Y9602]
 gi|321169434|gb|ADW75133.1| protein of unknown function DUF558 [Rahnella sp. Y9602]
          Length = 243

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   ++   S D  +++  VLRM+ G  I LF+G +  + + I+ V K 
Sbjct: 1   MRIPRIYHPEILTAHSEIALSEDAANHVGRVLRMQPGQAIQLFDGSNQVFEASITQVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  Q      +S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVSVSLNQGVLADNESPLNLHLGQVISRGEKMEFTIQKSIELGVNTITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   LE      D + ++        S N
Sbjct: 121 GERLEKKLQQWQKIAIAACEQCGRNRIPEIRPAMQLEAWCNEQDDSLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        + +V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVSHVRLLIGPEGGLSAEEIAMTSGYGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|321312028|ref|YP_004204315.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus subtilis BSn5]
 gi|320018302|gb|ADV93288.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus subtilis BSn5]
          Length = 256

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 105/249 (42%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +        +G+  H++ +V+RM EGD I+  +    E   ++  V K
Sbjct: 1   MQRYFIELTKQQIEEAPAFSITGEDVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSK 60

Query: 64  SI--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +E+ + ++     V       K ++L+++IQK  E+G  A  P     +    
Sbjct: 61  DKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P +    + + LL+      + V A E    +
Sbjct: 121 DDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESSKQ 180

Query: 176 NSLEKLHAI----AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             +    AI        ++ I+ GPEGG    E E L     V P  LGPRILR++TA +
Sbjct: 181 GEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGV-PCGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A++ +   
Sbjct: 240 YALSAISYQ 248


>gi|260462657|ref|ZP_05810863.1| protein of unknown function DUF558 [Mesorhizobium opportunistum
           WSM2075]
 gi|259031563|gb|EEW32833.1| protein of unknown function DUF558 [Mesorhizobium opportunistum
           WSM2075]
          Length = 273

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 140/226 (61%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS- 59
           M+ +  ++RLFV   L    +  A   Q HYL HVLR+ EG  IL+FNG+DGEW + I+ 
Sbjct: 30  MRANYKMQRLFVPDDLAGDAEFDAGQQQSHYLMHVLRLGEGAEILVFNGRDGEWSAAIAA 89

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              +++R KV    R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 90  KTKRAVRLKVLALQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 149

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      E +L  WD   +++F DE   + N L 
Sbjct: 150 AKPSIDRLRANVVEAAEQCGILAVPEVREAEKFERVLTGWDKGRRLIFCDEDASTNNPLP 209

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     + +L+GPEGG+  EE++ L +LPFV+ + LGPRILR
Sbjct: 210 ALQAIRE-KKLGLLVGPEGGFSDEERKMLRALPFVSAIPLGPRILR 254


>gi|261363907|ref|ZP_05976790.1| 16S rRNA methyltransferase RsmE [Neisseria mucosa ATCC 25996]
 gi|288567910|gb|EFC89470.1| 16S rRNA methyltransferase RsmE [Neisseria mucosa ATCC 25996]
          Length = 241

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 110/246 (44%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L      +   +   +L +VLR++ G+ ++LFNG    + +++      ++
Sbjct: 1   MSRFYLPDALYAGQVVELPDNVVRHL-NVLRVRCGEEVVLFNGNGKAYPARLDVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  +         +  + S     R+D+ +QKSVE+G+ AI+PVI+         +
Sbjct: 60  CAEVLREEETDNESPLKITLVQSVSSGERMDFTLQKSVELGVVAIQPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ     +P + P       LK        +            
Sbjct: 120 RADKRVARWQEIVVSACEQSGRNIVPEVRPLLPYREALKQMSSETTKLLMSLNRAQSLRA 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            K        ++  ++GPEGG+  EE++      F   ++LG R+LR++TA++AA+A +Q
Sbjct: 180 VK----PFSDDLIFMVGPEGGWTDEEEQLAFEAGF-QSVTLGKRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|158320271|ref|YP_001512778.1| hypothetical protein Clos_1236 [Alkaliphilus oremlandii OhILAs]
 gi|158140470|gb|ABW18782.1| protein of unknown function DUF558 [Alkaliphilus oremlandii OhILAs]
          Length = 256

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 59/253 (23%), Positives = 111/253 (43%), Gaps = 17/253 (6%)

Query: 7   LKRLFV--DFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + R FV  +       +     +   +++ VLR+KE D + + +G+  E++  I+ + K+
Sbjct: 1   MHRFFVMPNQVNLTSGEIVIHDEDVKHISKVLRLKEKDIVEICDGESKEYICSIASIHKN 60

Query: 65  IRFKVEYQSRSQTKQ--SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
                  + R  T++   +V       K  ++D +IQK+ E+G+  I PV+   T     
Sbjct: 61  EVVLSIEEERKSTQEASVEVVLYQGVPKGAKMDLIIQKTTELGIKEIIPVMMERTVVQFD 120

Query: 123 -------NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
                   ++R +     AA+Q     +P I+ P + +  +++   N   +   E   + 
Sbjct: 121 SPKDEVKKVERWQKIAEEAAKQSKRGMIPKIHLPMSFKDAIEDSRKNALNIMPYENEENR 180

Query: 176 NSLEKLH-----AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
                +        A I  + + IGPEGG+   E         + P++LGPRILR++TA 
Sbjct: 181 GFKNIIKNLSKEDQASIKKIGVWIGPEGGFEESEVVKAIENG-IHPVTLGPRILRTETAG 239

Query: 231 VAAMALVQAICGD 243
              ++LV    GD
Sbjct: 240 FTMLSLVMYELGD 252


>gi|323493586|ref|ZP_08098707.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio brasiliensis LMG
           20546]
 gi|323312109|gb|EGA65252.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio brasiliensis LMG
           20546]
          Length = 243

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +        S +   ++  VLRMKE   +LLF+G   E+ + IS V K 
Sbjct: 1   MRIPRIYHPETITQLGSLMLSEEAAGHVGRVLRMKEEQQVLLFDGSGAEFPATISEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVEVNVIERIERSSESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC   T+P I P   LE          ++        S N
Sbjct: 121 HKRFEKKLAQWQKIAISACEQCGRNTVPEIRPIMQLEEWCGEEYDGLKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE     +  F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEKVRLLIGPEGGLSAEEISMTENYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|229220771|ref|YP_001783785.2| 16S ribosomal RNA methyltransferase RsmE [Haemophilus somnus 2336]
          Length = 245

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++    L  +   + S D  +++  VLRM+ G+ I LF+G +  +  +   +   
Sbjct: 1   MRIPRIYHPTSLENQQTCQLSDDAANHVGRVLRMQVGEQIELFDGSNHIYPAIITQTNKK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  Q  ++     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  AIEVNILSRQLDNRESPLFIHLGQVISRGERMEFTIQKSVELGVNIITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   ISA EQC    +P I P   L+      D   ++        +  
Sbjct: 121 KDRMEKKIQQWQKIAISACEQCGRNIVPEIRPLMKLQDWCAEQDGTLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L ++        V +LIGPEGG  ++E     +  F T + LG R+LR++T A++A+  
Sbjct: 181 TLPEIP----PQGVRLLIGPEGGLSAQEISQTETQGF-TEILLGKRVLRTETTALSAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|306845979|ref|ZP_07478546.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306273614|gb|EFM55459.1| conserved hypothetical protein [Brucella sp. BO1]
          Length = 242

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 116/239 (48%), Positives = 155/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELQAGVSFDAEAQAAHYLAHVLRMKEGDKVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|238785646|ref|ZP_04629623.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           bercovieri ATCC 43970]
 gi|238713425|gb|EEQ05460.1| Ribosomal RNA small subunit methyltransferase E [Yersinia
           bercovieri ATCC 43970]
          Length = 253

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   ++   S +  +++  VLRM EG ++ LF+G +  + +KI    K 
Sbjct: 11  MRIPRIYHPQPLQANSELALSDEAANHVGRVLRMAEGQSLQLFDGSNQVFDAKIIRADKK 70

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E Q   +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 71  SLVVRLAEGQLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSERCGVKLD 130

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   T+P I     L       D + ++        S N
Sbjct: 131 GERLAKKIQQWQKIAIAACEQCGRNTIPEIRAAMQLADWCAEQDDSLKLNLHPRASNSIN 190

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 191 TL-----PPSLNKVRLLIGPEGGLSADEITMTSRLGF-TDILLGPRVLRTETTALTAITA 244

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 245 LQVRFGD 251


>gi|197303723|ref|ZP_03168760.1| hypothetical protein RUMLAC_02452 [Ruminococcus lactaris ATCC
           29176]
 gi|197297243|gb|EDY31806.1| hypothetical protein RUMLAC_02452 [Ruminococcus lactaris ATCC
           29176]
          Length = 249

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 105/244 (43%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  F D       + +  G   +++ +VLRMKEG+ + + +G    +L +I     +  
Sbjct: 1   MQHFFADRSWVQGDKIRLEGSDVNHMKNVLRMKEGEEVQVSDGTGNAYLCQIEGYEGNQA 60

Query: 67  FKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
                +   +     S +       K ++++ ++QK+VE+G+  I P   +        +
Sbjct: 61  VLKIREKTEKDTELPSKIWLFQGLPKGDKMELIVQKAVELGVYGIVPFAAKRSVVRLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                  R +     AAEQ     +P +    T    L+       I+   E   G + +
Sbjct: 121 KAGKKQIRWQAIAKGAAEQSGRGLIPEVEIVKTYAEALEFAKELDVILVPYELEEGMKAT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +  + AI    +V I IGPEGG+  +E     +   V P++LG RILR++TA +  ++++
Sbjct: 181 MSIIEAIRPGQSVGIFIGPEGGFEEQEIGQARNAGAV-PVTLGRRILRTETAGITTLSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|160940893|ref|ZP_02088233.1| hypothetical protein CLOBOL_05785 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436137|gb|EDP13904.1| hypothetical protein CLOBOL_05785 [Clostridium bolteae ATCC
           BAA-613]
          Length = 249

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/246 (23%), Positives = 116/246 (47%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV+         + +G   +++ +VLR+++G+ +L+ +G   ++L +   +     
Sbjct: 1   MHHFFVNPEQVEDGLIRITGSDVNHIKNVLRIRQGEEMLVSDGTGRDYLCQAEEIAGQEV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITR------YTQ 118
               +E +   +   S +       K+++++++IQK+VE+G   I PV TR        +
Sbjct: 61  TVRILETEEEGRELPSRIWLFQGLPKSDKMEFIIQKAVELGAAGIVPVSTRNTVVKLDPK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKN---WDHNCQIVFADETCGSE 175
                + R +    SAA+Q     +P +    TL+           + +++  +   G +
Sbjct: 121 KEEAKVKRWQAIAESAAKQSKRSLVPRVSGIMTLKEAFDYVESQGFSVRLIPYEHEAGMD 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +  +L A     ++A+ IGPEGG+   E E   S   V P+SLG RILR++TA +A ++
Sbjct: 181 GTKTELDAAGPGQDIAVFIGPEGGFDEREIELALSKG-VRPISLGRRILRTETAGLALLS 239

Query: 236 LVQAIC 241
           ++    
Sbjct: 240 VLMMRL 245


>gi|255065808|ref|ZP_05317663.1| 16S rRNA methyltransferase RsmE [Neisseria sicca ATCC 29256]
 gi|255050126|gb|EET45590.1| 16S rRNA methyltransferase RsmE [Neisseria sicca ATCC 29256]
          Length = 241

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 109/246 (44%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           + R ++   L      +   +   +L +VLR++ G+ ++LFNG    + +++      ++
Sbjct: 1   MSRFYLPDDLYAGQVVELPDNVVRHL-NVLRVRCGEEVVLFNGNGKAYPARLDVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  +         +  + S     R+D+ +QKSVE+G+ AI+PVI+         +
Sbjct: 60  CAEVLREEEADNESPLKITLVQSVSSGERMDFTLQKSVELGVVAIQPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ     +P + P       LK        +            
Sbjct: 120 RADKRVARWQEIVVSACEQSGRNIVPEVRPLLPYREALKQMSSETTKLLMSLNRAQSLRT 179

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            K        ++  ++GPEGG+  EE+       F   ++LG R+LR++TA++AA+A +Q
Sbjct: 180 VK----PFSDDLIFMVGPEGGWTDEEERMAFEAGF-QSVTLGKRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|33592148|ref|NP_879792.1| hypothetical protein BP0998 [Bordetella pertussis Tohama I]
 gi|33571792|emb|CAE41299.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332381564|gb|AEE66411.1| 16S ribosomal RNA methyltransferase RsmE [Bordetella pertussis CS]
          Length = 246

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 104/245 (42%), Gaps = 9/245 (3%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R + D  L             H+   VLR++ G  ++LF+G  GE+ + +   GK+
Sbjct: 1   MSLPRFYCDARLAPGECVALPEALAHHAVRVLRLRAGAALVLFDGAGGEYPATLEIEGKA 60

Query: 65  IRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT--- 120
              ++  +  R       +  +      +++D++++K+VE+G   + P+  + +      
Sbjct: 61  AWAQLGAHVPREAELPGRITLVQGLPAGDKMDWVVEKAVELGAWRVSPIAAQRSVLQLNG 120

Query: 121 ---HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 +   +    +AAEQC    L  +  P  L   L         +         + 
Sbjct: 121 ARAEKRLAHWQRIAQAAAEQCGRNRLMAVDAPQALAAWLAQAPGAALRLLCHPEA-ELDL 179

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              L   A   ++ +L+GPEGG+  EE E   +   V  +  GPR+LR++TA +A +A V
Sbjct: 180 AGALARHAAHDDICLLVGPEGGWSDEELEQARAAG-VQAVRFGPRVLRTETAGIALIAAV 238

Query: 238 QAICG 242
            AI G
Sbjct: 239 SAIRG 243


>gi|114771337|ref|ZP_01448757.1| hypothetical protein OM2255_08270 [alpha proteobacterium HTCC2255]
 gi|114548262|gb|EAU51149.1| hypothetical protein OM2255_08270 [alpha proteobacterium HTCC2255]
          Length = 243

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 105/245 (42%), Positives = 141/245 (57%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I S + RLFVD PL        + DQ +YL +V+R+  GD I +FNGKDGEW +++  
Sbjct: 1   MDIRSKI-RLFVDSPLGEGQSILLARDQANYLFNVMRLNIGDFISVFNGKDGEWQAEVLQ 59

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K      V+ QS  Q    DV  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGIIIVKNQSMPQLLPPDVWLLFAPIKKTRTDFIVEKATEMGVSRICPVFTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R++ ++I AAEQC    +P +   +TL  +LK+W     ++F DE    EN   
Sbjct: 120 DRIKQSRLQAHSIEAAEQCGGTYVPPVDELSTLTSVLKSWPKERHLLFCDEHKVGEN--V 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           K          AILIGPEGG+   E   L SL FVT +SLGPRILR+DTAAVAA+A+ Q 
Sbjct: 178 KSMKATKSDKWAILIGPEGGFSDSEVMHLKSLEFVTSISLGPRILRADTAAVAALAIWQM 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 QMGDW 242


>gi|304396754|ref|ZP_07378634.1| protein of unknown function DUF558 [Pantoea sp. aB]
 gi|304355550|gb|EFM19917.1| protein of unknown function DUF558 [Pantoea sp. aB]
          Length = 243

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I ++     D  +++  VLRM  G  + LF+G +  + ++I++V K 
Sbjct: 1   MRIPRIYHAEPLDIGSEITLDEDASNHVGRVLRMTAGQRLELFDGTNLTFAAEITHVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +S+    +S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  RVKVSVTESQPDDHESPLHLHLGQVMSRGEKMEFTIQKSIELGVNIITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I    TLE      D   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEADSGLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSADEIAMTAQHDF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|163749088|ref|ZP_02156338.1| hypothetical protein KT99_19644 [Shewanella benthica KT99]
 gi|161331158|gb|EDQ02047.1| hypothetical protein KT99_19644 [Shewanella benthica KT99]
          Length = 242

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++ D PL I        +   ++  VLRM  G+ I LFNG D ++L++I    K 
Sbjct: 1   MRIPRIYQDSPLVIGDSLALHDEAASHIGRVLRMTPGEQISLFNGSDHDYLAEIISASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S +   +S +         + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NISVKVLSSNTNASESPLHIHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   ++A EQ     +P I P  +LE        + ++           
Sbjct: 121 GDRLEKKRQQWQKIVVAACEQSGRSRVPEIRPAMSLEAWCGEPTDSLKLNLHPRAAHGIG 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L        +  V +LIGPEGG    E        F T + LGPR+LR++TAA+ A++ 
Sbjct: 181 GLPL-----EVAKVRLLIGPEGGLSDTEILQTEQDEF-TDILLGPRVLRTETAALTAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|297184217|gb|ADI20335.1| uncharacterized protein conserved in bacteria [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 243

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 105/245 (42%), Positives = 141/245 (57%), Gaps = 4/245 (1%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M I S + RLFVD PL        + DQ +YL +V+R+  GD I +FNGKDGEW +++  
Sbjct: 1   MDIRSKI-RLFVDSPLGEGQSILLARDQANYLFNVMRLNIGDFISVFNGKDGEWQAEVLQ 59

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             K      V+ QS  Q    DV  +F+PIK  R D++++K+ EMG+  I PV T YT +
Sbjct: 60  ANKRKGIIIVKNQSMPQLLPPDVWLLFAPIKKARTDFIVEKATEMGVSRICPVFTDYTNS 119

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R++ ++I AAEQC    +P +   +TL  +LK+W     ++F DE    EN   
Sbjct: 120 DRIKQSRLQAHSIEAAEQCGGTYVPPVDELSTLTSVLKSWPKERHLLFCDEHKVGEN--V 177

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           K          AILIGPEGG+   E   L SL FVT +SLGPRILR+DTAAVAA+A+ Q 
Sbjct: 178 KSMKATKSDKWAILIGPEGGFSDSEVMHLKSLEFVTSISLGPRILRADTAAVAALAIWQM 237

Query: 240 ICGDW 244
             GDW
Sbjct: 238 QMGDW 242


>gi|290476315|ref|YP_003469219.1| hypothetical protein XBJ1_3337 [Xenorhabdus bovienii SS-2004]
 gi|289175652|emb|CBJ82455.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 243

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L ++T+   S +  +++  VLRM  G  + LF+G +  + +++    K 
Sbjct: 1   MRIPRIYHPERLSVETEIYLSDEAANHVGRVLRMSNGQPLQLFDGSNQVFDAELIEASKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +        ++       +  ++++ IQKSVE+G+  I P+++        
Sbjct: 61  TIKVRITDGKLSDHESPLNLHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE      D + ++        S N
Sbjct: 121 AERLEKKLQQWKKIVISACEQCGRNCIPEIRPVMSLEAWCAENDGSLKLNLHPRASQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  + +LIGPEGG  +EE E   +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVEKIRLLIGPEGGLSAEEIEMTANHQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|325290539|ref|YP_004266720.1| Ribosomal RNA small subunit methyltransferase E [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965940|gb|ADY56719.1| Ribosomal RNA small subunit methyltransferase E [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 245

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R  +      +      G++ H+L  VLR+  G+ IL F+     W   I  + K   
Sbjct: 1   MHRFRISS--IDQDYFLIDGEELHHLTRVLRLGPGEEILGFDHSGRLWRGAIREINKEQA 58

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +  +      +  V  I    K  +++ +IQK  E+GM  + P+ TR +       
Sbjct: 59  VCSVIRAEIPETEAKVKVYLIVGLSKGEKMELVIQKGTELGMTGLIPLRTRRSVMKLEGT 118

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +DR R     A +QC  +  P + P    + L      + Q +   E   + +  
Sbjct: 119 KAEERVDRWRKIAGEAVKQCGRVIQPAVAPVLDWQDLPAYLPADTQWLIPFEGEKTVSLK 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L +      +A++IGPEGG+  +E            +SLG RILR++TAA+AA+ +V 
Sbjct: 179 ACLKSFDPSLPMALIIGPEGGFEPQEVLWAKEKLGAKSISLGSRILRAETAAIAALTIVL 238

Query: 239 AICGD 243
           A  GD
Sbjct: 239 AFYGD 243


>gi|319782233|ref|YP_004141709.1| hypothetical protein Mesci_2516 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168121|gb|ADV11659.1| protein of unknown function DUF558 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 244

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 141/226 (62%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS- 59
           M+ +  ++RLFV   L    + +A   Q HYL HVLR+ EG  IL+FNG+DGEW + IS 
Sbjct: 1   MRANYKMQRLFVTDDLAPDIEFEAGQQQSHYLLHVLRLGEGAEILVFNGRDGEWSAAISA 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              +++R KV    R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ 
Sbjct: 61  KTKRAVRLKVSALQRPQPPLPDLVYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              ++DR+R   + AAEQC IL +P +      + LL  WD   +++F DE   + N L 
Sbjct: 121 AKPSIDRLRANVVEAAEQCGILAVPQVREAEKFDRLLTGWDTERRLIFCDEDASTNNPLA 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L A+     + +L+GPEGG+  +E++ L +LPFVT + LGPRILR
Sbjct: 181 ALQAVKE-KKLGLLVGPEGGFSDDERKMLRALPFVTAIPLGPRILR 225


>gi|254455755|ref|ZP_05069184.1| conserved hypothetical protein TIGR00046 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082757|gb|EDZ60183.1| conserved hypothetical protein TIGR00046 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 232

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 72/231 (31%), Positives = 113/231 (48%), Gaps = 6/231 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RLF    L I  + K    Q HY++ V+R+KE +   LFN         IS    S+ F 
Sbjct: 5   RLFFPKSLSINLKDKLDKSQSHYVSKVMRIKENEVFSLFNSSGEWEAKIISISKSSVEFN 64

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           +  Q R +    ++   FSPIK+N  ++MIQK+ E+G+    P+I   T     N +R+ 
Sbjct: 65  ITKQLRQKENLKELWLAFSPIKSNYFNFMIQKATELGVTKFLPIIFDRTIVRKINKERLE 124

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
              I AAEQ + +T+P I  P  L+  L N      I     T  ++  L+KL       
Sbjct: 125 KVIIEAAEQSNRITVPIIEEPQKLKNFLSNDM--DLIFTDLNTSNTKIDLKKLTTKPT-- 180

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
              ++IGPEG +  EE+E +     V  + +   ILRS+TA ++A++++  
Sbjct: 181 --CVIIGPEGDFSEEEREKILKFNGVQSIKINENILRSETAVISALSIINY 229


>gi|58617229|ref|YP_196428.1| hypothetical protein ERGA_CDS_05020 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416841|emb|CAI27954.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 238

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 77/230 (33%), Positives = 127/230 (55%), Gaps = 5/230 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V   +   +  K      HY++ V+R  + D++ +FNGKDGEW+ +I  +  +I+ +
Sbjct: 9   RLYVPDSISKHSIIKLDTLASHYISKVMRATKCDHVKIFNGKDGEWIGEICELSNNIKIR 68

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           ++  +R Q K  ++   F  +K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ R
Sbjct: 69  IDKLTRKQVKSKNLTLCFGIVKGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKCR 128

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
            + I A+EQC+ L +P I  P +   L K    N   +  DET   +   E L       
Sbjct: 129 KWAIEASEQCERLDIPQISHPISFTDLKKLDTANINFIICDETGNGKKPAEILTNKN--- 185

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           N+ I++GPEGG+ SEE +      F   LSLG RILR DTA V+A+A V 
Sbjct: 186 NIYIIVGPEGGFSSEELDFA--YTFCNGLSLGTRILRVDTAVVSALAYVN 233


>gi|319651611|ref|ZP_08005738.1| hypothetical protein HMPREF1013_02350 [Bacillus sp. 2_A_57_CT2]
 gi|317396678|gb|EFV77389.1| hypothetical protein HMPREF1013_02350 [Bacillus sp. 2_A_57_CT2]
          Length = 249

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 104/247 (42%), Gaps = 14/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F +  +         G+  H++  V+RMKEGD I+  +      L  I+ +     
Sbjct: 1   MQRYFTENAVKEN-VFLIKGEDRHHIVKVMRMKEGDQIICVDQSQNSALCAIAEITDEHV 59

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPV------ITRYTQ 118
               V++   S    +++  +    K ++L+++IQK  E+G     P       +    +
Sbjct: 60  AAEVVQWIEGSSELPANITIVSGLPKGDKLEWIIQKGTELGAHRFIPFTSARSVVKWDAK 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
            +    +R +     AAEQ     +P ++ P  L+ LLK        + A E    +   
Sbjct: 120 KSVKKAERWQKIAKEAAEQSHRTMVPEVFAPLDLKSLLKLSGDYSYKLIAFEEEAKQGED 179

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               + L ++    ++ ++ GPEGG    E   L    FV    LGPRILR++TA +  +
Sbjct: 180 SVLYKTLTSMNKGQSLMVVFGPEGGLSDNEVSLLQEAGFV-ACGLGPRILRTETAPLYLL 238

Query: 235 ALVQAIC 241
           + V    
Sbjct: 239 SAVSYHF 245


>gi|332975772|gb|EGK12653.1| RsmE family RNA methyltransferase [Desmospora sp. 8437]
          Length = 248

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 112/245 (45%), Gaps = 11/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG--KS 64
           ++R F+D       +    GD  H++ +V+RM+ GD ++  + +  ++L+++  V   ++
Sbjct: 1   MQRYFIDSTQIGPDRITVRGDDVHHIKNVMRMRAGDRLICCDSRGTDYLAELETVSEGEA 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E        +  V    S  K ++ ++++QK  E+G  +  P I+  T       
Sbjct: 61  RCRILERMPSRGEPRFRVAVAASLTKGDKWEWVLQKGTELGAASFLPFISARTVVKWDGK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R +     AAEQ     +P +        LL+ +    +++FA E  G   SL
Sbjct: 121 KADKKKERWQRIAKEAAEQSHRGQIPHVETVMDWRSLLERFPAFDRVLFAYEKGG--RSL 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             +        + ++IGPEGG+   EK    +   V  + LGPRILR++TA +A ++ + 
Sbjct: 179 GAVLREVTGERMLVVIGPEGGFTETEKSEAVAAGAV-SIHLGPRILRAETAPLALLSCIH 237

Query: 239 AICGD 243
              G+
Sbjct: 238 YSYGE 242


>gi|325295443|ref|YP_004281957.1| ribosomal RNA small subunit methyltransferase E [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065891|gb|ADY73898.1| Ribosomal RNA small subunit methyltransferase E [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 241

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 68/246 (27%), Positives = 117/246 (47%), Gaps = 18/246 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           ++R  VD            G +  +   VLR+++GD I++F+G+  E+L++I     +  
Sbjct: 1   MQRFKVDK--VGNGVAYLRGQEARHALKVLRLRKGDEIIIFDGEGREYLAEIEAASPTSV 58

Query: 66  --RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
             +   E      +      Y+    K  + +  IQK+ E+G+  I PV+ + +      
Sbjct: 59  RLKVLEEININRDSHLKTTLYMGLTNKLQKFELAIQKATELGVTEIIPVVCKRSSNAQNI 118

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
           +N    + R     ++AA+QC    LP ++ P  L  +    + +   V  ++   S   
Sbjct: 119 KNWDNKLRRWEEIVVNAAKQCGRNILPIVHSPVKLPEIEN--NSDLLFVLWEKGGKSLKD 176

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E   A     +V++++GPEGG+  EE E L    F  P+ LG RILR++TAA+A M LV
Sbjct: 177 YESFSA----SSVSLIVGPEGGFDKEEIEILKEKGF-KPIYLGKRILRAETAAIAGMTLV 231

Query: 238 QAICGD 243
           Q + GD
Sbjct: 232 QFLWGD 237


>gi|296533751|ref|ZP_06896298.1| RsmE family RNA methyltransferase [Roseomonas cervicalis ATCC
           49957]
 gi|296265927|gb|EFH12005.1| RsmE family RNA methyltransferase [Roseomonas cervicalis ATCC
           49957]
          Length = 242

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 86/241 (35%), Positives = 138/241 (57%), Gaps = 4/241 (1%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + RL V   L    +      Q HYL  V+R KEGD + LFNG+DGEWL++I+ + K 
Sbjct: 1   MSIPRLHVAADLAEAAEIPGEPGQGHYLGQVMRRKEGDPVHLFNGRDGEWLARIAALRKD 60

Query: 65  I-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
             +F+ E + R Q    D++ + +P+K + +D++++K+ E+G+ +IRPV T        N
Sbjct: 61  RVQFRPESRLRPQQSGPDLRLLLAPVKRDAMDWIVEKATELGVRSIRPVFTARCVIGRVN 120

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
           ++R+ T    AAEQC+ L +P       L+        +   +   +  G   SL  + A
Sbjct: 121 LERLSTIAREAAEQCERLDVP--EIAAPLDLHAALDAWDGAPLLVGDARGKAPSLNVVLA 178

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
               P + +L+GPEGG+  +E + +   PFV+P +LGPRILR++TAAVA +A++QA+ GD
Sbjct: 179 GKAPP-LGLLVGPEGGFTDQELDAVRRRPFVSPAALGPRILRAETAAVAGLAVLQALAGD 237

Query: 244 W 244
           W
Sbjct: 238 W 238


>gi|227820965|ref|YP_002824935.1| 16S ribosomal RNA methyltransferase RsmE [Sinorhizobium fredii
           NGR234]
 gi|227339964|gb|ACP24182.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 245

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 102/226 (45%), Positives = 147/226 (65%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV+ PL    + +A+ DQ++YL +VLR  EG +IL+FNG+DGEW +++S 
Sbjct: 1   MRANFRMQRLFVESPLHAGARHEATKDQFNYLINVLRFGEGSSILVFNGRDGEWRAELSL 60

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +         Q+R Q   SD+ Y+F+P+KT RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKQLVLTAVEQTRPQPAPSDLVYLFAPLKTGRLDYLVQKAVEMGAGVLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+DR+R     AAEQC +L +P +  P  LE LL NW    +I+F DE   S+N L 
Sbjct: 121 KLGNLDRLRANVTEAAEQCGVLGIPSVETPRKLEELLANWPRERRIIFCDEGNESQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L  I+    +A+LIGPEGG+   E+  LHSL FVT + LGPRILR
Sbjct: 181 ILGGISE-RRLALLIGPEGGFSEAERVLLHSLDFVTAVPLGPRILR 225


>gi|301055803|ref|YP_003794014.1| RNA methyltransferase [Bacillus anthracis CI]
 gi|300377972|gb|ADK06876.1| RNA methyltransferase [Bacillus cereus biovar anthracis str. CI]
          Length = 249

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NG+               
Sbjct: 1   MQRYFVEEKYVDETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGRTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|291484991|dbj|BAI86066.1| hypothetical protein BSNT_03788 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 256

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 106/249 (42%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +        +G+  H++ +V+RM EGD I+  +    E   ++  V K
Sbjct: 1   MQRYFIELTKQQIEEAPAFSITGEDVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSK 60

Query: 64  SI--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +E+ ++++     V       K ++L+++IQK  E+G  A  P     +    
Sbjct: 61  DKVSCLVIEWTNKNRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P +    + + LL+      + V A E    +
Sbjct: 121 DDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESSKQ 180

Query: 176 NSLEKLHAI----AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             +    AI        ++ I+ GPEGG    E E L     VT   LGPRILR++TA +
Sbjct: 181 GEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVT-CGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A++ +   
Sbjct: 240 YALSAISYQ 248


>gi|297170744|gb|ADI21766.1| uncharacterized protein conserved in bacteria [uncultured gamma
           proteobacterium HF0130_22O14]
          Length = 246

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 119/251 (47%), Gaps = 16/251 (6%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+    ++R  VD     K+  + +G+Q HY+  VLR++ GD ++LF+G   EW +KI  
Sbjct: 1   MR-KKRIQRFHVDQIDNSKSHLEIAGEQSHYVTRVLRLQTGDRMILFDGSGSEWTAKIID 59

Query: 61  VGKSIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG------MGAIRPV 112
             ++       E  +  +    ++  I S  ++ R+D ++QKS E+G      + +   +
Sbjct: 60  TKRNRLLLELEERATPDRESPINLTLIQSISRSQRMDLVMQKSTELGVTRIVPVFSTNTI 119

Query: 113 ITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
           +          ++  R   ISA+EQ     +P +  P  LE        +   +F D T 
Sbjct: 120 VKMNEDKIEKKINHWRNILISASEQSGRTKIPDLISPIQLETECLKRYKSDLSIFYDTTG 179

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
                        +  ++  +IGPEGG+  +EK+      ++   S GPR+LR++TA + 
Sbjct: 180 KDSYDA------NNPKDITAVIGPEGGFTEDEKQIAIDAGYMVMQS-GPRLLRTETAPIM 232

Query: 233 AMALVQAICGD 243
           A++++Q + GD
Sbjct: 233 ALSILQYLYGD 243


>gi|117617899|ref|YP_857627.1| hypothetical protein AHA_3127 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559306|gb|ABK36254.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 243

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L +      S D  +++  VLRM+ G  + LFNG   ++ + I+ VGK 
Sbjct: 1   MRIPRIYEPAALQVGQTLALSEDGANHIGRVLRMQPGQQLELFNGDGNQYPATIANVGKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                     + S      +       + +++D+ IQKSVE+G+  I P+ +        
Sbjct: 61  SVEVTIDRCDTHSVESPLAIHLGQVISRGDKMDFTIQKSVELGVTCITPLFSERCGVKLP 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                   ++ +   ISA EQC   T+P +  P  L+  L    +  ++        S N
Sbjct: 121 ADRLEKKREQWQKVVISACEQCGRNTVPEVRMPMELDAWLAEETNELKLNLHPRAPYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           V +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPI-----PEHGVRLLIGPEGGLSSDEIARTVQEDFKEML-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQCRFGD 241


>gi|261867348|ref|YP_003255270.1| 16S ribosomal RNA methyltransferase RsmE [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412680|gb|ACX82051.1| hypothetical protein D11S_0649 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 244

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T    S D  +++  VLRM+ GD + LF+G +  + + I+ V K 
Sbjct: 1   MRVPRIYHPIPLNQHTTCALSEDGANHVGRVLRMRAGDQLELFDGSNHIYQAVITAVAKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  Q   +     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVEVDILSRQFDDRESPLAIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      +   ++        S  
Sbjct: 121 GERMDKKIQQWQKIAIAACEQCGRNKIPEIRPLMKLQQWCAEPNDALKLNLHPRARYSIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L ++ A      V +LIG EGG   +E        FV  + LG R+LR++TAA+AA+  
Sbjct: 181 TLPEIPA----AGVRLLIGSEGGLSPQEIAQTEQQGFV-DVLLGKRVLRTETAAMAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|312110171|ref|YP_003988487.1| hypothetical protein GY4MC1_1064 [Geobacillus sp. Y4.1MC1]
 gi|311215272|gb|ADP73876.1| protein of unknown function DUF558 [Geobacillus sp. Y4.1MC1]
          Length = 249

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 94/247 (38%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV             GD YH++ HV+RM++G  ++         L +I  +     
Sbjct: 1   MQRYFVPDDQVENDHLIIQGDDYHHIVHVMRMEKGSKLICVLSCHKTALCQIEQITNERV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                +  ++  +  VQ   +          +                 A R ++    +
Sbjct: 61  IVRVEEWINEQTELPVQIYIAHGLPKGDKLELVIQKGTELGAASFIPFMAARSIVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----GS 174
             +  ++R +     AAEQ     +P I+ P T++ L++        +FA E        
Sbjct: 121 KANKKLERWKKIAKEAAEQSHRGKIPDIHAPMTIDELVEFAKIADYRLFAYEEEAKQRNH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  + H  ++  + GPEGG+  EE E L    F    SLGPRILR++TA +  +
Sbjct: 181 RTLAAILRQMKHGQSLLAVFGPEGGFSGEEVELLKQHGFF-SCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           A      
Sbjct: 240 AAASYQF 246


>gi|319639002|ref|ZP_07993760.1| hypothetical protein HMPREF0604_01384 [Neisseria mucosa C102]
 gi|317399906|gb|EFV80569.1| hypothetical protein HMPREF0604_01384 [Neisseria mucosa C102]
          Length = 241

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 115/246 (46%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVGKS 64
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG    +  L ++    ++
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNGNGKSYPALPEVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  ++       ++  + +     R+D+ +QKSVE+G+  IRPVI+         +
Sbjct: 60  SVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ     +P + P TT    L+        +        + S 
Sbjct: 120 RAEKRVARWQEIVVSACEQSGRNIVPRVLPLTTYAQALRQLPQETAKLLMSLNRAQKLS- 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V  ++GPEGG+  +E++      F   ++LG R+LR++TA++AA+A +Q
Sbjct: 179 ---DVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGF-QSVTLGKRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|261379381|ref|ZP_05983954.1| 16S rRNA methyltransferase RsmE [Neisseria subflava NJ9703]
 gi|284797829|gb|EFC53176.1| 16S rRNA methyltransferase RsmE [Neisseria subflava NJ9703]
          Length = 241

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 115/246 (46%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVGKS 64
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG    +  L ++    ++
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNGNGKAYPALPEVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  ++       ++  + +     R+D+ +QKSVE+G+  IRPVI+         +
Sbjct: 60  SVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ     +P + P TT    L+        +        + S 
Sbjct: 120 RAEKRVARWQEIVVSACEQSGRNIVPKVLPLTTYAQALQQLPQETTKLLMSLNRAQKLS- 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V  ++GPEGG+  +E++      F   ++LG R+LR++TA++AA+A +Q
Sbjct: 179 ---DVQPQSGKVVFMVGPEGGWTEKEEQQAFDAGF-QSVTLGKRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|118479479|ref|YP_896630.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus thuringiensis
           str. Al Hakam]
 gi|225866292|ref|YP_002751670.1| RNA methyltransferase, RsmE family [Bacillus cereus 03BB102]
 gi|229186551|ref|ZP_04313712.1| RNA methyltransferase, RsmE [Bacillus cereus BGSC 6E1]
 gi|118418704|gb|ABK87123.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|225790106|gb|ACO30323.1| RNA methyltransferase, RsmE family [Bacillus cereus 03BB102]
 gi|228596810|gb|EEK54469.1| RNA methyltransferase, RsmE [Bacillus cereus BGSC 6E1]
          Length = 249

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NG+               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGRTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      +       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFMTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|225076881|ref|ZP_03720080.1| hypothetical protein NEIFLAOT_01932 [Neisseria flavescens
           NRL30031/H210]
 gi|224951767|gb|EEG32976.1| hypothetical protein NEIFLAOT_01932 [Neisseria flavescens
           NRL30031/H210]
          Length = 241

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 116/246 (47%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVGKS 64
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG    +  L ++    ++
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNGNGKAYPALPEVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  ++       ++  + +     R+D+ +QKSVE+G+  IRPVI+         +
Sbjct: 60  SVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R +   +SA EQ     +P + P TT    L+        +        + S 
Sbjct: 120 RAEKRVERWQEIVVSACEQSGRNIVPKVLPLTTYAQALQQLPQETTKLLMSLNRAQKLS- 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V  ++GPEGG+  +E++      F   ++LG R+LR++TA++AA+A +Q
Sbjct: 179 ---DVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGF-QSVTLGKRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|295706647|ref|YP_003599722.1| ribosomal RNA small subunit methyltransferase E [Bacillus
           megaterium DSM 319]
 gi|294804306|gb|ADF41372.1| ribosomal RNA small subunit methyltransferase E [Bacillus
           megaterium DSM 319]
          Length = 250

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 102/246 (41%), Gaps = 13/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+      +     + D  H+++ V+RM EG   +  N +    L +I  +  +  
Sbjct: 1   MQRYFLPNDQFQEQSVIVTQDDAHHISRVMRMNEGSQFIACNEQGQAALCEIENISANEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVI------TRYTQ 118
               +E+ S  +     V  +    K ++L+ +IQK  E+G     P I          +
Sbjct: 61  KASIIEWISEEKELPVHVTIVNGLPKGDKLELIIQKGTELGAYKFIPFIAARSVVKWDDK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
            +   +DR       AAEQ     +P +  P + + L++        V A E    +   
Sbjct: 121 KSQKKVDRWNKIAKEAAEQSHRTIVPAVEAPISFKKLVEISGDYTHKVVAYEERAKQGET 180

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            +    L A+    +V +++GPEGG   +E   L    F      GPRILR++TA + A+
Sbjct: 181 SHLHAVLSALKPGHSVLVVVGPEGGLTEQEVGVLEENEFTIS-GFGPRILRAETAPLYAL 239

Query: 235 ALVQAI 240
           + +   
Sbjct: 240 SAISYQ 245


>gi|78044093|ref|YP_359279.1| hypothetical protein CHY_0418 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996208|gb|ABB15107.1| conserved hypothetical protein TIGR00046 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 248

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/245 (26%), Positives = 117/245 (47%), Gaps = 11/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-- 64
           +   F+            +GD   ++A VLR+K G+ + L + ++  +L ++  V K   
Sbjct: 1   MPYFFLPPGQTQGDYAYLTGDDAKHVAKVLRIKPGEKLTLQDDQEFRYLCQVIAVRKDLV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               +E +        +V  +    K +++D+++QK+ E+G+  I PV T         +
Sbjct: 61  QLKILEKKKVVTRPPVNVTLVQGVPKGDKMDFIVQKATELGVYRIIPVETIRTVVVFDER 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R +     AA+Q  +  +P I+P   L+ L +        +        + SL
Sbjct: 121 KKKDRCERWQKIAYEAAKQAGVSRVPEIFPVIDLKALPEFISDAL--ILVPYEGEEQTSL 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           ++L     + NV ++IGPEGG+   E E L S   VT +SLGPRILR++TAA+A +++V 
Sbjct: 179 KQLLNKEAVKNVTVIIGPEGGFDPGEIEYLKSFGAVT-VSLGPRILRTETAALAVLSMVL 237

Query: 239 AICGD 243
              GD
Sbjct: 238 YQWGD 242


>gi|306841708|ref|ZP_07474395.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306288238|gb|EFM59622.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 242

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 115/239 (48%), Positives = 153/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYLAHVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELQAGVSFDAGAQAAHYLAHVLRMKEGDEVLVFNGRDGEWRASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      D
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGILQPVITQHTQVPRLGTD 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L LP        +     WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLALPDCREALRFDRFRDQWDTSRRLIFCDEGHESDDPLSILAGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|295399227|ref|ZP_06809209.1| protein of unknown function DUF558 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978693|gb|EFG54289.1| protein of unknown function DUF558 [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 249

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 94/247 (38%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV             GD YH++ HV+RM++G  ++         L +I  +     
Sbjct: 1   MQRYFVPDDQVENDHLIIQGDDYHHIVHVMRMEKGSKLICVLSCHKTALCQIEQITNERV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMG--------MGAIRPVITRYTQ 118
                +  ++  +  +Q   +          +                 A R ++    +
Sbjct: 61  IVRVEEWINEQTELPIQIYIAHGLPKGDKLELVIQKGTELGAASFIPFMAARSIVKWDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC----GS 174
             +  ++R +     AAEQ     +P I+ P T++ L++        +FA E        
Sbjct: 121 KANKKLERWKKIAKEAAEQSHRGKIPDIHAPMTIDELVEFAKIADYRLFAYEEEAKQRNH 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  + H  ++  + GPEGG+  EE E L    F    SLGPRILR++TA +  +
Sbjct: 181 RTLAAILRQMKHGQSLLAVFGPEGGFSGEEVELLKQHGFF-SCSLGPRILRTETAPLYLL 239

Query: 235 ALVQAIC 241
           A      
Sbjct: 240 AAASYQF 246


>gi|260589081|ref|ZP_05854994.1| RNA methyltransferase, RsmE family [Blautia hansenii DSM 20583]
 gi|260540501|gb|EEX21070.1| RNA methyltransferase, RsmE family [Blautia hansenii DSM 20583]
          Length = 246

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 111/244 (45%), Gaps = 9/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV+       Q   SG   +++ +VLRMK  + IL+ +G+D E+   I  +G+   
Sbjct: 1   MYRFFVEPSQIKDNQICISGSDVNHIKNVLRMKLKEEILISSGEDKEYTCYIEEIGEEEI 60

Query: 67  FKVEYQSRSQTKQ--SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                  +    +  S +       K+++++ +IQK+VE+G+  + PV ++        +
Sbjct: 61  LAHIMYVQEAGYELSSKIYLFQGLPKSDKMELIIQKAVELGVHQVIPVASKRAVVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                + R +  + SAA+Q   + +P I    + +  +        ++F  E   G + +
Sbjct: 121 KEEKKITRWQAISESAAKQSKRMYVPEITNVMSFQQAVDYAGKLDIVLFPYELADGMKKT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E +  I    +V I IGPEGG+   E            ++LG RILR++TA +  +A++
Sbjct: 181 KEIIGKIKPGQSVGIFIGPEGGFEESEVALAKEKADAQVITLGKRILRTETAGLTVLAIL 240

Query: 238 QAIC 241
               
Sbjct: 241 MYTL 244


>gi|228929355|ref|ZP_04092379.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228830306|gb|EEM75919.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 249

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NG+               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGRTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEIIVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|49187206|ref|YP_030458.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Sterne]
 gi|49481319|ref|YP_038366.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|65321684|ref|ZP_00394643.1| COG1385: Uncharacterized protein conserved in bacteria [Bacillus
           anthracis str. A2012]
 gi|165872033|ref|ZP_02216673.1| conserved hypothetical protein TIGR00046 [Bacillus anthracis str.
           A0488]
 gi|167634645|ref|ZP_02392965.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0442]
 gi|167638597|ref|ZP_02396873.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0193]
 gi|170687378|ref|ZP_02878595.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0465]
 gi|170707490|ref|ZP_02897944.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0389]
 gi|177653268|ref|ZP_02935520.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0174]
 gi|190566983|ref|ZP_03019899.1| RNA methyltransferase, RsmE family [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034476|ref|ZP_03101885.1| RNA methyltransferase, RsmE family [Bacillus cereus W]
 gi|196039365|ref|ZP_03106671.1| RNA methyltransferase, RsmE family [Bacillus cereus NVH0597-99]
 gi|218905448|ref|YP_002453282.1| RNA methyltransferase, RsmE family [Bacillus cereus AH820]
 gi|227817087|ref|YP_002817096.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. CDC
           684]
 gi|228916943|ref|ZP_04080504.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228935631|ref|ZP_04098445.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948024|ref|ZP_04110309.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229077351|ref|NP_846759.2| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Ames]
 gi|229093381|ref|ZP_04224486.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-42]
 gi|229123850|ref|ZP_04253043.1| RNA methyltransferase, RsmE [Bacillus cereus 95/8201]
 gi|229220844|ref|YP_021182.2| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           'Ames Ancestor']
 gi|229600789|ref|YP_002868600.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0248]
 gi|254684068|ref|ZP_05147928.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721902|ref|ZP_05183691.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           A1055]
 gi|254736416|ref|ZP_05194122.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741454|ref|ZP_05199141.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Kruger B]
 gi|254750892|ref|ZP_05202931.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Vollum]
 gi|254757780|ref|ZP_05209807.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus anthracis str.
           Australia 94]
 gi|49181133|gb|AAT56509.1| conserved hypothetical protein TIGR00046 [Bacillus anthracis str.
           Sterne]
 gi|49332875|gb|AAT63521.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|164712164|gb|EDR17701.1| conserved hypothetical protein TIGR00046 [Bacillus anthracis str.
           A0488]
 gi|167513445|gb|EDR88815.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0193]
 gi|167530097|gb|EDR92832.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0442]
 gi|170127734|gb|EDS96607.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0389]
 gi|170668573|gb|EDT19319.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0465]
 gi|172081550|gb|EDT66622.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0174]
 gi|190561974|gb|EDV15943.1| RNA methyltransferase, RsmE family [Bacillus anthracis
           Tsiankovskii-I]
 gi|195993018|gb|EDX56977.1| RNA methyltransferase, RsmE family [Bacillus cereus W]
 gi|196029992|gb|EDX68593.1| RNA methyltransferase, RsmE family [Bacillus cereus NVH0597-99]
 gi|218534944|gb|ACK87342.1| RNA methyltransferase, RsmE family [Bacillus cereus AH820]
 gi|227006628|gb|ACP16371.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. CDC
           684]
 gi|228659564|gb|EEL15211.1| RNA methyltransferase, RsmE [Bacillus cereus 95/8201]
 gi|228689975|gb|EEL43778.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-42]
 gi|228811610|gb|EEM57946.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228823991|gb|EEM69809.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228842664|gb|EEM87751.1| RNA methyltransferase, RsmE [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229265197|gb|ACQ46834.1| RNA methyltransferase, RsmE family [Bacillus anthracis str. A0248]
 gi|269850267|gb|AAP28245.2| RNA methyltransferase, RsmE family [Bacillus anthracis str. Ames]
          Length = 249

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NG+               
Sbjct: 1   MQRYFVEEKYVNETSIRIVGDDVHHIARVMRMSAGDHIYCCVNGRTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|118594425|ref|ZP_01551772.1| hypothetical protein MB2181_02115 [Methylophilales bacterium
           HTCC2181]
 gi|118440203|gb|EAV46830.1| hypothetical protein MB2181_02115 [Methylophilales bacterium
           HTCC2181]
          Length = 246

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/245 (26%), Positives = 112/245 (45%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +KR +    L +      S    H+  +V+R+K  D I+LFN    ++ ++I  + K+  
Sbjct: 1   MKRFYHPDALELDQIANLSKVAAHHATNVMRLKLSDKIILFNNDVYDFGAEIIRISKNRV 60

Query: 67  FKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
             V     +  K SD  ++ I S   T ++D++IQKSVE+G+  I P+ ++         
Sbjct: 61  EVVIQSKIANRKDSDLKIRLIQSISSTEKMDWIIQKSVELGVHTIVPIFSQRSIIKLNND 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +   +    SA EQC    +P I+ P   +    N   + +            + 
Sbjct: 121 RAEKKLSHWKQIIQSACEQCGRSKVPEIFIPKKFDAFWSNETISNKDHLKLILSPLAKNS 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            +  +      + I+IGPEGG+  EE        F+ P  +GPRILR++TA +A +AL+Q
Sbjct: 181 FRTISTIKPSAIDIMIGPEGGFSEEEVVNAEKNGFI-PFEIGPRILRTETAPLAMLALLQ 239

Query: 239 AICGD 243
              GD
Sbjct: 240 YKYGD 244


>gi|170695362|ref|ZP_02886508.1| protein of unknown function DUF558 [Burkholderia graminis C4D1M]
 gi|170139762|gb|EDT07944.1| protein of unknown function DUF558 [Burkholderia graminis C4D1M]
          Length = 246

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/248 (22%), Positives = 107/248 (43%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV   L      +   D   ++  VLR++ GD+I+LFNG+ GE+ ++++ + +   
Sbjct: 1   MPRFFVGTSLSPDDIVQLPDDVVRHVL-VLRLQVGDSIVLFNGEGGEYSAELAAIERRAV 59

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E++         +         +++D++I+K+VE+G  +  P+ T  +      +
Sbjct: 60  TVKIREFRDIEVETPYRLTLAQGIASGDKMDWLIEKAVELGASSFVPLTTTRSVVRLAGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD--HNCQIVFADETCGSEN 176
                         ++ EQC    LP + P   +   L           +    +  +  
Sbjct: 120 RAARRHAHWEGIVRASCEQCGRNRLPEVMPVREIATWLSAMPRVPAGDELRILLSPRASI 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L A      V +L+GPEGG+ + E+       F   + LGPR+LR++TA +A ++ 
Sbjct: 180 PFSALPAAPPKGPVTVLVGPEGGFSAAEEAAAMDHGF-QAVGLGPRVLRTETAGMAVLSA 238

Query: 237 VQAICGDW 244
           + A  G W
Sbjct: 239 LAAGWGGW 246


>gi|57239217|ref|YP_180353.1| 16S ribosomal RNA methyltransferase RsmE [Ehrlichia ruminantium
           str. Welgevonden]
 gi|57161296|emb|CAH58217.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 238

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 77/230 (33%), Positives = 126/230 (54%), Gaps = 5/230 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V   +   +  K      HY++ V+R  + D + +FNGKDGEW+ +I  +  +I+ +
Sbjct: 9   RLYVPDSISKHSIIKLDTLASHYISKVMRATKCDYVKIFNGKDGEWIGEICELSNNIKIR 68

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           ++  +R Q K  ++   F  +K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ R
Sbjct: 69  IDKLTRKQVKSKNLTLCFGIVKGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKCR 128

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
            + I A+EQC+ L +P I  P +   L K    N   +  DET   +   E L       
Sbjct: 129 KWAIEASEQCERLDIPQISHPISFTDLKKLDTANINFIICDETGNGKKPAEILTNKN--- 185

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           N+ I++GPEGG+ SEE +      F   LSLG RILR DTA V+A+A V 
Sbjct: 186 NIYIIVGPEGGFSSEELDFA--YTFCNGLSLGTRILRVDTAVVSALAYVN 233


>gi|255318401|ref|ZP_05359634.1| RNA methyltransferase [Acinetobacter radioresistens SK82]
 gi|262378631|ref|ZP_06071788.1| RNA methyltransferase [Acinetobacter radioresistens SH164]
 gi|255304393|gb|EET83577.1| RNA methyltransferase [Acinetobacter radioresistens SK82]
 gi|262299916|gb|EEY87828.1| RNA methyltransferase [Acinetobacter radioresistens SH164]
          Length = 239

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 109/243 (44%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L + T  + +   +H+   VLR + GD+  LFNG+ GE+ + ++ + K   
Sbjct: 1   MPRFYIEADLTVGTTVELTETVFHHWVKVLRAQIGDSATLFNGRGGEFEANLTEISKKTA 60

Query: 67  FKVEYQSRSQTKQSDVQ--YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                 S    +             K +R+DY+IQK+ E+G+  I+ + +   +      
Sbjct: 61  SVAIRSSNPADRTPPFTTVLGQVMSKGDRMDYVIQKATELGVTTIQLLTSERCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  +   I+A EQC +  +P I PP  L   L+      ++V A          
Sbjct: 121 RDQKKLDHWQAVVIAACEQCGMNRIPEILPPVPLTDWLQQNLPATRLVLAPNKRQQNVLT 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +         ++A+LIGPEGG    E +  +   F     +G RILR++TA V A++++ 
Sbjct: 181 DA------QTDLALLIGPEGGLSEAEIDMANHAGF-KNWCIGERILRTETAPVVALSILN 233

Query: 239 AIC 241
              
Sbjct: 234 HHF 236


>gi|331091342|ref|ZP_08340182.1| hypothetical protein HMPREF9477_00825 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404503|gb|EGG84047.1| hypothetical protein HMPREF9477_00825 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 245

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV        +    G   +++ +VLRMK+G+ + + +G + +++ +I  +     
Sbjct: 1   MHHFFVTPNQVSGEEIYIEGSDVNHICNVLRMKKGEKLQISDGNNKKYICRIEDMTAEKV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               VE +       S +       K++++++++QK+VE+G   I PV T+        +
Sbjct: 61  LLQIVEEKLGDTELSSKIYLFQGLPKSDKMEWIVQKAVELGAYEIIPVSTKRAVVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSENS 177
                ++R  +     A+Q     +P +    T    L   +  +  +V  +   G + +
Sbjct: 121 KAAKKVERWNSIAEGGAKQSGRTVIPKVREVMTYREALAYAETLDIVLVPYELAEGMDKT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E +  I    +V I IGPEGG+  EE E    +    P++LG RILR++TA +  ++++
Sbjct: 181 KEFIGQIEKGQSVGIFIGPEGGFEKEEVEQAMEMG-AEPITLGKRILRTETAGLTVLSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|212709359|ref|ZP_03317487.1| hypothetical protein PROVALCAL_00395 [Providencia alcalifaciens DSM
           30120]
 gi|212688271|gb|EEB47799.1| hypothetical protein PROVALCAL_00395 [Providencia alcalifaciens DSM
           30120]
          Length = 243

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I T      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRVPRIYHPEPLQINTTISLCDDAANHVGRVLRMTAGQQLELFDGSNHIFNAEITEATKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
             F   +      +    D+       +  ++++ IQKSVE+G+  I P+++        
Sbjct: 61  NVFVRVLNSTLDDRESPLDIHLGQVMSRGEKMEFTIQKSVELGVNTITPLLSERCGVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I+A EQ     +P I P  +LE      D   +I        S N
Sbjct: 121 GERLEKKLQQWQKIAIAACEQSGRNRIPVIRPVQSLEAWCAENDGAFKINLHPRASESIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPADLKH-----VRLLIGPEGGLSADEIAMTANYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRLGD 241


>gi|161936292|ref|YP_131254.2| 16S ribosomal RNA methyltransferase RsmE [Photobacterium profundum
           SS9]
          Length = 243

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  + +   S D  +++  V+RM+ G  +LLF+G D E+ + IS   K 
Sbjct: 1   MRIPRIYHPELLPSQGKVMLSDDAANHVGRVMRMQVGQEVLLFDGSDAEFPAVISTASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                       + +S +         +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVEVDIQCRNENSIESPLNIHLGQVISRGEKMEFTIQKSVELGVMTITPLISERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ++A EQC    +P I P   LE          ++        S N
Sbjct: 121 AERFEKKLSQWQKIVVAACEQCGRNVIPEIRPVMKLEDWCAEEYDGLKLNLHPRANYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  +EE        F   + LGPR+LR++T A+ A+  
Sbjct: 181 TLPE-----PVTKVRLLIGPEGGLSAEEISMTEQYKFDE-ILLGPRVLRTETTAMTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|307730990|ref|YP_003908214.1| hypothetical protein BC1003_2971 [Burkholderia sp. CCGE1003]
 gi|307585525|gb|ADN58923.1| protein of unknown function DUF558 [Burkholderia sp. CCGE1003]
          Length = 246

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/248 (22%), Positives = 107/248 (43%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV   L      +   D   ++  VLR++ GD+I+LFNG+ GE+ +++  + +   
Sbjct: 1   MPRFFVGTSLSPDGVLQLPDDVVRHVL-VLRLQVGDSIVLFNGEGGEYSAELVTIERRAI 59

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E++         +         +++D++I+K+VE+G  +  P+ T  +      +
Sbjct: 60  TVKVREFRDIEVEPPYRLSLAQGIASGDKMDWLIEKAVELGASSFVPLTTTRSVVRLAGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD--HNCQIVFADETCGSEN 176
                         ++ EQC    LP + P   +   L           +    +  +  
Sbjct: 120 RALRRHTHWEGIVRASCEQCGRNRLPEVMPVREIATWLGAMPRLPAADELRILLSPRASI 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L   A    V +L+GPEGG+ + E+       F   + LGPR+LR++TA +A ++ 
Sbjct: 180 QFSALPTTAPKGPVTVLVGPEGGFSAAEEAAAMDHGF-QAVGLGPRVLRTETAGIAVLSA 238

Query: 237 VQAICGDW 244
           + A+ G W
Sbjct: 239 LAAMWGGW 246


>gi|283835293|ref|ZP_06355034.1| 16S rRNA methyltransferase RsmE [Citrobacter youngae ATCC 29220]
 gi|291068451|gb|EFE06560.1| 16S rRNA methyltransferase RsmE [Citrobacter youngae ATCC 29220]
          Length = 243

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 105/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++   PL   +Q     D  +++  VLRM  G  + LF+G +  +      +   
Sbjct: 1   MRIPRIYHPEPLTSGSQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITHASKK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVDVKVLNVELDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  + +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERIRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|315645962|ref|ZP_07899083.1| hypothetical protein PVOR_10924 [Paenibacillus vortex V453]
 gi|315278723|gb|EFU42037.1| hypothetical protein PVOR_10924 [Paenibacillus vortex V453]
          Length = 256

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 100/253 (39%), Gaps = 17/253 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS--YVGKS 64
           ++R FV        + + +GD   ++  V+R + GD +++ +G   E + +I        
Sbjct: 1   MQRYFVTPAQFEGDRVEITGDDARHITKVMRGRLGDKLIVSDGVSREAMVEIESLEAASV 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E        +  V    S  K ++++ +IQK  E+G  +  P ++  T   +   
Sbjct: 61  FAVVIESMEMRNEPRLQVTIAQSLPKGDKMETVIQKCTEIGAVSFAPFLSERTIVQYDAK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++R R     AAEQ     +P +  P +   LL  +     + F  E        
Sbjct: 121 KEGKRLERWRKIAKEAAEQAHRNRVPSVEQPLSWRNLLAAFSSYDAVCFCYEKEHGSQLR 180

Query: 179 EKLHAI--------AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           + L                + +++GPEGG+  EE         V  + LG RILR +TA 
Sbjct: 181 DVLKPFVEQALPESGSQACLLLVVGPEGGFTEEECRAAEDAGAV-SVGLGRRILRCETAG 239

Query: 231 VAAMALVQAICGD 243
           + A+A      G+
Sbjct: 240 MTALACALYESGE 252


>gi|301027303|ref|ZP_07190649.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 69-1]
 gi|300395109|gb|EFJ78647.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 69-1]
          Length = 255

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 11  LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 70

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 71  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 130

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 131 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 190

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 191 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 244

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 245 TALQVRFGD 253


>gi|330830726|ref|YP_004393678.1| hypothetical protein B565_3026 [Aeromonas veronii B565]
 gi|328805862|gb|AEB51061.1| hypothetical protein B565_3026 [Aeromonas veronii B565]
          Length = 243

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L +      S D  +++  VLRM+ G  + LFNG   ++ + I+ VGK 
Sbjct: 1   MRIPRIYEPATLQVGQTIALSEDGANHIGRVLRMQPGQQLELFNGDGNQYPATIANVGKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                      +S      +       + +++D+ IQKSVE+G+  I P+ +        
Sbjct: 61  SVEVTIDSCDVQSVESPLAIHLGQVISRGDKMDFTIQKSVELGVTCITPLFSERCGVKLP 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                   ++ +   ISA EQC    +P +  P  L+  L       ++        S N
Sbjct: 121 ADRLEKKREQWQKVVISACEQCGRNVVPEVRMPIELDAWLAEETKELKLNLHPRAEYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           V +LIGPEGG  S+E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPV-----PEHGVRLLIGPEGGLSSDEIARTVQEDFKEML-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQCRFGD 241


>gi|288939950|ref|YP_003442190.1| hypothetical protein Alvin_0191 [Allochromatium vinosum DSM 180]
 gi|288895322|gb|ADC61158.1| protein of unknown function DUF558 [Allochromatium vinosum DSM 180]
          Length = 248

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 68/248 (27%), Positives = 107/248 (43%), Gaps = 11/248 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             L RL VD  L    +      Q  +   VLR++    ++LFNG   ++          
Sbjct: 1   MRLTRLHVDLDLRPGAEIDLPSAQARHAVQVLRLERDAPLVLFNGDGHDYSACLVEPGRD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
           +               + D+       K  R+D+ IQK+VE+G+  I P+ TR  Q    
Sbjct: 61  RVRVLVESRGDPELESRLDIHLALGISKGERMDFAIQKAVELGVTRITPLFTRRAQVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  ++  +   ++A EQ     LP + P   LE  L+    +           +E 
Sbjct: 121 GARLDKRLEHWQGVVVAACEQSGRRRLPTLEPAGGLEAWLETAHGDGFAGGLLLDPLAER 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  L A      + +LIGPEGG    E+E      F   + LGPRILR++TA +AA+A+
Sbjct: 181 ALPALPAPE--SGLTLLIGPEGGLDPREREAARRHGF-QGVRLGPRILRTETAPLAAIAV 237

Query: 237 VQAICGDW 244
           +QA+ GD+
Sbjct: 238 IQALWGDF 245


>gi|157377104|ref|YP_001475704.1| hypothetical protein Ssed_3972 [Shewanella sediminis HAW-EB3]
 gi|157319478|gb|ABV38576.1| protein of unknown function DUF558 [Shewanella sediminis HAW-EB3]
          Length = 243

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 103/247 (41%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++      +        +   ++  VLRM  G+ + LFNG   E+L++I    K 
Sbjct: 1   MRIPRIYQASTFTVGMSVALDDEAASHVGRVLRMSSGEQVSLFNGDGNEYLAQIESASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S +   +S +         + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NVQVTILSSVANESESPLHLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I A EQ     +P + P  +LE        + ++           
Sbjct: 121 GERLEKKIHQWQKIVIGACEQSGRSLVPQVRPAMSLEAWSAEQTDSLKLNLHPRAAHGIG 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L         P V +LIGPEGG    E        F T + LGPR+LR++TAA+ A++ 
Sbjct: 181 GLTL-----PEPRVRLLIGPEGGLSETEILMTEQHAF-TDVLLGPRVLRTETAALTAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|325577675|ref|ZP_08147950.1| 16S rRNA methyltransferase RsmE [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160420|gb|EGC72546.1| 16S rRNA methyltransferase RsmE [Haemophilus parainfluenzae ATCC
           33392]
          Length = 263

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 112/251 (44%), Gaps = 14/251 (5%)

Query: 2   KIH-SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           +++   + R++    L  ++  + S D  +++  VLRM E + I LF+G +  + +KI  
Sbjct: 16  RLNIMRIPRIYHPESLKNQSTCQLSEDAANHVGRVLRMTESEQIELFDGSNHIYPAKIIE 75

Query: 61  VGKSIRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT- 117
           V K          +   +     +       + +R+++ IQKSVE+G+  I P+ +    
Sbjct: 76  VSKKAVKVEILGCELSDKESNLSIHLGQVISRGDRMEFTIQKSVELGVNVITPLWSERCG 135

Query: 118 -----QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
                +     + + +   I+A EQC    +P I P   L+      D   ++       
Sbjct: 136 VKLDGERMDKKIQQWQKIAIAACEQCGRNVVPEIRPLMKLQDWCAENDGTLKLNLHPRAQ 195

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
            S  +L  +        V +LIG EGG   +E        F T + LG R+LR++TA++A
Sbjct: 196 YSIKTLPSIPK----EGVRLLIGSEGGLSPQEIVQTEQQGF-TEILLGKRVLRTETASLA 250

Query: 233 AMALVQAICGD 243
           A++ +Q   GD
Sbjct: 251 AISALQICFGD 261


>gi|229597123|ref|YP_001609040.2| 16S ribosomal RNA methyltransferase RsmE [Bartonella tribocorum CIP
           105476]
          Length = 247

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 137/226 (60%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  IL+FNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQTLALNEEIKIEGAQASYLMHVLRMKEGAEILIFNGQDGEWLAKLII 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K     ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG   ++PVIT +TQ 
Sbjct: 61  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGASILQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL+ WD    + F DE   S N L 
Sbjct: 121 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLERWDETQPLFFCDEEHKSPNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
                       +LIGPEGG+  EE+  L   PFV P+SLGPRILR
Sbjct: 181 SFKKRNVTTP-GVLIGPEGGFSEEERSFLKKHPFVVPMSLGPRILR 225


>gi|52141192|ref|YP_085637.1| hypothetical protein BCZK4058 [Bacillus cereus E33L]
 gi|51974661|gb|AAU16211.1| conserved hypothetical protein [Bacillus cereus E33L]
          Length = 249

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     +T  +  GD  H++A V+RM  GD+I    NG+               
Sbjct: 1   MQRYFVEEKHVNETSIRIVGDDVHHIARVMRMSVGDHIYCCVNGRTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTMMKPGQKLLIVFGPEGGLAEEEITVLREHNFV-PCSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|241759555|ref|ZP_04757658.1| RNA methyltransferase, RsmE family [Neisseria flavescens SK114]
 gi|241320112|gb|EER56473.1| RNA methyltransferase, RsmE family [Neisseria flavescens SK114]
          Length = 241

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 110/246 (44%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +VDF L   +  +   +   +L +VLR+K  + I+LFNG    + +    + K   
Sbjct: 1   MPRFYVDFALSPDSVVELPDNVVRHL-NVLRVKNTEEIVLFNGNGKAYPALPEVLEKRCA 59

Query: 67  FKVEYQS--RSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                +          ++  + +     R+D+ +QKSVE+G+  IRPVI+         +
Sbjct: 60  SVRILREEATDNESPLNITLVQAVSAAERMDFTLQKSVELGVAEIRPVISERCVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ     +P + P  T    L+        +        + S 
Sbjct: 120 RAEKRVARWQEIVVSACEQSGRNIVPKVLPLMTYAQALQQLPQETAKLLMSLNRAQKLS- 178

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                      V  ++GPEGG+  +E++      F   ++LG R+LR++TA++AA+A +Q
Sbjct: 179 ---DVRPQSGKVVFMVGPEGGWTEKEEQQAFDAGF-QSVTLGKRVLRTETASLAAIATMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|315295635|gb|EFU54958.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 16-3]
          Length = 253

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 9   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 68

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 69  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 128

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 129 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 188

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 189 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 242

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 243 TALQVRFGD 251


>gi|324005502|gb|EGB74721.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 57-2]
          Length = 261

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 17  LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 76

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 77  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 136

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 137 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 196

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 197 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 250

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 251 TALQVRFGD 259


>gi|300995473|ref|ZP_07181121.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 200-1]
 gi|300304835|gb|EFJ59355.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 200-1]
          Length = 254

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 10  LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 69

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 70  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 129

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 130 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 189

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 190 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 243

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 244 TALQVRFGD 252


>gi|295677690|ref|YP_003606214.1| protein of unknown function DUF558 [Burkholderia sp. CCGE1002]
 gi|295437533|gb|ADG16703.1| protein of unknown function DUF558 [Burkholderia sp. CCGE1002]
          Length = 246

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 110/248 (44%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + R FVD  L          D   ++A VLR++ GD+++LFNG+ GE+ +++  V +   
Sbjct: 1   MPRFFVDALLYPDDVIALPDDVVRHVA-VLRLQPGDSLVLFNGRGGEYGAELVEVERRSA 59

Query: 66  RFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           R K+ E+++        +         +++D++I+K+VE+G     P+ T  +      +
Sbjct: 60  RVKIGEFRAVEVEPPYRLTLAQGIAGGDKMDWLIEKAVELGASGFVPLATARSVVRLTGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                    +    ++ EQC    LP + P   +   L                    S+
Sbjct: 120 RAQRRQQHWQGVVRASCEQCGRNRLPDVTPVGEIGPWLDTLSREPAPDELRLLLSPRASI 179

Query: 179 E--KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               L        V +LIGPEGG  ++E+       F T + LGPR+LR++TA +A +A 
Sbjct: 180 GFAALPDAPPPGGVTLLIGPEGGLSADEEAAAVEQGF-TAVGLGPRVLRTETAGIAVLAA 238

Query: 237 VQAICGDW 244
           + A  G W
Sbjct: 239 LAARWGGW 246


>gi|308188039|ref|YP_003932170.1| UPF0088 protein yggJ [Pantoea vagans C9-1]
 gi|308058549|gb|ADO10721.1| UPF0088 protein yggJ [Pantoea vagans C9-1]
          Length = 243

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I ++     D  +++  VLRM  G  + LF+G +  + ++I++V K 
Sbjct: 1   MRIPRIYHAGPLEIGSEITLDEDASNHVGRVLRMTAGQRLELFDGTNLTFAAEITHVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +S+   ++S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  RVKVSVTESQPDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I    TLE      D   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAIAACEQCGRNRVPEIREAMTLEAWCAEADSGLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSADEIAMTAQHDF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|300940772|ref|ZP_07155318.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 21-1]
 gi|300454472|gb|EFK17965.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 21-1]
          Length = 253

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 9   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 68

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 69  KKSVEVKVLEGQLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 128

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 129 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 188

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 189 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 242

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 243 TALQVRFGD 251


>gi|226328796|ref|ZP_03804314.1| hypothetical protein PROPEN_02696 [Proteus penneri ATCC 35198]
 gi|225201982|gb|EEG84336.1| hypothetical protein PROPEN_02696 [Proteus penneri ATCC 35198]
          Length = 243

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   TQ     +  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPEPLTAGTQTVLGEEASNHVGRVLRMSSGQKLALFDGSNQVFDAEIIESTKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                        K+S +         +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVTVQVNVGIVDDKESPLDLHLGQVLSRGEKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   ISA EQC   ++P + P  +LE      D + ++          N
Sbjct: 121 PSRLEKKHQQWQKIIISACEQCGRNSIPQLMPVMSLEEWCAQDDGSLKLNLHPRANQRIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG   EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVKKVRLLIGPEGGLSPEEIAMTAEHNF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|157844011|gb|ABV84512.1| hypothetical protein RMA_0218 [Rickettsia massiliae MTU5]
          Length = 283

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 138/244 (56%), Gaps = 8/244 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK +    R++++  L   ++ + + D  HY+  VLR+K  D + LFNG DGE+L++I+ 
Sbjct: 41  MKYN----RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQIND 96

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           +GK+    +++ Q +    +S +    + IK ++L   I  + ++G+  I P+ITR  Q 
Sbjct: 97  IGKNNLSVRLKEQLKKPYTESTLTLAVAIIKQDKLMLAINMATQLGITKIIPLITRRCQF 156

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N++R+    I A EQ + LT P I    T++  LK   +N  +++A+E    +NS+ 
Sbjct: 157 RSVNIERLTKCVIEATEQSERLTPPIIEKAITIQDYLK--KNNNLMLYANEHEKEDNSIL 214

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           ++ +     ++ I++GPEGG+ ++E E L S      +SLG  ILR++TAA+ A+  V+ 
Sbjct: 215 RISSSLSNSDITIIVGPEGGFTNDELELLASYKNTKSISLGRNILRAETAAITAIVQVR- 273

Query: 240 ICGD 243
           + G 
Sbjct: 274 LLGR 277


>gi|49475195|ref|YP_033236.1| hypothetical protein BH03960 [Bartonella henselae str. Houston-1]
 gi|49238000|emb|CAF27205.1| hypothetical protein BH03960 [Bartonella henselae str. Houston-1]
          Length = 247

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 141/226 (62%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+  PL I  + K  G Q  Y+ HVLRM+EG  ILLFNG+DGEWL+K+  
Sbjct: 1   MRINYKLKRLFIRQPLVINEKIKIEGPQAFYIVHVLRMQEGAEILLFNGQDGEWLAKLIT 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           + K     ++ +Q R QT  S++ Y F+P+KT RLDYM+QK+VEMG+  ++PVIT +TQ 
Sbjct: 61  IKKKFVVVQLIHQERFQTALSNLIYCFAPLKTARLDYMVQKAVEMGVSVLQPVITHHTQV 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+ +  + A+EQC IL+LP   P  +L  LL  WD    + F DET  S N L 
Sbjct: 121 TRINMARMESNVVEASEQCGILSLPECVPAVSLAELLARWDETQPLFFCDETHKSHNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
                  +    ILIGPEGG+  EE+  L   PFV  + LGPRILR
Sbjct: 181 LFKKREMLAP-GILIGPEGGFSQEERSFLKKHPFVISIPLGPRILR 225


>gi|256015526|ref|YP_003105535.1| hypothetical protein BMI_II755 [Brucella microti CCM 4915]
 gi|261217356|ref|ZP_05931637.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220586|ref|ZP_05934867.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261318573|ref|ZP_05957770.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320229|ref|ZP_05959426.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323007|ref|ZP_05962204.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750457|ref|ZP_05994166.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261756957|ref|ZP_06000666.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265986373|ref|ZP_06098930.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265996067|ref|ZP_06108624.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|255998186|gb|ACU49873.1| hypothetical protein BMI_II755 [Brucella microti CCM 4915]
 gi|260919170|gb|EEX85823.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922445|gb|EEX89013.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292919|gb|EEX96415.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297796|gb|EEY01293.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298987|gb|EEY02484.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261736941|gb|EEY24937.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740210|gb|EEY28136.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262550364|gb|EEZ06525.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264658570|gb|EEZ28831.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 242

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 114/239 (47%), Positives = 154/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|292493337|ref|YP_003528776.1| hypothetical protein Nhal_3352 [Nitrosococcus halophilus Nc4]
 gi|291581932|gb|ADE16389.1| protein of unknown function DUF558 [Nitrosococcus halophilus Nc4]
          Length = 243

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++   PL I +          ++  VLR++ G  + LF+G+  E+  + +     
Sbjct: 1   MRVPRIYSSLPLSIGSSVVLDERALQHVVRVLRLRAGAELWLFDGRGTEYRAVLETVEKR 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
            +    +E   R+     D+       +  R+DY +QK+VE+G+  I P+ T  +     
Sbjct: 61  SAEARILERMERNVESPLDIILGQGISRGERMDYALQKAVELGVSGIVPLFTERSAVHLS 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +++   +                 P       L  +  +C    A       +   K
Sbjct: 121 GERLEKRLRHWRGVVISACEQCGRNYTPGVDTPRSLAAFLGDCHAGLAVLLDPRSHRPLK 180

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                    + +LIGPEGG    E +      F+  +SLGPR+LR++TA VAA+  +Q +
Sbjct: 181 TLPSPLGKRLILLIGPEGGLSEVEVKEAQQAGFI-DVSLGPRVLRTETATVAALTALQLL 239

Query: 241 CGD 243
            GD
Sbjct: 240 WGD 242


>gi|149186955|ref|ZP_01865263.1| hypothetical protein ED21_24936 [Erythrobacter sp. SD-21]
 gi|148829344|gb|EDL47787.1| hypothetical protein ED21_24936 [Erythrobacter sp. SD-21]
          Length = 239

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 80/230 (34%), Positives = 123/230 (53%), Gaps = 4/230 (1%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSIR 66
            RLFV   L         G+Q +YLA V+R+ +GD ++L +   GEW+++++    + + 
Sbjct: 13  PRLFVSDELGTGRIVCIEGNQANYLARVMRVGKGDAVILCDDVTGEWIARVTEAGKRRVE 72

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
            KVE   R + +  D     + +K +R D +++KS E+G+ AI PVITR       N +R
Sbjct: 73  LKVEDHLRPREEVPDFWLCPALLKKDRFDVVLEKSTELGVAAIHPVITRRCVADKLNGER 132

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
             T    AAEQC    LP +  P  L+ LL++W  +  + FADE  G   +         
Sbjct: 133 ASTIVTEAAEQCARTALPQVAEPVKLDALLRDWPEDRILFFADEEGGEPAAD---AFCYA 189

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               A+L GPEGG+   E+  + + P   P+SLGPRILR +TAA+A +A+
Sbjct: 190 DGPAALLTGPEGGFDDAERAAIRAHPAARPISLGPRILRGETAALAGIAV 239


>gi|229104942|ref|ZP_04235598.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-28]
 gi|228678436|gb|EEL32657.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-28]
          Length = 249

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVSEAKIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFVE 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEVSSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYDVCLVAYEEVAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV   SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFVL-CSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|88705487|ref|ZP_01103198.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700577|gb|EAQ97685.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 245

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 13/244 (5%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R F    L   +      +   ++A  LRM+ GD++ LF+G   E   +IS + KS   
Sbjct: 4   PRFFTAQTLSEGSTLTLEKEPSRHIAKALRMRAGDSLCLFDGSGIEAHGEISDLDKSQVS 63

Query: 68  KVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
            +    Q  ++    D   I +  + +R+D ++QK+ E+G+  I P+I+           
Sbjct: 64  VIVKSIQQPTRESPLDTVLIIALSRGDRMDTVVQKATELGVTEIWPMISERTGVRLDETR 123

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                       ISA EQC    LP +  PT+ E  L+                   S  
Sbjct: 124 LARKRQHWERIAISACEQCGRNRLPTVETPTSFEETLQRAAKGDDS----LRLILHTSAH 179

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
                 H  ++ +L+GPEGG+  EE        F   L +GPRILR++TA +  +AL QA
Sbjct: 180 PSPLPTHCKSLTLLVGPEGGFSDEEVTAALDQGFC-ALQMGPRILRTETAPLVGLALAQA 238

Query: 240 ICGD 243
             GD
Sbjct: 239 RWGD 242


>gi|300921287|ref|ZP_07137656.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 115-1]
 gi|300411749|gb|EFJ95059.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 115-1]
          Length = 255

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 11  LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 70

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E +   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 71  KKSVEVKVLEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 130

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 131 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMVLEAWCAEQDEGLKLNLHPRASNS 190

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 191 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 244

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 245 TALQVRFGD 253


>gi|228902836|ref|ZP_04066980.1| RNA methyltransferase, RsmE [Bacillus thuringiensis IBL 4222]
 gi|228856792|gb|EEN01308.1| RNA methyltransferase, RsmE [Bacillus thuringiensis IBL 4222]
          Length = 249

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD I    NGK               
Sbjct: 1   MQRYFVEEKHVSEAKVRIVGDDVHHIARVMRMTAGDQIYCCVNGKTAVCSIDEITSEFIN 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEIPEVHAPASFKQLLTMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV P SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFV-PSSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|229098782|ref|ZP_04229720.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-29]
 gi|228684626|gb|EEL38566.1| RNA methyltransferase, RsmE [Bacillus cereus Rock3-29]
          Length = 249

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKYVSEAKIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFVE 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYDVCLVAYEEVAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV   SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFVL-CSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|304316647|ref|YP_003851792.1| hypothetical protein Tthe_1189 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778149|gb|ADL68708.1| protein of unknown function DUF558 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 240

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query: 13  DFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ 72
                     + +GD  H++  VLR K G  +++ NGK+   +S +     S+  K+  +
Sbjct: 2   KNEDIKDGIVRINGDDAHHIIDVLRFKIGTKLIISNGKNQYIVSILDIENSSVILKIIEE 61

Query: 73  SRSQTK-QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNTHYNMD 125
                +   ++       K++++D +IQK  E+G+  I PV T +       +N +  ++
Sbjct: 62  YNQVVESPINITLYQGLPKSDKMDLIIQKCTEIGIKKIVPVETEFSTIKIKEKNIYNKIN 121

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R +  ++ A++Q     +P +  P   +  L++ +     +   E   +    + L    
Sbjct: 122 RWKKISLEASKQSGRSIVPDVLVPVGFKDALESLNEFDLCLIPYEKETNMRLKDVLKKNF 181

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
           +  N+ + IGPEGG+   E         + P++LGPRILR++TA +   +++    GD
Sbjct: 182 NAKNICVFIGPEGGFSENEIMAAIEYGAI-PVTLGPRILRTETAGIVTSSIILYELGD 238


>gi|284007789|emb|CBA73643.1| ribosomal RNA small subunit methyltransferase E [Arsenophonus
           nasoniae]
          Length = 245

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 114/249 (45%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL      + S +  ++++ VLRM  G NI LF+G +  ++ +I    
Sbjct: 1   MTMRVPRIYHPNPLESGAIIQLSDNATNHVSRVLRMSVGQNIELFDGSNSIFIGQILEAN 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT 120
           K         +    ++S +         +  ++++ IQKSVE+G+  I P+++      
Sbjct: 61  KKSVKIQLGLATIANRESPLDLHLGQVISRGEKMEFTIQKSVELGVNIITPLLSERCNVK 120

Query: 121 ------HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
                      + ++  ISA EQC    +P I P   +E      D   +I    +   S
Sbjct: 121 LDPRRLSKKQQQWQSIAISACEQCGRNKIPLIRPVMPIEAWCMEKDDALKINLHPKAQSS 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L     +A +  + +LIGPEGG   +E     +  F T + LGPRILR++T A+ A+
Sbjct: 181 INTL-----LASVNKIRLLIGPEGGLSPDEIIMTTNYQF-TNILLGPRILRTETTALTAI 234

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 235 TALQVRFGD 243


>gi|186477349|ref|YP_001858819.1| 16S ribosomal RNA methyltransferase RsmE [Burkholderia phymatum
           STM815]
 gi|184193808|gb|ACC71773.1| protein of unknown function DUF558 [Burkholderia phymatum STM815]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/254 (21%), Positives = 104/254 (40%), Gaps = 13/254 (5%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+    + R FV  P           +   ++  VLR++ GD + LFNG  GE+ ++I  
Sbjct: 1   MR-TFLMPRFFVGTPFKTDDIVSLPDEVNRHV-RVLRLQPGDTVSLFNGDGGEYGAEIVD 58

Query: 61  VGKSIRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT- 117
           + +       V ++         +        ++++D++I+K+ E+G     P+ T  + 
Sbjct: 59  MDRHGTIVRIVGFRDIECEPPYRLTLAQGIAGSDKMDWLIEKATELGACEFVPLTTTRSV 118

Query: 118 -----QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHN--CQIVFADE 170
                +         +    ++ EQC    LP + P   L   L           +    
Sbjct: 119 VRLAGERAQRRQVHWQRIVQASCEQCGRNRLPQVMPTRELATWLSTMPKEPVDGELRLLL 178

Query: 171 TCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           +  +      L          +L+GPEGG+ + E+    +  F T + LGPR+LR++TA 
Sbjct: 179 SPRASVPFSALPVEPPKVRALVLVGPEGGFSAAEEAAAAAHGF-TAVGLGPRVLRTETAG 237

Query: 231 VAAMALVQAICGDW 244
           +A ++ + A  G W
Sbjct: 238 IAVLSALAARWGGW 251


>gi|293394489|ref|ZP_06638785.1| 16S rRNA methyltransferase RsmE [Serratia odorifera DSM 4582]
 gi|291422954|gb|EFE96187.1| 16S rRNA methyltransferase RsmE [Serratia odorifera DSM 4582]
          Length = 243

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+    PL   T+   S D  +++  VLRM  G  + LF+G +  + ++I+ V K 
Sbjct: 1   MRIPRIHHPEPLRSDTEIVLSEDAANHVGRVLRMSPGQLLQLFDGSNQVFDAEITRVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    R + ++S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVQVQIGAGRQEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVNTITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +  I P   LE      D + ++        S N
Sbjct: 121 GERLAKKLQQWQKIAIAACEQCGRNRIADIRPAMPLEAWCAEQDDSLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        + +V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLAL-----PVNHVRLLIGPEGGLSADEIAMTSAHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|148980482|ref|ZP_01816079.1| hypothetical protein VSWAT3_21045 [Vibrionales bacterium SWAT-3]
 gi|145961207|gb|EDK26521.1| hypothetical protein VSWAT3_21045 [Vibrionales bacterium SWAT-3]
          Length = 243

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     +          D   ++  VLRMKEG  +LLF+G   E+ + I+ V K 
Sbjct: 1   MRIPRIHHPERIHQLGSLALGEDAAGHVGRVLRMKEGQEVLLFDGSGTEFPATIAEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVTVNVTERIERSSESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   T+P I P   LE          ++        S N
Sbjct: 121 AKRFEKKLAQWQKIAIAACEQCGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      I  V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PISKVRLLIGPEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|52424293|ref|YP_087430.1| hypothetical protein MS0238 [Mannheimia succiniciproducens MBEL55E]
 gi|52306345|gb|AAU36845.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 243

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 105/247 (42%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L      + + +  +++  VLRM+ G+ + LF+G +  + + I    K 
Sbjct: 1   MRIPRIYHPDSLTNIKTCRLTDEAANHVGRVLRMQAGERLELFDGSNHVYTAVILQADKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  + Q   +     +       +  R+++ +QKSVE+G+  I P+ +        
Sbjct: 61  SVTAEIRDCQLDDRESHLKIHLGQVISRGERMEFTVQKSVELGVNVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ++A EQC    +P I P   L+      D   ++        S  
Sbjct: 121 AERMDKKIQQWQKIAVAACEQCGRNIVPEIRPMMKLQDWCAEQDGMLKLNLHPRAKYSIQ 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG   +E        F T + LG R+LR++TA++ A+  
Sbjct: 181 TLPDIPA----EGVRLLIGSEGGLSPQEIAQTERQGF-TEVLLGKRVLRTETASLVAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQLCFGD 242


>gi|260756485|ref|ZP_05868833.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759917|ref|ZP_05872265.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763155|ref|ZP_05875487.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882306|ref|ZP_05893920.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216206|ref|ZP_05930487.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|62197593|gb|AAX75892.1| conserved hypothetical protein TIGR00046 [Brucella abortus bv. 1
           str. 9-941]
 gi|82939654|emb|CAJ12643.1| Conserved hypothetical protein 46:Protein of unknown function
           DUF558 [Brucella melitensis biovar Abortus 2308]
 gi|189021229|gb|ACD73950.1| Conserved hypothetical protein 46 [Brucella abortus S19]
 gi|260670235|gb|EEX57175.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673576|gb|EEX60397.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676593|gb|EEX63414.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260871834|gb|EEX78903.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917813|gb|EEX84674.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 242

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 113/239 (47%), Positives = 153/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVLRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH  PFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRQPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|300723910|ref|YP_003713221.1| hypothetical protein XNC1_3049 [Xenorhabdus nematophila ATCC 19061]
 gi|297630438|emb|CBJ91103.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 243

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 115/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R++   PL I+T+   S D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRTPRIYHPEPLSIETEIYLSDDAANHVGRVLRMSLGQELQLFDGSNQIFNAEITETSKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +        ++       +  ++++ IQKSVE+G+  I P+++        
Sbjct: 61  TVKIRILNGKFSDHESPLNLHLGQVMSRGEKMEFTIQKSVELGVSTITPLLSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE   K  D + ++        S N
Sbjct: 121 AERLEKKLQQWKKIAISACEQCGRNRIPEIRPVMSLEAWCKENDDSLKLNLHPRASQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE +      F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLTL-----PVKKVRLLIGPEGGLSAEEIDMTAKYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|222084972|ref|YP_002543501.1| hypothetical protein Arad_1026 [Agrobacterium radiobacter K84]
 gi|221722420|gb|ACM25576.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 95/226 (42%), Positives = 143/226 (63%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +  ++RLFV   +      +A  +Q++YLA+VLRM++G  +L+FNG+DGEW ++IS+
Sbjct: 1   MRANFRMQRLFVVSDIKANAGIEADQEQFNYLANVLRMEDGAELLIFNGRDGEWKARISF 60

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
             +         ++R Q   SD+ Y+F+P+K  RLDY++QK+VEMG G ++PV+T++ Q 
Sbjct: 61  PSRKRILMTPIEETRPQPAPSDLHYLFAPLKVGRLDYLVQKAVEMGAGLLQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N+D+VR   I AAEQC IL +P +  P  L  LL+ W    +I++ DE    +N L 
Sbjct: 121 KITNLDKVRANVIEAAEQCGILGIPDVAEPVKLADLLERWPRERRIIYCDEGDAGQNPLP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L  I     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 LLAKITEKH-LALLVGPEGGFSEEERALLRSLDFVTAIPLGPRILR 225


>gi|302391394|ref|YP_003827214.1| hypothetical protein Acear_0607 [Acetohalobium arabaticum DSM 5501]
 gi|302203471|gb|ADL12149.1| protein of unknown function DUF558 [Acetohalobium arabaticum DSM
           5501]
          Length = 248

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 111/245 (45%), Gaps = 9/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV+     + Q + +GD   ++   LR+  GD I + +GK   ++ +I+  G  + 
Sbjct: 1   MHHFFVEPDYITEGQVRITGDDVKHITKSLRLGPGDEISVADGKGRRYMVEIAETGNGLV 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                +        + +V  +    K+ ++D +++K  E+G+  + P  T+ +       
Sbjct: 61  LGNIKEEFRSKVEPEVEVTLLQGLPKSRKMDLIVEKCTELGIDKVIPAETKRSVVKLKPS 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                  R +    +AA+Q     +P +     L  L +       I+   E   + +  
Sbjct: 121 KAKRRRKRWQRKAEAAAKQSKRARIPAVGQLMNLTDLSEIATDYDLILLPWEEESTSSVK 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L + A I  V I+IGPEGG+ +EE ET   L     +SLGPRILR++TA +  ++LV 
Sbjct: 181 EVLGSAAAIEKVLIIIGPEGGFTAEEVETAKQLG-AKSVSLGPRILRTETAGLTTLSLVL 239

Query: 239 AICGD 243
              GD
Sbjct: 240 YELGD 244


>gi|296444351|ref|ZP_06886316.1| protein of unknown function DUF558 [Methylosinus trichosporium
           OB3b]
 gi|296257998|gb|EFH05060.1| protein of unknown function DUF558 [Methylosinus trichosporium
           OB3b]
          Length = 247

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 102/238 (42%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
           +RLFVD  L    +    GD+ +YL +VLR++EGD +LLFNG+DGEWL+++  V +    
Sbjct: 9   QRLFVDERLEAGARMIPDGDRLNYLLNVLRLREGDGVLLFNGRDGEWLARLEKVTRRSAE 68

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
                ++R QT   D+ Y F+P+K  RLDYM QK+ EMG   + P+ITR TQ    N+ R
Sbjct: 69  LVATTRAREQTAPCDLHYCFAPLKHARLDYMAQKATEMGASRLVPIITRRTQARRVNLTR 128

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R   I AAEQC +L +P +    +L+  L     +  +VF DE     + +  L A   
Sbjct: 129 LRANAIEAAEQCGVLGVPEVAEEVSLDAFLAGLCASRLLVFCDEAAEIADPVAALRAAPE 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
              +A++IGPEGG+  EE+  + S   V  L+LGPRILR+DTAAVAA+A+VQ   GDW
Sbjct: 189 HEGIAVIIGPEGGFDEEERRAILSAGKVARLALGPRILRADTAAVAALAIVQTTIGDW 246


>gi|260913267|ref|ZP_05919749.1| 16S rRNA methyltransferase RsmE [Pasteurella dagmatis ATCC 43325]
 gi|260632854|gb|EEX51023.1| 16S rRNA methyltransferase RsmE [Pasteurella dagmatis ATCC 43325]
          Length = 244

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   T  + S D  +++  VLRM+ G+ + LF+G +  + + I+ V K 
Sbjct: 1   MRIPRIYHPTSLQGITFCELSEDAANHVGRVLRMQVGEQLELFDGSNHTYAATITQVSKK 60

Query: 65  IRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q   +     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  AVTVEILSQQLDDRESHLKIHLGQVISRGERMEFTIQKSVELGVSVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I+A EQC    +P I P   L+      D   ++    +   S  
Sbjct: 121 ADRMEKKIQQWQKIAIAACEQCGRNVIPEIRPLMRLQDWCAEKDGALKLNLHPKAQYSIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  +        V +LIG EGG   +E        F T + LG R+LR++TA++AA++ 
Sbjct: 181 TLPAIPE----EGVRLLIGSEGGLSPQEISQTEQQGF-TEVLLGKRVLRTETASLAAISA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQICFGD 242


>gi|229075985|ref|ZP_04208958.1| RNA methyltransferase, RsmE [Bacillus cereus Rock4-18]
 gi|228707097|gb|EEL59297.1| RNA methyltransferase, RsmE [Bacillus cereus Rock4-18]
          Length = 249

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 102/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKHVSEAKIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFVE 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G+ A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGVAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV   SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFVL-CSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|322514739|ref|ZP_08067765.1| 16S rRNA methyltransferase RsmE [Actinobacillus ureae ATCC 25976]
 gi|322119334|gb|EFX91450.1| 16S rRNA methyltransferase RsmE [Actinobacillus ureae ATCC 25976]
          Length = 248

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 114/252 (45%), Gaps = 14/252 (5%)

Query: 1   MKIH-SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS 59
           MK +   + R++    L  +T+   S D  +++  VLRM EGD I+LF+G +  + + + 
Sbjct: 1   MKEYLMRIPRIYHPELLANQTRCILSEDATNHVGRVLRMTEGDQIILFDGSNHIFHATLQ 60

Query: 60  YVGKSIRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT 117
            VGK          +  ++     +       + +R+++ IQKSVE+G+  I P+ +   
Sbjct: 61  AVGKKQIIAKIDSSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLCSERC 120

Query: 118 ------QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET 171
                 +     + + +   I+A EQC    +P I P   L    K  D   ++      
Sbjct: 121 GVKLNDERQDKKLQQWQKIAIAACEQCGRNEIPEIRPFMKLTDWCKEQDDMLKLNLHPRA 180

Query: 172 CGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             +   L  +        V +LIG EGG  +EE     +  F T + LG R+LR++TA++
Sbjct: 181 KYTIRQLPNVPE----AGVRLLIGSEGGLSAEEIAMTETEGF-TEVLLGKRVLRTETASL 235

Query: 232 AAMALVQAICGD 243
            A+  +Q   GD
Sbjct: 236 TAITALQVCFGD 247


>gi|163675614|gb|ABY39724.1| conserved hypothetical protein [Brucella suis ATCC 23445]
          Length = 242

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 114/239 (47%), Positives = 154/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 LGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|225686530|ref|YP_002734502.1| 16S ribosomal RNA methyltransferase RsmE [Brucella melitensis ATCC
           23457]
 gi|225642635|gb|ACO02548.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
          Length = 242

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 114/239 (47%), Positives = 154/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQALRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|229117808|ref|ZP_04247172.1| RNA methyltransferase, RsmE [Bacillus cereus Rock1-3]
 gi|228665605|gb|EEL21083.1| RNA methyltransferase, RsmE [Bacillus cereus Rock1-3]
          Length = 249

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGKSI 65
           ++R FV+     + + +  GD  H++A V+RM  GD+I    NGK               
Sbjct: 1   MQRYFVEEKHVSEAKIRIVGDDVHHIARVMRMSAGDHIYCCVNGKTAVCSIDEITSEFVE 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
              VE+   S      V       K ++L+ + QK  E+G  A  P     +      + 
Sbjct: 61  TAIVEWVEASSELPVFVTIASGLPKGDKLELIFQKGTELGAAAFLPFQASRSIVKWDAKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE---- 175
               ++R+R     AAEQ     +P ++ P + + LL         + A E    +    
Sbjct: 121 ADKKVERLRKIVKEAAEQSHRSEVPEVHAPASFKQLLSMSGEYDVCLVAYEEEAKQGEKS 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N  + L  +     + I+ GPEGG   EE   L    FV   SLGPRILR++TA + A++
Sbjct: 181 NFAKALTTMKPGQKLLIVFGPEGGLAEEEITALREHKFVL-CSLGPRILRTETAPLYALS 239

Query: 236 LVQAIC 241
                 
Sbjct: 240 AASYHF 245


>gi|237729877|ref|ZP_04560358.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908483|gb|EEH94401.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 243

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 105/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++   P+   +Q     D  +++  VLRM  G  + LF+G +  +      +   
Sbjct: 1   MRIPRIYHPEPITSGSQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITHASKK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVDVKVLNAELDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  + +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERIRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|298369579|ref|ZP_06980896.1| RNA methyltransferase, RsmE family [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282136|gb|EFI23624.1| RNA methyltransferase, RsmE family [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 241

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 57/246 (23%), Positives = 113/246 (45%), Gaps = 14/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK--ISYVGKS 64
           + R ++   L          +   +L HVLR+K  + I+LFNG    + ++  +    ++
Sbjct: 1   MPRFYLSEVLSAGRAVSLPDNVVRHL-HVLRLKPDEEIVLFNGDGKAYPARLGVLEKRRA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  +        ++  + +     R+D+ +QKSVE+G+G IRPV++         +
Sbjct: 60  TAEILREEEADNESPLNITLVQAVSSGERMDFTLQKSVELGVGEIRPVLSERCVVRLDGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   +SA EQ    T+P + P  + +  L+        +         N+ 
Sbjct: 120 RAAKRVARWQEIVVSACEQSGRNTVPQVLPLVSYQEALRQMPSEKTKLLM----SVRNAQ 175

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +          +  ++GPEGG+   E++      F   ++LGPR+LR++TA++AA+A +Q
Sbjct: 176 KLNRITPSSDGLIFMVGPEGGWTESEEQQAFGAGF-QAVTLGPRVLRTETASLAAIAAMQ 234

Query: 239 AICGDW 244
            + GD+
Sbjct: 235 TLWGDF 240


>gi|167754795|ref|ZP_02426922.1| hypothetical protein CLORAM_00299 [Clostridium ramosum DSM 1402]
 gi|237735918|ref|ZP_04566399.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|167705627|gb|EDS20206.1| hypothetical protein CLORAM_00299 [Clostridium ramosum DSM 1402]
 gi|229381663|gb|EEO31754.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 245

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 107/241 (44%), Gaps = 9/241 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F++  L  K Q     D  H++  V+R   GD I+  +     +   I  +   + 
Sbjct: 1   MQRYFINEDLTSKQQLILPDDDLHHVKKVMRNINGDEIICIDNAGQVYYGVIEDIEIGLV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY---- 122
              +    +     ++  +++  K ++ + ++QK+ E+G+  I P+ T+           
Sbjct: 61  KIDKRLEENNELDVEITLVYALPKGDKFELVLQKATELGVKRIVPIQTKRCVVKMDEQKF 120

Query: 123 --NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              + R R     AAEQ     +P I     LE L +    +  + F +     E+ + K
Sbjct: 121 AKKITRYRKILKEAAEQSWRNFIPEITNVIKLEQLDQYLGDHNLVAFEELAKQGEHMVLK 180

Query: 181 --LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L  ++    + I++G EGG+  +E E ++ L  +   SLG RILRS+TA +  ++++ 
Sbjct: 181 QTLDQLSSGDKITIVVGSEGGFELDEIEMMNKLG-IKACSLGKRILRSETAPLYFLSVIG 239

Query: 239 A 239
            
Sbjct: 240 Y 240


>gi|254519874|ref|ZP_05131930.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
 gi|226913623|gb|EEH98824.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
          Length = 250

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 103/247 (41%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + F      I  + K  GD   +L  VLR+ EGD I+L N    E+L+ IS + K   
Sbjct: 1   MHKFFTPKENFIDNEAKILGDDVKHLYKVLRLNEGDKIVLNNCDGEEFLASISTITKQEV 60

Query: 67  FKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN----T 120
                E    +      +       K  ++D ++QK  E+G+    P +T          
Sbjct: 61  IVEIEEKLQINNESSVKIYLFQGLPKAQKMDLIVQKGTELGITEFIPTLTDRVDIKLKGD 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +DR+    + AA+Q     +P +  P + +  L   ++   ++   E   +      
Sbjct: 121 FKKLDRLNRIALEAAKQSKRSIIPNVVDPISFDEALDKMNNLDMVIVPYENAENFGIKTL 180

Query: 181 LHA----IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            +        I  V IL+GPEGG+  +E   L        ++LG RILR++TA   A +L
Sbjct: 181 FNHTDLDRTKIKTVGILVGPEGGFEEDEINRLKENG-AYIVTLGSRILRTETAGFVATSL 239

Query: 237 VQAICGD 243
           VQ   GD
Sbjct: 240 VQYELGD 246


>gi|194431744|ref|ZP_03064035.1| 16S rRNA methyltransferase RsmE [Shigella dysenteriae 1012]
 gi|194420100|gb|EDX36178.1| 16S rRNA methyltransferase RsmE [Shigella dysenteriae 1012]
 gi|320181049|gb|EFW55970.1| Ribosomal RNA small subunit methyltransferase E [Shigella boydii
           ATCC 9905]
 gi|332086875|gb|EGI92011.1| RNA methyltransferase family protein [Shigella boydii 5216-82]
 gi|332087723|gb|EGI92850.1| RNA methyltransferase family protein [Shigella dysenteriae 155-74]
          Length = 243

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVKVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEHDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|30064262|ref|NP_838433.1| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 2a str.
           2457T]
 gi|38704129|ref|NP_311849.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. Sakai]
 gi|56480218|ref|NP_708711.2| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 2a str.
           301]
 gi|89109723|ref|AP_003503.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|90111515|ref|NP_417421.4| 16S rRNA m(3)U1498 methyltransferase, SAM-dependent [Escherichia
           coli str. K-12 substr. MG1655]
 gi|110643095|ref|YP_670825.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli 536]
 gi|110806854|ref|YP_690374.1| 16S ribosomal RNA methyltransferase RsmE [Shigella flexneri 5 str.
           8401]
 gi|117625173|ref|YP_854161.1| hypothetical protein APECO1_3575 [Escherichia coli APEC O1]
 gi|157156709|ref|YP_001464298.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli E24377A]
 gi|157162405|ref|YP_001459723.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli HS]
 gi|161367531|ref|NP_289518.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           EDL933]
 gi|161486126|ref|NP_755407.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli CFT073]
 gi|162138377|ref|YP_542314.2| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UTI89]
 gi|168747562|ref|ZP_02772584.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753898|ref|ZP_02778905.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760088|ref|ZP_02785095.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766953|ref|ZP_02791960.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773415|ref|ZP_02798422.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781805|ref|ZP_02806812.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785804|ref|ZP_02810811.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC869]
 gi|168797521|ref|ZP_02822528.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC508]
 gi|170018813|ref|YP_001723767.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli ATCC
           8739]
 gi|170082498|ref|YP_001731818.1| hypothetical protein ECDH10B_3121 [Escherichia coli str. K-12
           substr. DH10B]
 gi|191171800|ref|ZP_03033346.1| 16S rRNA methyltransferase RsmE [Escherichia coli F11]
 gi|195937084|ref|ZP_03082466.1| 16S rRNA m3U1498 methyltransferase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807472|ref|ZP_03249809.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813470|ref|ZP_03254799.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818613|ref|ZP_03258933.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396394|ref|YP_002272426.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4115]
 gi|217326972|ref|ZP_03443055.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           TW14588]
 gi|218555505|ref|YP_002388418.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli IAI1]
 gi|218559937|ref|YP_002392850.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli S88]
 gi|218691070|ref|YP_002399282.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli ED1a]
 gi|218706461|ref|YP_002413980.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UMN026]
 gi|238902068|ref|YP_002927864.1| hypothetical protein BWG_2668 [Escherichia coli BW2952]
 gi|253772216|ref|YP_003035047.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254794898|ref|YP_003079735.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. TW14359]
 gi|256024545|ref|ZP_05438410.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia sp. 4_1_40B]
 gi|261226258|ref|ZP_05940539.1| hypothetical protein EscherichiacoliO157_16928 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256484|ref|ZP_05949017.1| hypothetical protein EscherichiacoliO157EcO_11691 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284267|ref|YP_003501085.1| hypothetical protein G2583_3605 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406453|ref|ZP_06650379.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1412]
 gi|293412306|ref|ZP_06655029.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B354]
 gi|293416207|ref|ZP_06658847.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B185]
 gi|298382190|ref|ZP_06991787.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1302]
 gi|300947676|ref|ZP_07161845.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 116-1]
 gi|306812150|ref|ZP_07446348.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli NC101]
 gi|307139631|ref|ZP_07498987.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli H736]
 gi|312964791|ref|ZP_07779031.1| RNA methyltransferase family protein [Escherichia coli 2362-75]
 gi|331664529|ref|ZP_08365435.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA143]
 gi|84027952|sp|P0AGL8|RSME_ECOL6 RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|84027953|sp|P0AGL7|RSME_ECOLI RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|84027954|sp|P0AGL9|RSME_SHIFL RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|30042519|gb|AAP18243.1| hypothetical protein S3141 [Shigella flexneri 2a str. 2457T]
 gi|56383769|gb|AAN44418.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|85675756|dbj|BAE77009.1| hypothetical protein [Escherichia coli str. K12 substr. W3110]
 gi|87082186|gb|AAC75983.2| 16S rRNA m(3)U1498 methyltransferase, SAM-dependent [Escherichia
           coli str. K-12 substr. MG1655]
 gi|110344687|gb|ABG70924.1| hypothetical protein YggJ [Escherichia coli 536]
 gi|110616402|gb|ABF05069.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115514297|gb|ABJ02372.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157068085|gb|ABV07340.1| conserved hypothetical protein TIGR00046 [Escherichia coli HS]
 gi|157078739|gb|ABV18447.1| conserved hypothetical protein TIGR00046 [Escherichia coli E24377A]
 gi|169753741|gb|ACA76440.1| protein of unknown function DUF558 [Escherichia coli ATCC 8739]
 gi|169890333|gb|ACB04040.1| predicted protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187770823|gb|EDU34667.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017770|gb|EDU55892.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000650|gb|EDU69636.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358446|gb|EDU76865.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363856|gb|EDU82275.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369285|gb|EDU87701.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373969|gb|EDU92385.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC869]
 gi|189379845|gb|EDU98261.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC508]
 gi|190907835|gb|EDV67428.1| 16S rRNA methyltransferase RsmE [Escherichia coli F11]
 gi|208727273|gb|EDZ76874.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734747|gb|EDZ83434.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738736|gb|EDZ86418.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157794|gb|ACI35227.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           EC4115]
 gi|217319339|gb|EEC27764.1| 16S rRNA methyltransferase RsmE [Escherichia coli O157:H7 str.
           TW14588]
 gi|218362273|emb|CAQ99894.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218366706|emb|CAR04463.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218428634|emb|CAR09563.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218433558|emb|CAR14461.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|238863019|gb|ACR65017.1| predicted protein [Escherichia coli BW2952]
 gi|253323260|gb|ACT27862.1| protein of unknown function DUF558 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254594298|gb|ACT73659.1| predicted protein [Escherichia coli O157:H7 str. TW14359]
 gi|260448011|gb|ACX38433.1| protein of unknown function DUF558 [Escherichia coli DH1]
 gi|284922889|emb|CBG35978.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290764140|gb|ADD58101.1| hypothetical protein G2583_3605 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291426459|gb|EFE99491.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1412]
 gi|291432396|gb|EFF05378.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B185]
 gi|291469077|gb|EFF11568.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B354]
 gi|294490749|gb|ADE89505.1| conserved hypothetical protein TIGR00046 [Escherichia coli IHE3034]
 gi|298277330|gb|EFI18846.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           FVEC1302]
 gi|300452722|gb|EFK16342.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 116-1]
 gi|305854188|gb|EFM54626.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli NC101]
 gi|307554928|gb|ADN47703.1| 16S rRNA methyltransferase RsmE [Escherichia coli ABU 83972]
 gi|307625480|gb|ADN69784.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli UM146]
 gi|312290347|gb|EFR18227.1| RNA methyltransferase family protein [Escherichia coli 2362-75]
 gi|313647996|gb|EFS12442.1| RNA methyltransferase family protein [Shigella flexneri 2a str.
           2457T]
 gi|315137543|dbj|BAJ44702.1| hypothetical protein ECDH1ME8569_2846 [Escherichia coli DH1]
 gi|315614893|gb|EFU95531.1| RNA methyltransferase family protein [Escherichia coli 3431]
 gi|320189294|gb|EFW63953.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. EC1212]
 gi|320195065|gb|EFW69694.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           WV_060327]
 gi|320640592|gb|EFX10131.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. G5101]
 gi|320656635|gb|EFX24531.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662154|gb|EFX29555.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667230|gb|EFX34193.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H7
           str. LSU-61]
 gi|323188660|gb|EFZ73945.1| RNA methyltransferase family protein [Escherichia coli RN587/1]
 gi|323941968|gb|EGB38147.1| RsmE family protein RNA methyltransferase [Escherichia coli E482]
 gi|323951616|gb|EGB47491.1| RsmE family protein RNA methyltransferase [Escherichia coli H252]
 gi|323957330|gb|EGB53052.1| RsmE family protein RNA methyltransferase [Escherichia coli H263]
 gi|323960761|gb|EGB56382.1| RsmE family protein RNA methyltransferase [Escherichia coli H489]
 gi|324115039|gb|EGC09004.1| RsmE family protein RNA methyltransferase [Escherichia fergusonii
           B253]
 gi|325498503|gb|EGC96362.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia fergusonii
           ECD227]
 gi|326338967|gb|EGD62782.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. 1044]
 gi|326343152|gb|EGD66920.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           O157:H7 str. 1125]
 gi|330908981|gb|EGH37495.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           AA86]
 gi|331058460|gb|EGI30441.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA143]
 gi|332752989|gb|EGJ83373.1| RNA methyltransferase family protein [Shigella flexneri 4343-70]
 gi|332765363|gb|EGJ95581.1| ribosomal RNA small subunit methyltransferase E [Shigella flexneri
           2930-71]
 gi|332999693|gb|EGK19278.1| RNA methyltransferase family protein [Shigella flexneri VA-6]
 gi|333000409|gb|EGK19992.1| RNA methyltransferase family protein [Shigella flexneri K-218]
 gi|333000605|gb|EGK20183.1| RNA methyltransferase family protein [Shigella flexneri K-272]
 gi|333015165|gb|EGK34508.1| RNA methyltransferase family protein [Shigella flexneri K-304]
 gi|333015286|gb|EGK34628.1| RNA methyltransferase family protein [Shigella flexneri K-227]
          Length = 243

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|320645839|gb|EFX14824.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H-
           str. 493-89]
 gi|320651139|gb|EFX19579.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O157:H-
           str. H 2687]
          Length = 243

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKLLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|188496461|ref|ZP_03003731.1| 16S rRNA methyltransferase RsmE [Escherichia coli 53638]
 gi|218701656|ref|YP_002409285.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli IAI39]
 gi|254162856|ref|YP_003045964.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli B str.
           REL606]
 gi|301027729|ref|ZP_07191039.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 196-1]
 gi|331684573|ref|ZP_08385165.1| 16S rRNA methyltransferase RsmE [Escherichia coli H299]
 gi|188491660|gb|EDU66763.1| 16S rRNA methyltransferase RsmE [Escherichia coli 53638]
 gi|218371642|emb|CAR19481.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|242378472|emb|CAQ33256.1| 16S rRNA m[3]U1498 methyltransferase monomer, subunit of 16S rRNA
           m[3]U1498 methyltransferase [Escherichia coli BL21(DE3)]
 gi|253974757|gb|ACT40428.1| hypothetical protein ECB_02776 [Escherichia coli B str. REL606]
 gi|253978923|gb|ACT44593.1| hypothetical protein ECD_02776 [Escherichia coli BL21(DE3)]
 gi|299879165|gb|EFI87376.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 196-1]
 gi|309703301|emb|CBJ02637.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|323936051|gb|EGB32346.1| RsmE family protein RNA methyltransferase [Escherichia coli E1520]
 gi|323966463|gb|EGB61896.1| RsmE family protein RNA methyltransferase [Escherichia coli M863]
 gi|323971707|gb|EGB66935.1| RsmE family protein RNA methyltransferase [Escherichia coli TA007]
 gi|323978759|gb|EGB73840.1| RsmE family protein RNA methyltransferase [Escherichia coli
           TW10509]
 gi|327251714|gb|EGE63400.1| RNA methyltransferase family protein [Escherichia coli STEC_7v]
 gi|331078188|gb|EGI49394.1| 16S rRNA methyltransferase RsmE [Escherichia coli H299]
 gi|332344845|gb|AEE58179.1| RNA methyltransferase [Escherichia coli UMNK88]
          Length = 243

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|52081092|ref|YP_079883.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus licheniformis
           ATCC 14580]
 gi|52786471|ref|YP_092300.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus licheniformis
           ATCC 14580]
 gi|319644950|ref|ZP_07999183.1| hypothetical protein HMPREF1012_00216 [Bacillus sp. BT1B_CT2]
 gi|52004303|gb|AAU24245.1| Conserved hypothetical protein [Bacillus licheniformis ATCC 14580]
 gi|52348973|gb|AAU41607.1| YqeU [Bacillus licheniformis ATCC 14580]
 gi|317392759|gb|EFV73553.1| hypothetical protein HMPREF1012_00216 [Bacillus sp. BT1B_CT2]
          Length = 255

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 104/249 (41%), Gaps = 16/249 (6%)

Query: 7   LKRLFVDF---PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +         G+  H++A V+RM  GD ++       E   +I  V K
Sbjct: 1   MQRYFIEQSKQEVTAAPAFSIKGEDVHHIATVMRMSPGDEVICCAKDGHEAKCRIESVTK 60

Query: 64  SIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY----- 116
                  +E+   ++     +       K ++L+++IQK  E+G  +  P          
Sbjct: 61  EEVLLSVIEWTGETRELPVQIHIANGLPKGDKLEWIIQKGTELGASSFIPFQASRSVVKL 120

Query: 117 -TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P + P  T + LL++ +   + V A E    +
Sbjct: 121 DEKKAKKKRERWAKIAKEAAEQSHRNAIPDVAPVHTFQRLLESLEDFDKCVVAYEESSKQ 180

Query: 176 ----NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
                    L +++   +V ++ GPEGG+  EE E L          LGPRILR++TA +
Sbjct: 181 GETSRFQSVLKSLSEGSSVLMVFGPEGGFTEEEIEALKEKG-ALACGLGPRILRAETAPL 239

Query: 232 AAMALVQAI 240
            A+A V   
Sbjct: 240 YALAAVSYH 248


>gi|227872816|ref|ZP_03991130.1| protein of hypothetical function DUF558 [Oribacterium sinus F0268]
 gi|227841343|gb|EEJ51659.1| protein of hypothetical function DUF558 [Oribacterium sinus F0268]
          Length = 254

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 112/249 (44%), Gaps = 15/249 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV      + +    G+ +H+L  VLR + G+ IL+ +G+  ++  +I    +   
Sbjct: 1   MHHFFVSKEEIGEEKILLRGENFHHLHKVLRGQIGEKILISDGEGVDYQCEIQSFSEEEA 60

Query: 67  F-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN------ 119
              + ++       + +  + +  K ++++++IQK+VE+G+ A+ P+ ++ T        
Sbjct: 61  VLSICFREEPHELPAKIILLQALPKGDKMEWIIQKAVELGISALIPLESKNTVMKLKEKK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + R ++   SAA+Q     LP +      +            +   E         
Sbjct: 121 EEKKISRWQSIMDSAAKQSKRSILPKMENGMGWKEAFSYVKDCDFKLLPYENERGVIPTR 180

Query: 180 KLHAI-------AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           ++ A            ++A+ IGPEGG+  EE E      F+ P+SLG RILR++TAA+ 
Sbjct: 181 EILAKMEAAVKGKKNCSIALCIGPEGGFTKEEVEQAMGEGFL-PISLGKRILRTETAAIT 239

Query: 233 AMALVQAIC 241
           A++L+    
Sbjct: 240 ALSLIMMQL 248


>gi|152977886|ref|YP_001343515.1| hypothetical protein Asuc_0200 [Actinobacillus succinogenes 130Z]
 gi|150839609|gb|ABR73580.1| protein of unknown function DUF558 [Actinobacillus succinogenes
           130Z]
          Length = 243

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  ++  + S +  +++  VLRM+ G+ + LF+G +  + + IS   K 
Sbjct: 1   MRVPRIYHPESLLNQSSCRLSEEAANHVGRVLRMQAGEALELFDGSNHIYPAVISRADKK 60

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +  S  ++S   +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  TVTVNIRERISDDRESPLAIHLGQVISRGERMEFTIQKSVELGVKVITPLWSERCGVKLE 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   +SA EQC    +P I P   L+      D   ++        S  
Sbjct: 121 GDRLAKKIRQWQKIAVSACEQCGRNVIPQIRPMMKLQDWCAENDGALKLNLHPRAQYSIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      + +LIG EGG   +E        F T + LG RILR++TAA+ A+  
Sbjct: 181 TLPTIPA----EGIRLLIGSEGGLSPQEIALTEQQGF-TEILLGKRILRTETAALTAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQICFGD 242


>gi|237706401|ref|ZP_04536882.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|254037995|ref|ZP_04872053.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|331643639|ref|ZP_08344770.1| 16S rRNA methyltransferase RsmE [Escherichia coli H736]
 gi|331648701|ref|ZP_08349789.1| 16S rRNA methyltransferase RsmE [Escherichia coli M605]
 gi|331654458|ref|ZP_08355458.1| 16S rRNA methyltransferase RsmE [Escherichia coli M718]
 gi|331674427|ref|ZP_08375187.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA280]
 gi|12517492|gb|AAG58077.1|AE005525_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26109775|gb|AAN81980.1|AE016766_68 Hypothetical protein yggJ [Escherichia coli CFT073]
 gi|882475|gb|AAA69113.1| ORF_o252 [Escherichia coli str. K-12 substr. MG1655]
 gi|13363294|dbj|BAB37245.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91073902|gb|ABE08783.1| hypothetical protein UTI89_C3335 [Escherichia coli UTI89]
 gi|209760100|gb|ACI78362.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760102|gb|ACI78363.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760104|gb|ACI78364.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|209760106|gb|ACI78365.1| hypothetical protein ECs3822 [Escherichia coli]
 gi|226839619|gb|EEH71640.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226899441|gb|EEH85700.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|281602283|gb|ADA75267.1| hypothetical protein SFxv_3218 [Shigella flexneri 2002017]
 gi|331037110|gb|EGI09334.1| 16S rRNA methyltransferase RsmE [Escherichia coli H736]
 gi|331042448|gb|EGI14590.1| 16S rRNA methyltransferase RsmE [Escherichia coli M605]
 gi|331047840|gb|EGI19917.1| 16S rRNA methyltransferase RsmE [Escherichia coli M718]
 gi|331068521|gb|EGI39916.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA280]
          Length = 252

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 8   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 67

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 68  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 127

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 128 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 187

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 188 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 241

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 242 TALQVRFGD 250


>gi|170682172|ref|YP_001745107.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli SMS-3-5]
 gi|170519890|gb|ACB18068.1| 16S rRNA methyltransferase RsmE [Escherichia coli SMS-3-5]
          Length = 243

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNRVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|194436810|ref|ZP_03068910.1| 16S rRNA methyltransferase RsmE [Escherichia coli 101-1]
 gi|194424292|gb|EDX40279.1| 16S rRNA methyltransferase RsmE [Escherichia coli 101-1]
          Length = 243

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        I  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PIERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|145638791|ref|ZP_01794400.1| hypothetical protein CGSHiII_08751 [Haemophilus influenzae PittII]
 gi|145272386|gb|EDK12294.1| hypothetical protein CGSHiII_08751 [Haemophilus influenzae PittII]
 gi|309750281|gb|ADO80265.1| 16S rRNA m3U1498 methyltransferase [Haemophilus influenzae R2866]
          Length = 245

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ I LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCLLSEDAANHVARVLRMTEGEQIELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGREVADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|209760098|gb|ACI78361.1| hypothetical protein ECs3822 [Escherichia coli]
          Length = 252

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 8   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 67

Query: 63  KSIRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 68  KKSVEVKLLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 127

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 128 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 187

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 188 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 241

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 242 TALQVRFGD 250


>gi|281179955|dbj|BAI56285.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 243

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQVLQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPVMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|292487087|ref|YP_003529957.1| hypothetical protein EAMY_0599 [Erwinia amylovora CFBP1430]
 gi|292900528|ref|YP_003539897.1| hypothetical protein EAM_2830 [Erwinia amylovora ATCC 49946]
 gi|291200376|emb|CBJ47504.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291552504|emb|CBA19549.1| UPF0088 protein yggJ [Erwinia amylovora CFBP1430]
 gi|312171190|emb|CBX79449.1| UPF0088 protein yggJ [Erwinia amylovora ATCC BAA-2158]
          Length = 243

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  +   S +  +++  VLRM  G  + LF+G    + ++I    K 
Sbjct: 1   MRIPRIYQPRPLQIGNEIALSEEAANHVGRVLRMSAGQMLELFDGTSLVFAAEIIQADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   SR  +++S +         +  ++++ +QK+VE+G+  I P+ +        
Sbjct: 61  NVCVRINASREDSRESPLHLHLGQVMSRGEKMEFTVQKAVELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     M + +   I+A EQC    +P +     L+      +   ++        S N
Sbjct: 121 AERLAKKMQQWQKIAIAACEQCGRNCIPEVRNAMALDAWCAEPEPGLKLNLHPRAKHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        I  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PIERVRLLIGPEGGLSADEIAMTAQHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|157372259|ref|YP_001480248.1| hypothetical protein Spro_4025 [Serratia proteamaculans 568]
 gi|157324023|gb|ABV43120.1| protein of unknown function DUF558 [Serratia proteamaculans 568]
          Length = 243

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL    +   S D  +++  VLRM  G  + LF+G +  + + I+ V K 
Sbjct: 1   MRIPRIYHPQPLIDHAEIFLSEDAANHIGRVLRMNAGQALQLFDGSNQVFDAVIAQVDKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q   +    ++       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVQVQLSAGQLEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVNVITPLFSERCGVALS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     LE      D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNRIPEIREAMQLEAWCAEQDGSLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        + NV +LIGPEGG  + E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVENVRLLIGPEGGLSTGEIAMTTGHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|330446905|ref|ZP_08310556.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491096|dbj|GAA05053.1| ribosomal RNA small subunit methyltransferase E [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 243

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 115/248 (46%), Gaps = 16/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  + +   S D  +++  V+RM+ G  +L+F+G D E+ + I+   K 
Sbjct: 1   MRIPRIYHPESLPSQGKVMLSDDAANHVGRVMRMQAGQELLMFDGSDAEFPAVITSASKK 60

Query: 65  IRFKVEYQ---SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              +VE Q     S     ++       + +++++ IQKSVE+G+  I P+I+       
Sbjct: 61  -SVEVEIQSRVEHSVESPLNIHLGQVISRGDKMEFTIQKSVELGVSTITPLISERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     +D+ +   I+A EQC    +P I P   LE          ++        S 
Sbjct: 120 NAERFEKKLDQWQKIAIAACEQCGRNVVPTIRPVMKLEQWCAEEYDGLKLNLHPRAKYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        + NV +LIGPEGG  +EE        F   + LGPR+LR++T A+ A+ 
Sbjct: 180 NTL-----PTPVTNVRLLIGPEGGLSAEEIGMTEEYKFDE-ILLGPRVLRTETTAMTAIT 233

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 234 ALQVRFGD 241


>gi|311069145|ref|YP_003974068.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus atrophaeus 1942]
 gi|310869662|gb|ADP33137.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus atrophaeus 1942]
          Length = 256

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 101/249 (40%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +        +G+  H++ +V+RM  GD I+  +    E   ++  V K
Sbjct: 1   MQRYFIELTKQQMEAGPAFMITGEDVHHITNVMRMSAGDEIICCSLDGHEAKCELQSVSK 60

Query: 64  SI--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                   E+   ++     V       K ++L+++IQK  E+G     P     +    
Sbjct: 61  EKVACLVSEWTGANRELPIKVHIASGLPKGDKLEWIIQKGTELGSSMFLPFQAARSVVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P + P  T + LL       + V A E    +
Sbjct: 121 DDKKAKKKRERWTKIAKEAAEQSYRNEIPDVAPVHTFQQLLSKVQDFDKCVVAYEESSKQ 180

Query: 176 N----SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
                 +  L ++    ++ I+ GPEGG    E E L     V P  LGPRILR++TA +
Sbjct: 181 GETSALVSVLSSLPDQSSLLIIFGPEGGLTESEVEQLKDKGAV-PCGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A+  V   
Sbjct: 240 YALGAVSYH 248


>gi|20807439|ref|NP_622610.1| hypothetical protein TTE0958 [Thermoanaerobacter tengcongensis MB4]
 gi|20515963|gb|AAM24214.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 245

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 112/244 (45%), Gaps = 8/244 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFN-GKDGEWLSKISYVGKSI 65
           ++++FV+            G  +H+L HVLR K GD I++ +  ++     +     ++I
Sbjct: 1   MRKIFVEKGKIKGKFAYVDGKDFHHLIHVLRYKVGDKIVVSDMAEEHLGRIEKIEKDRAI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
            F  E    +     +V      +K +++D ++QK  E+G+  I P ++ +        N
Sbjct: 61  LFLEEKMEGNAESPLEVFLFQGILKADKMDLIVQKCTEIGVKRIIPFVSEFSVVDIKRAN 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               ++R +  +  A +Q     +P I  P + +  ++        +   E    +   E
Sbjct: 121 IDKKVERWKKISEEACKQSGRNIIPEISAPVSFKEAIEKAMECDLAIIPYEKEEKKRLKE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L  +     + I IGPEGG+  +E E   +   + P++LGPRILR++TAA+A  A+V  
Sbjct: 181 VLKDVEDAKKIGIFIGPEGGFSQKEIEKAINNG-IVPVTLGPRILRAETAAIAVSAIVMY 239

Query: 240 ICGD 243
             GD
Sbjct: 240 QLGD 243


>gi|161950046|ref|YP_404631.2| 16S ribosomal RNA methyltransferase RsmE [Shigella dysenteriae
           Sd197]
 gi|309785226|ref|ZP_07679857.1| RNA methyltransferase family protein [Shigella dysenteriae 1617]
 gi|308926346|gb|EFP71822.1| RNA methyltransferase family protein [Shigella dysenteriae 1617]
          Length = 243

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ ++       
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSKRCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|157960429|ref|YP_001500463.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella pealeana ATCC
           700345]
 gi|157845429|gb|ABV85928.1| protein of unknown function DUF558 [Shewanella pealeana ATCC
           700345]
          Length = 243

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 102/247 (41%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L +        +   ++  VLRM  G+ + LFNG   ++L++I    K 
Sbjct: 1   MRVPRIYQQSTLVVGQSVALDDEAAGHVGRVLRMSSGEQVSLFNGDGNDYLAEIISASKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+D+ IQKSVE+G+  I P+ +        
Sbjct: 61  NVEVKVLSCEANDSESPLNLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKLT 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ     +P I P   L           ++          N
Sbjct: 121 GERLDKKIQQWQKIVISACEQSGRSVVPVIRPAMQLSDWCAEDSDAVKLNLHPRASHGVN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L           V ++IGPEGG  + E        F T + LGPR+LR++TAA+  ++ 
Sbjct: 181 GLTL-----PNNRVRLVIGPEGGLSAPEIAMTEEHQF-TDVLLGPRVLRTETAALTTISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|167757694|ref|ZP_02429821.1| hypothetical protein CLOSCI_00024 [Clostridium scindens ATCC 35704]
 gi|167664576|gb|EDS08706.1| hypothetical protein CLOSCI_00024 [Clostridium scindens ATCC 35704]
          Length = 245

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/244 (21%), Positives = 107/244 (43%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  FV        +    G   +++ +VLRM+ G+ + + +G + ++   +    +   
Sbjct: 1   MQHFFVTPSQVEGERIYIEGSDVNHMKNVLRMRPGEAVAISDGDNLKYRCVVEGYEEGRA 60

Query: 67  FKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
                Q           +       K ++++ ++QK+VE+G   + PV TR        +
Sbjct: 61  VLAIQQRMPVDTELPCRIILFQGLPKQDKMELIVQKAVELGASQVVPVATRRSVVKLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPP-TTLEFLLKNWDHNCQIVFADETCGSENS 177
                + R +    SAA+Q     +P +    +  E L K  + +  ++  +   G E +
Sbjct: 121 KAAKKLQRWQQIAESAAKQAGRGYIPQVSSVLSYQEALEKAGELDVLLIPYELAEGMEEA 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            + + +IA   +V I IGPEGG+  EE +          ++LG RILR++TA +A ++++
Sbjct: 181 RKVVASIAQGQSVGIFIGPEGGFEKEEVDAAIRQG-AKAITLGRRILRTETAGLAILSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MFRL 243


>gi|21672668|ref|NP_660735.1| hypothetical protein BUsg395 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25009589|sp|Q8K9E4|RSME_BUCAP RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|21623305|gb|AAM67946.1| hypothetical 26.9 kDa protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 246

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 67/250 (26%), Positives = 114/250 (45%), Gaps = 15/250 (6%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R+++ + L I      S    HY+  VLRMK+ D + +FN  +  + S+I  + 
Sbjct: 1   MKKRIPRIYIKYFLQINQVISLSKSYTHYIKKVLRMKKKDKLEIFNNTNYIFFSEILEIN 60

Query: 63  KSIRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ-- 118
                 +    Q ++      +       K  ++++ IQKSVE+G+  I P+ + Y    
Sbjct: 61  NHTIEIIILKKQIKNLESPLLIHLGQVISKNEKMNFSIQKSVELGVNTITPLFSEYCNFQ 120

Query: 119 ----NTHYNMDRVRTYTISAAEQCDILTLPFI-YPPTTLEFLLKNWDHNCQIVFADETCG 173
                            IS+ EQC    +P I  P   L +  + +++  +IVF+     
Sbjct: 121 NKLICFPKKKIHWENIVISSCEQCHRNNIPEIKNPEYILPWCKRTYENETKIVFSPSATF 180

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           + N L +         V +LIG EGG+   E E +    F+ P+ LGPRILR++TA +AA
Sbjct: 181 TINELPEKINC-----VRLLIGSEGGFSFLEIEKIIQYGFI-PIKLGPRILRTETAVIAA 234

Query: 234 MALVQAICGD 243
           +  +Q   GD
Sbjct: 235 ITALQIKFGD 244


>gi|215488244|ref|YP_002330675.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266316|emb|CAS10747.1| 16S rRNA methyltransferase [Escherichia coli O127:H6 str. E2348/69]
          Length = 243

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVISRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|238897814|ref|YP_002923493.1| 16S rRNA methyltransferase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465571|gb|ACQ67345.1| 16S rRNA methyltransferase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 243

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 119/247 (48%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-NGKDGEWLSKISYVGK 63
             + R++  +P    TQ + S +  H++  VLRMK G ++ LF +  D    + I    K
Sbjct: 1   MRIPRIYHPYPFFAHTQIELSEEAAHHVIRVLRMKPGQSLYLFHDSNDIIQANIIRIDKK 60

Query: 64  SIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
            +  ++ E   ++      +       ++ +++Y +QKSVE+G+ ++ P+ +        
Sbjct: 61  KVYVQLKEAILKNNESPLYLHLGQVICRSEKMEYTLQKSVELGVHSVTPLFSERCGVKID 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P IY    L     + D++ ++ F  +     N
Sbjct: 121 GERLQKKIQQWKKIAISACEQCGRNKIPKIYNALPLHNWCAHQDNSLKLNFVPKANNRIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L     I  +  V ILIGPEGG  ++E        F+ P+SLGPR+LR++T A+ A+  
Sbjct: 181 TL-----IPPVSRVRILIGPEGGLSNDEIAMAADYEFL-PISLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|81242430|gb|ABB63140.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 252

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 111/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 8   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 67

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E Q   +     +       +  ++++ IQKS+E+G+  I P+ ++     
Sbjct: 68  KKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSKRCGVK 127

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 128 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 187

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 188 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 241

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 242 TALQVRFGD 250


>gi|294853463|ref|ZP_06794135.1| ribosomal RNA small subunit methyltransferase E [Brucella sp. NVSL
           07-0026]
 gi|294819118|gb|EFG36118.1| ribosomal RNA small subunit methyltransferase E [Brucella sp. NVSL
           07-0026]
          Length = 242

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 114/239 (47%), Positives = 154/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++RL+V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRLYVENELRAGVSFDAGAQAVHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  RLDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|161984861|ref|YP_409378.2| 16S ribosomal RNA methyltransferase RsmE [Shigella boydii Sb227]
 gi|187732729|ref|YP_001881719.1| 16S ribosomal RNA methyltransferase RsmE [Shigella boydii CDC
           3083-94]
 gi|191167926|ref|ZP_03029729.1| 16S rRNA methyltransferase RsmE [Escherichia coli B7A]
 gi|193063533|ref|ZP_03044622.1| 16S rRNA methyltransferase RsmE [Escherichia coli E22]
 gi|193067437|ref|ZP_03048405.1| 16S rRNA methyltransferase RsmE [Escherichia coli E110019]
 gi|194426231|ref|ZP_03058786.1| 16S rRNA methyltransferase RsmE [Escherichia coli B171]
 gi|209920405|ref|YP_002294489.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli SE11]
 gi|218696544|ref|YP_002404211.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli 55989]
 gi|256019252|ref|ZP_05433117.1| 16S ribosomal RNA methyltransferase RsmE [Shigella sp. D9]
 gi|260845616|ref|YP_003223394.1| hypothetical protein ECO103_3526 [Escherichia coli O103:H2 str.
           12009]
 gi|260857079|ref|YP_003230970.1| hypothetical protein ECO26_4045 [Escherichia coli O26:H11 str.
           11368]
 gi|260869633|ref|YP_003236035.1| hypothetical protein ECO111_3694 [Escherichia coli O111:H- str.
           11128]
 gi|293449276|ref|ZP_06663697.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B088]
 gi|300824847|ref|ZP_07104950.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 119-7]
 gi|301306391|ref|ZP_07212460.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 124-1]
 gi|301327362|ref|ZP_07220612.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 78-1]
 gi|307310433|ref|ZP_07590081.1| protein of unknown function DUF558 [Escherichia coli W]
 gi|309794035|ref|ZP_07688460.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 145-7]
 gi|331669689|ref|ZP_08370535.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA271]
 gi|187429721|gb|ACD08995.1| 16S rRNA methyltransferase RsmE [Shigella boydii CDC 3083-94]
 gi|190902011|gb|EDV61757.1| 16S rRNA methyltransferase RsmE [Escherichia coli B7A]
 gi|192930810|gb|EDV83415.1| 16S rRNA methyltransferase RsmE [Escherichia coli E22]
 gi|192959394|gb|EDV89829.1| 16S rRNA methyltransferase RsmE [Escherichia coli E110019]
 gi|194415539|gb|EDX31806.1| 16S rRNA methyltransferase RsmE [Escherichia coli B171]
 gi|209913664|dbj|BAG78738.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218353276|emb|CAU99232.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|257755728|dbj|BAI27230.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760763|dbj|BAI32260.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765989|dbj|BAI37484.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|291322366|gb|EFE61795.1| ribosomal RNA small subunit methyltransferase E [Escherichia coli
           B088]
 gi|300522685|gb|EFK43754.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 119-7]
 gi|300838386|gb|EFK66146.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 124-1]
 gi|300846046|gb|EFK73806.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 78-1]
 gi|306909328|gb|EFN39823.1| protein of unknown function DUF558 [Escherichia coli W]
 gi|308122442|gb|EFO59704.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 145-7]
 gi|315062252|gb|ADT76579.1| 16S rRNA methyltransferase [Escherichia coli W]
 gi|315256838|gb|EFU36806.1| 16S rRNA methyltransferase RsmE [Escherichia coli MS 85-1]
 gi|320174058|gb|EFW49228.1| Ribosomal RNA small subunit methyltransferase E [Shigella
           dysenteriae CDC 74-1112]
 gi|320184293|gb|EFW59105.1| Ribosomal RNA small subunit methyltransferase E [Shigella flexneri
           CDC 796-83]
 gi|320202610|gb|EFW77180.1| Ribosomal RNA small subunit methyltransferase E [Escherichia coli
           EC4100B]
 gi|323168002|gb|EFZ53691.1| RNA methyltransferase family protein [Shigella sonnei 53G]
 gi|323180406|gb|EFZ65958.1| RNA methyltransferase family protein [Escherichia coli 1180]
 gi|323183517|gb|EFZ68914.1| RNA methyltransferase family protein [Escherichia coli 1357]
 gi|323377164|gb|ADX49432.1| protein of unknown function DUF558 [Escherichia coli KO11]
 gi|323946556|gb|EGB42579.1| RsmE family protein RNA methyltransferase [Escherichia coli H120]
 gi|324119741|gb|EGC13621.1| RsmE family protein RNA methyltransferase [Escherichia coli E1167]
 gi|331063357|gb|EGI35270.1| 16S rRNA methyltransferase RsmE [Escherichia coli TA271]
 gi|332091330|gb|EGI96418.1| RNA methyltransferase family protein [Shigella boydii 3594-74]
          Length = 243

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|114561729|ref|YP_749242.1| hypothetical protein Sfri_0543 [Shewanella frigidimarina NCIMB 400]
 gi|114333022|gb|ABI70404.1| protein of unknown function DUF558 [Shewanella frigidimarina NCIMB
           400]
          Length = 246

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 62/248 (25%), Positives = 106/248 (42%), Gaps = 13/248 (5%)

Query: 5   SHLKRLFVD-FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
             + R+F     L      +   D   ++  VLRM  GD I LFNG   ++L++I    K
Sbjct: 1   MRVPRIFQPLDNLQQGQTLQLDEDGVAHIGRVLRMGMGDQISLFNGDGNDYLAEIIETSK 60

Query: 64  SIRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +  ++ +     D+       + +R+++ +QKSVE+G+  I P+ +       
Sbjct: 61  KSIAVTVLSCEANNSESPLDLHLGQVISRGDRMEFTVQKSVELGVTTITPLFSDRCGVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   ISA EQ     +P + P  TL    +      ++          
Sbjct: 121 SGERLEKKLQQWQKIVISACEQSGRSIVPIVRPAMTLAQWCEESTEALKLNLHPRASH-- 178

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
             +  L        V +LIGPEGG   EE     +  F T + LGPR+LR++TA++ A+ 
Sbjct: 179 -GINGLQLSGQHHKVRLLIGPEGGLSDEEIAMTETQHF-TDILLGPRVLRTETASLTAIT 236

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 237 ALQVKFGD 244


>gi|308272138|emb|CBX28745.1| hypothetical protein N47_L13430 [uncultured Desulfobacterium sp.]
          Length = 259

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 111/247 (44%), Gaps = 11/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  ++D            G    ++ +VLR+K GD+I LF+    ++ ++I  V  +  
Sbjct: 1   MRLFYIDQSEIASQNPAIKGSDARHIINVLRLKPGDHIELFDESGIKYKARIVAVSSARV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH--- 121
               V   +++     ++    S +K  ++D +I++  E+G+    P I+  + +     
Sbjct: 61  EVSVVGQSNQTVESFLEIIVAQSFLKEAKMDNLIRQLTELGITKWIPFISERSVSRPDDK 120

Query: 122 ---YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                  R  +    AA+QC       I    + + LL++       +   E   +   +
Sbjct: 121 RLLNRSKRWESIAKEAAKQCKRAKTTIIEKTVSFKELLESKQEFDLKIIFWENEKNLLDI 180

Query: 179 EKLHA--IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           + L A     I  + I++GPEGG+   E E      F+T   LGPRILR++TA+V+A  L
Sbjct: 181 KNLTATHQKDINKILIILGPEGGFTISEIEKAKESGFLTA-GLGPRILRAETASVSACTL 239

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 240 IQFLFGD 246


>gi|331678938|ref|ZP_08379612.1| 16S rRNA methyltransferase RsmE [Escherichia coli H591]
 gi|332280360|ref|ZP_08392773.1| conserved hypothetical protein [Shigella sp. D9]
 gi|81246842|gb|ABB67550.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|331073768|gb|EGI45089.1| 16S rRNA methyltransferase RsmE [Escherichia coli H591]
 gi|332102712|gb|EGJ06058.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 252

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 110/249 (44%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   
Sbjct: 8   LTMRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSAS 67

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +E +   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 68  KKSVEVKVLEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 127

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQC    +P I P   LE      D   ++        S
Sbjct: 128 LDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNS 187

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 188 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 241

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 242 TALQVRFGD 250


>gi|296160467|ref|ZP_06843283.1| protein of unknown function DUF558 [Burkholderia sp. Ch1-1]
 gi|295889216|gb|EFG69018.1| protein of unknown function DUF558 [Burkholderia sp. Ch1-1]
          Length = 246

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 112/251 (44%), Gaps = 18/251 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV  PL      +   D   ++  VLR++ GD+I+LFNG+ GE+ +++  V +   
Sbjct: 1   MPRFFVGTPLQSDDIMQLPDDVVRHVL-VLRLQPGDSIVLFNGEGGEYSAELVEVERRSA 59

Query: 67  FKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E+++        +         +++D++I+K+VE+G  A  P+ T  +      +
Sbjct: 60  KVRIREFRNIEVEAPYRLTLAQGIAGGDKMDWLIEKAVELGASAFVPLTTTRSVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYP-----PTTLEFLLKNWDHNCQIVFADETCG 173
                    +    ++ EQC    LP + P                + + +I+ +     
Sbjct: 120 RAQRRHAHWQGIVRASCEQCGRNRLPEVMPVREIATWLGAMPRTPEEGDLRILLSPRASI 179

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              S   L A      V +L+GPEGG+ + E+       F T + LGPR++R++TA +A 
Sbjct: 180 ---SFSALPAEPPQGRVTVLVGPEGGFSAAEEAAATDHGF-TAVGLGPRVMRTETAGIAV 235

Query: 234 MALVQAICGDW 244
           ++ + A  G W
Sbjct: 236 LSALAAGWGGW 246


>gi|225574856|ref|ZP_03783466.1| hypothetical protein RUMHYD_02934 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037930|gb|EEG48176.1| hypothetical protein RUMHYD_02934 [Blautia hydrogenotrophica DSM
           10507]
          Length = 246

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 112/246 (45%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +KR F       + +   +G+  +++  VLRM+EG+ + + +G+  E+  +I    +   
Sbjct: 1   MKRFFAKPEQIDEREIHITGEDVNHIRQVLRMREGEELWVSDGEKKEYHCRIKDFQQDEI 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  Q       S +       K ++++ +IQK+VE+G   + PV T         +
Sbjct: 61  LLEILYAQESDYELPSRIYLFQGLPKGDKMELIIQKAVELGAFEVIPVATSRCVVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                 +R +    +AA+Q   L +P I+P  +L   L         +   E   G   +
Sbjct: 121 KAAKKQERWQEIARNAAKQSRRLLVPQIHPVCSLREALDYSGSLDVKLLPYELAKGMRQT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E L  I    ++ I IGPEGG+  EE E   ++  V P++LG RILR++TA +  ++++
Sbjct: 181 KETLAGIKRGQSIGIFIGPEGGFAPEEVEQAMAVG-VEPITLGKRILRTETAGMTVLSIL 239

Query: 238 QAICGD 243
                D
Sbjct: 240 MFQLED 245


>gi|294649934|ref|ZP_06727326.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292824163|gb|EFF82974.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 239

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 111/243 (45%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L      + +   +H+   VLR KE +  + FNGK GE+L  ++ + K   
Sbjct: 1   MNRFYIETELNTGNTIELTESVFHHWVRVLRAKEQEQAIFFNGKGGEYLVTLTEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                Q     + +    +      K +R+DY IQK+ E+G+  I+ + +   +      
Sbjct: 61  LVSIDQFNKLDRTAPFNVVLGQVMSKGDRMDYAIQKATELGVTTIQLLTSDRCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  R+  I+A EQC +  +P I  P +L   +K+     + V A     +   L
Sbjct: 121 RDQKKLDHWRSVAIAACEQCGMNRVPEILAPISLNDWVKSELPTSRFVLAPNKDQTNILL 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                    P++A+L+GPEGG    E ET +   F     +G R+LR++TA V A++++ 
Sbjct: 181 ------NSTPDIALLVGPEGGLSETEIETANQYQF-KNWCIGDRVLRTETAPVVALSILN 233

Query: 239 AIC 241
              
Sbjct: 234 YHF 236


>gi|266621760|ref|ZP_06114695.1| RNA methyltransferase, RsmE family [Clostridium hathewayi DSM
           13479]
 gi|288866557|gb|EFC98855.1| RNA methyltransferase, RsmE family [Clostridium hathewayi DSM
           13479]
          Length = 245

 Score =  141 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 57/243 (23%), Positives = 109/243 (44%), Gaps = 10/243 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV+     +     +G   +++ +VLRMK G+ +L+ NG D +++ ++  +     
Sbjct: 1   MYHFFVNQEQIGQDTVTVTGPDVNHIKNVLRMKPGEEVLISNGVDKDYVCRLQTITSDAV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               V          +         K+++++++IQK+VE+G+  + PV TR T      +
Sbjct: 61  TAEIVTVTEGGTELPAKFYLFQGLPKSDKMEFLIQKAVELGVYQVIPVETRRTVVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVF-ADETCGSENS 177
                + R    + SAA+Q   L +P +    T +  L       + +   +   G  ++
Sbjct: 121 KVEAKVRRWNAVSESAAKQSKRLIIPEVTGVMTFQEALNYAGGFDKNIIPFEHAEGMADT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
                 I    +  I IGPEGG+  EE         V P++LG RILR++TA +A ++++
Sbjct: 181 KAYFAGIRPGMSCGIFIGPEGGFEDEEISQASEAG-VKPVTLGKRILRTETAGLAVLSVL 239

Query: 238 QAI 240
              
Sbjct: 240 MFQ 242


>gi|255659202|ref|ZP_05404611.1| RNA methyltransferase, RsmE family [Mitsuokella multacida DSM
           20544]
 gi|260848654|gb|EEX68661.1| RNA methyltransferase, RsmE family [Mitsuokella multacida DSM
           20544]
          Length = 248

 Score =  141 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 106/249 (42%), Gaps = 16/249 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS-- 64
           ++RLF    L      +  G   H+L HV+R K G  +++ + ++     +++       
Sbjct: 1   MRRLFYKGILA--DTIEIRGADAHHLMHVMRAKPGQEVIVVDDENQVARMEMTRFTSDAV 58

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGA------IRPVITRYTQ 118
               VE           +      +K +++D+++QK+VE+G+           V+    +
Sbjct: 59  TMELVERLDADTESPIQLGLAMCLLKADKMDFVVQKAVELGVNCIVPVASHNCVVRYDAK 118

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPP----TTLEFLLKNWDHNCQIVFADETCGS 174
                  R +     AA+QC    L  ++P       L       D + + +F  E   +
Sbjct: 119 KAKQRQQRWQKIADEAAKQCGRTVLVKVFPIETLKDFLSHAWYEDDMDSEFLFCYENEEN 178

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
             S+             +LIGPEGG+  EE E +        ++LGPRILR++TAAVA +
Sbjct: 179 -VSVRDCLQRTTSERYMLLIGPEGGFTLEEAEAVVKAGG-QSVTLGPRILRAETAAVAGL 236

Query: 235 ALVQAICGD 243
           ++VQ   GD
Sbjct: 237 SIVQYEKGD 245


>gi|315499603|ref|YP_004088406.1| hypothetical protein Astex_2610 [Asticcacaulis excentricus CB 48]
 gi|315417615|gb|ADU14255.1| protein of unknown function DUF558 [Asticcacaulis excentricus CB
           48]
          Length = 248

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 131/249 (52%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDF---PLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           + RLF+     P         + DQ  Y+A V+R+ +GD I +FNG+DGEW  ++  V K
Sbjct: 1   MIRLFIAETTPPFAEGLIFPLNPDQARYVAAVMRLGDGDEISVFNGRDGEWRGRLQAVSK 60

Query: 64  SIRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
                  +          +  + + + +K  RL+ +I+K+ E+G+G I+ +ITR T   H
Sbjct: 61  KHVHVELIAQARPQPAAGNAPKLLIALVKRGRLETIIEKATELGVGEIQLLITRRTNADH 120

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
            N+ R++     AAEQ + L +P +  P  LE  LK        ++ DE    E     +
Sbjct: 121 TNLARLQLIAQEAAEQTERLDVPQVLAPVKLEVYLKAASETL--IYGDEDSTHETGERTI 178

Query: 182 HAIAHIPN------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
             +    +      V+ILIGPEGG+ + E++TL   P    ++LGPRILR+DTAA++A+ 
Sbjct: 179 SPMLEALSGLGEGAVSILIGPEGGFDAVERQTLSVQPNTVAVNLGPRILRADTAAISALT 238

Query: 236 LVQAICGDW 244
           L QA+ GDW
Sbjct: 239 LYQAVRGDW 247


>gi|85858413|ref|YP_460615.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB]
 gi|85721504|gb|ABC76447.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
          Length = 274

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 114/245 (46%), Gaps = 8/245 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + RL+    L +  +   S +  HY+  V RMK G  + LF+G+  E+ + I  +     
Sbjct: 16  IPRLYYPCVLTVGDRCFLSEEHLHYVRSVQRMKPGSRLSLFDGRGQEYTAVIVDISAERA 75

Query: 67  F-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT----- 120
             ++  +  +  + + +  I +  K  ++D+++QK+ E+G+  I P  +  +        
Sbjct: 76  LAEIIDRKSAPERPARITLIQALPKGQKMDFIVQKATELGVDEILPFSSERSIPRLPPEK 135

Query: 121 -HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +R R     AA QC    +P I    +   +LK  D +   +   E    +   +
Sbjct: 136 ARLKTERWRKIAGEAARQCRRSDVPNIPEIQSFAGILKAADADSLKMIFWEEESRQGLKD 195

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L   +     +IL+GPEGG  SEE E   +  FV  +SLG +IL+ +TAAVA +A++Q 
Sbjct: 196 LLKKFSGTCIFSILVGPEGGLTSEEVEAATAAGFV-SVSLGKQILKLETAAVAILAIIQY 254

Query: 240 ICGDW 244
             G +
Sbjct: 255 EVGLF 259


>gi|91785218|ref|YP_560424.1| hypothetical protein Bxe_A0561 [Burkholderia xenovorans LB400]
 gi|91689172|gb|ABE32372.1| Conserved hypothetical protein 46 [Burkholderia xenovorans LB400]
          Length = 251

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 112/251 (44%), Gaps = 18/251 (7%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV  PL      +   D   ++  VLR++ GD+I+LFNG+ GE+ +++  V +   
Sbjct: 6   MPRFFVGTPLQSDDIMQLPDDVVRHVL-VLRLQPGDSIVLFNGEGGEYSAELVEVERRSA 64

Query: 67  FKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                E+++        +         +++D++I+K+VE+G  A  P+ T  +      +
Sbjct: 65  KVRIREFRNIEVEAPYRLTLAQGIAGGDKMDWLIEKAVELGASAFVPLTTTRSVVRLTGE 124

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYP-----PTTLEFLLKNWDHNCQIVFADETCG 173
                    +    ++ EQC    LP + P                + + +I+ +     
Sbjct: 125 RAQRRHAHWQGIVRASCEQCGRNRLPEVMPVREIATWLGAMPRTPEEGDLRILLSPRASI 184

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              S   L A      V +L+GPEGG+ + E+       F T + LGPR++R++TA +A 
Sbjct: 185 ---SFSALPAEPPQGRVTVLVGPEGGFSAAEEAAATDHGF-TAVGLGPRVMRTETAGIAV 240

Query: 234 MALVQAICGDW 244
           ++ + A  G W
Sbjct: 241 LSALAAGWGGW 251


>gi|218550193|ref|YP_002383984.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia fergusonii
           ATCC 35469]
 gi|218357734|emb|CAQ90378.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 243

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPDPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|161017487|emb|CAK01045.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 277

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 137/226 (60%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+I+  LKRLF+   L +  + K  G Q  YL HVLRMKEG  IL+FNG+DGEWL+K+  
Sbjct: 31  MRINYKLKRLFIRQTLALNEEIKIEGAQASYLMHVLRMKEGAEILIFNGQDGEWLAKLII 90

Query: 61  VGKSIRF-KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           V K     ++ +Q R QT  S++ Y F+P+K  RLDYM+QK+VEMG   ++PVIT +TQ 
Sbjct: 91  VKKKFVVVQLIHQERLQTTHSNLIYCFAPLKNARLDYMVQKAVEMGASILQPVITHHTQV 150

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           T  NM R+    I A+EQC IL+LP      +L  LL+ WD    + F DE   S N L 
Sbjct: 151 TRINMARMEANVIEASEQCGILSLPECVSALSLAELLERWDETQPLFFCDEEHKSPNPLP 210

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
                       +LIGPEGG+  EE+  L   PFV P+SLGPRILR
Sbjct: 211 SFKKRNVTTP-GVLIGPEGGFSEEERSFLKKHPFVVPMSLGPRILR 255


>gi|145634697|ref|ZP_01790406.1| hypothetical protein CGSHiAA_05711 [Haemophilus influenzae PittAA]
 gi|145268242|gb|EDK08237.1| hypothetical protein CGSHiAA_05711 [Haemophilus influenzae PittAA]
          Length = 245

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPDIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|312883853|ref|ZP_07743570.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368311|gb|EFP95846.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 243

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R++    +        S +   ++  VLRMK G  + LF+G   E+++ IS   K 
Sbjct: 1   MRTPRIYHPEMITQLGLLTLSEEAAGHVGRVLRMKIGQELRLFDGSGSEFIATISSQSKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  QS  ++ +S+++        + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVEVEVKQSIERSAESNLKLHLGQVISRGDKMEFTIQKSVELGVEVITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P  +LE          ++        S N
Sbjct: 121 QKRFEKKLAQWQKIAISACEQCGRNRIPSIRPIMSLENWCGEEYDGLKLNLHPRADYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG    E +      F + + LGPR+LR++TAA+ A+  
Sbjct: 181 TL-----PTPVEQVKLLIGPEGGLSEAEIDMTQKYAF-SDILLGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|253990749|ref|YP_003042105.1| 16S ribosomal RNA methyltransferase RsmE [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|211639080|emb|CAR67692.1| Hypothetical protein yggJ [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782199|emb|CAQ85363.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 270

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 111/248 (44%), Gaps = 14/248 (5%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           +  + R++    L   T+   S +  +++  VLRM  G  + LF+G +  + ++I+   K
Sbjct: 27  NMRIPRIYHPELLSSSTEIYLSDEAANHVGRVLRMSHGQQLQLFDGSNQIFNAEITEASK 86

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                    S     +S +         +  ++++ IQKSVE+G+  I P+I+       
Sbjct: 87  KSVKVHISNSTLADNESPLNLHLGQVISRGEKMEFTIQKSVELGVNTITPLISERCGVKL 146

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
                   + + +   I+A EQC    +P I P   LE      D + ++        S 
Sbjct: 147 DGDRLAKKLQQWQKIAIAACEQCCRNRIPEIRPVMQLEQWCAENDGSLKLNLHPRANQSI 206

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  V +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+ 
Sbjct: 207 NTLPL-----PVEKVRLLIGPEGGLSTDEIAMTANHQF-TDILLGPRVLRTETTALTAIT 260

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 261 ALQVRFGD 268


>gi|295109582|emb|CBL23535.1| RNA methyltransferase, RsmE family [Ruminococcus obeum A2-162]
          Length = 247

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 60/246 (24%), Positives = 117/246 (47%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKT--QGKASGDQYHYLAHVLRMKEGDNILLFNG--KDGEWLSKISYVG 62
           ++R FV+     +   Q    G   +++++VLRMK+G+ + + +G  K+     +     
Sbjct: 1   MQRFFVEPHQIDEGAHQIHILGSDVNHISNVLRMKQGEELWISDGGKKEYRCTIEDFSSD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           + +   +  Q       S +       K ++++ +IQK+VE+G   + PV T+       
Sbjct: 61  EVLLHIIYAQEPDYELPSRIYLFQGLPKADKMELIIQKAVELGAYEVIPVETKRCVVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPP-TTLEFLLKNWDHNCQIVFADETCGSE 175
            +     ++R +    SAA+Q   + +P ++   T  E L      + +++  +   G +
Sbjct: 121 GKKAAKKVERWKQIAESAAKQSKRMLIPNVHEVLTFKEALKYAEAMDIRLIPYELAKGMQ 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            + E L  I    +V I IGPEGG+  +E ET  S     P++LG RILR++TA +A ++
Sbjct: 181 ETKEILADIQPGQSVGIFIGPEGGFEEKEVETAISEG-AKPITLGKRILRTETAGLAILS 239

Query: 236 LVQAIC 241
           ++    
Sbjct: 240 VLMFQL 245


>gi|229593532|ref|YP_001455814.2| 16S ribosomal RNA methyltransferase RsmE [Citrobacter koseri ATCC
           BAA-895]
          Length = 243

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             + R++   P+   +Q     D  +++  VLRM  G  + LF+G +  + ++I+    K
Sbjct: 1   MRIPRIYHPEPITSGSQFSLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITNASKK 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           S+  KV   +    +    +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVDVKVLSATLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKRQQWQKIAIAACEQCGRNWVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|222034641|emb|CAP77383.1| UPF0088 protein yggJ [Escherichia coli LF82]
 gi|312947477|gb|ADR28304.1| 16S ribosomal RNA methyltransferase RsmE [Escherichia coli O83:H1
           str. NRG 857C]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTALYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|56750741|ref|YP_171442.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus elongatus
           PCC 6301]
 gi|81299617|ref|YP_399825.1| 16S ribosomal RNA methyltransferase RsmE [Synechococcus elongatus
           PCC 7942]
 gi|56685700|dbj|BAD78922.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168498|gb|ABB56838.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 107/236 (45%), Gaps = 6/236 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L+RL++        +   + DQ HYL  VLR+K GD   + +G+ G W +++    +   
Sbjct: 5   LRRLWLPPEQLQGDRWSLTADQRHYLQRVLRLKPGDRCAVIDGQGGLWTAELGDRDQLFP 64

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH--YNM 124
                       +  +      +     D +I+++ E+G+  I+PVI+  +Q        
Sbjct: 65  VGAVPVLPPAQPRLTLI---QSLPKQGFDEVIRQATELGVTTIQPVISDRSQVRPEAQKT 121

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           DR R   I A+EQ + L LP + P       +     +             N L  L A 
Sbjct: 122 DRWRKIAIEASEQSERLYLPQLEPIRLWSEAIAQIPADSLRCICLARRSLPNLLPWLQAQ 181

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
               ++AI IGPEGG+   E E   ++ + TP+SLG  ILR+ TA + A++L QA+
Sbjct: 182 PAWTDLAIAIGPEGGWSDAEIEQAIAVGW-TPVSLGSSILRAVTAPIVALSLAQAV 236


>gi|309388922|gb|ADO76802.1| protein of unknown function DUF558 [Halanaerobium praevalens DSM
           2228]
          Length = 253

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 105/247 (42%), Gaps = 10/247 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKD--GEWLSKISYVGKS 64
           + R F+D    I  +   SG+ Y++L + LR+  GD ++L +G     E          +
Sbjct: 1   MHRFFIDQSTEIGKKVFISGNDYNHLKNSLRLDLGDRVILSDGNGFDLEAEIITYQTESA 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +  +      +  V       K +++D +++K+ E+G   + P+ ++ T   +   
Sbjct: 61  ELKILTKEKSKVEPKIKVWLAQGLPKKSKMDLIVEKATEIGFSGLIPLESKRTIVKYNQK 120

Query: 125 ------DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIV--FADETCGSEN 176
                  R +    +AA+Q     +P I        +    +    ++  + DE   +  
Sbjct: 121 KKAKKRSRWQRVAEAAAKQSGRAVIPKIKNFCNSNNIKSFKEKFDYVLVLWEDEKKTTIK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S  K + IA    + ++IGPEGG+   E            ++LGPRILR++TA + A+  
Sbjct: 181 SFFKENEIAAEAKILLIIGPEGGFSEAEVNRFEQKLEAEIITLGPRILRTETAGIVALTA 240

Query: 237 VQAICGD 243
           + +  G+
Sbjct: 241 ILSEKGE 247


>gi|37525153|ref|NP_928497.1| hypothetical protein plu1185 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784579|emb|CAE13479.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   T+   S +  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRVYHPELLSSNTEIYLSDEAANHVGRVLRMSHGQQLQLFDGSNQIFNAQITEASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S     +S +         +  ++++ IQKSVE+G+  I P+I+        
Sbjct: 61  SVKVHISNSELADNESPLNLHLGQVISRGEKMEFTIQKSVELGVNVITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   LE      D + ++        S N
Sbjct: 121 GERLAKKLQQWQKIAIAACEQCCRNRVPEIRPVMQLEHWCAENDGSLKLNLHPRASQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG   +E     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVEKVRLLIGPEGGLSIDEIAMTANYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|309972536|gb|ADO95737.1| 16S rRNA m3U1498 methyltransferase [Haemophilus influenzae R2846]
          Length = 245

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|68248905|ref|YP_248017.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           86-028NP]
 gi|68057104|gb|AAX87357.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae 86-028NP]
          Length = 245

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DTERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|145632547|ref|ZP_01788281.1| hypothetical protein CGSHi3655_01994 [Haemophilus influenzae 3655]
 gi|144986742|gb|EDJ93294.1| hypothetical protein CGSHi3655_01994 [Haemophilus influenzae 3655]
          Length = 245

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|71280059|ref|YP_267997.1| 16S ribosomal RNA methyltransferase RsmE [Colwellia psychrerythraea
           34H]
 gi|71145799|gb|AAZ26272.1| conserved hypothetical protein TIGR00046 [Colwellia psychrerythraea
           34H]
          Length = 244

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/250 (26%), Positives = 106/250 (42%), Gaps = 15/250 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R+F      +      S D + ++  VLR+KEGD I LFNG++    +        
Sbjct: 1   MRNPRIFQQSQFALNETVPLSDDAFGHVVRVLRLKEGDTITLFNGEEAFQYTATLCNVSK 60

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
               V+    +  +     ++       + +R+D+ +QKSVE+G+  I P+ T       
Sbjct: 61  KSADVKVTSQEENNSESPLNIHLGQGISRGDRMDFTLQKSVELGVNTITPLFTERCGVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +       + +   ISA EQ    ++P +  P  L   LK      +I    +   S 
Sbjct: 121 NAERLEKKRQQWQKIVISACEQSGRASVPIVAEPMLLADWLKQETSALKINLHPKAQHSI 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            SL           V +LIGPEGG   EE    +   F   + LGPR+LR++TAA+ A+ 
Sbjct: 181 MSL-----PMENTRVRLLIGPEGGLSDEEITQANDSDF-HDVLLGPRVLRTETAALTAIT 234

Query: 236 LVQAICGDWY 245
            +Q   GD +
Sbjct: 235 ALQCRFGDLH 244


>gi|325662164|ref|ZP_08150782.1| hypothetical protein HMPREF0490_01520 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471613|gb|EGC74833.1| hypothetical protein HMPREF0490_01520 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 246

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  FV          + +G   +++ +VLRMK G+ + + +G + ++L +I  +     
Sbjct: 1   MQHFFVVPDQVRDGYIEITGSDVNHMKNVLRMKTGEQLEISDGNNKKYLCEIESLEADKV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               +E Q       S +       K+++++ +IQK+VE+G   + PV T+        +
Sbjct: 61  TARILEEQEAENELPSKLYLFQGLPKSDKMELIIQKAVELGAWEVIPVATKRAVVKLDQK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSENS 177
                 +R    + SAA+Q     +P I      +  L      +  ++  +   G + +
Sbjct: 121 KAAKKRERWSGISESAAKQAGRNVIPEIKQVMNFQEALSYAKSLDVLLIPYELAEGMQAT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E++ AI    +V I IGPEGG+  EE +         P++LG RILR++TA +  ++++
Sbjct: 181 KERIQAIQPGQSVGIFIGPEGGFEQEEVKLAMEAG-AYPITLGRRILRTETAGMTMLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|311278138|ref|YP_003940369.1| hypothetical protein Entcl_0810 [Enterobacter cloacae SCF1]
 gi|308747333|gb|ADO47085.1| protein of unknown function DUF558 [Enterobacter cloacae SCF1]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKISYVG 62
             + R++   P+ +  Q   S D  +++  VLRM  G  I LF+G +  +      +   
Sbjct: 1   MRIPRIYHPEPVTVGQQMALSDDAANHVGRVLRMGIGQAIQLFDGSNQLFDAEIVHADKK 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 ++ ++  +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVRVTVLKGETDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 AERLNKKIQQWQKIAIAACEQCGRNRIPEIRPAMDLEQWCAEQDDALKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSADEIAMTARYRF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|327395101|dbj|BAK12523.1| hypothetical UPF0088 protein YggJ [Pantoea ananatis AJ13355]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+ + ++     D   ++  VLRM  G ++ LF+G +  + ++I++V K 
Sbjct: 1   MRIPRIYHSQPVHVGSEITLDEDASGHVGRVLRMTSGQHVELFDGSNLTFAAEITHVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S+   ++S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  RVKVSITASQEDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ++A EQC    +P I P   LE      +   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAVAACEQCGRNRVPEIRPAMALEAWCSEAESGLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSADEIAMTAQHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|307245046|ref|ZP_07527140.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306854034|gb|EFM86245.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 112/247 (45%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +T    S D  +++  VLRM EG+ I+LF+G +  + + +  VGK 
Sbjct: 1   MRIPRIYHPELLANRTDCILSEDATNHVGRVLRMTEGEQIILFDGSNHIFHATLQAVGKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +  ++     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAKIDGSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +        V +LIG EGG  +EE E   +  F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPNVPE----AGVRLLIGSEGGLSAEEIEMTETQGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|226952621|ref|ZP_03823085.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226836610|gb|EEH68993.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 239

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 111/243 (45%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L      + +   +H+   VLR KE +  + FNGK GE+L  ++ + K   
Sbjct: 1   MNRFYIETELNTGNTIELTESVFHHWVRVLRAKEQEQAIFFNGKGGEYLVTLTVINKKNA 60

Query: 67  FKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                Q     + +    +      K +R+DY IQK+ E+G+  I+ + +   +      
Sbjct: 61  LVSIDQFNKLDRTAPFNVVLGQVMSKGDRMDYAIQKATELGVTTIQLLTSDRCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  R+  I+A EQC +  +P I  P +L   +K+     + V A     +   L
Sbjct: 121 RDQKKLDHWRSVAIAACEQCGMNRVPEILAPISLNDWVKSELPTSRFVLAPNKDQTNILL 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                    P++A+LIGPEGG    E ET +   F     +G R+LR++TA V A++++ 
Sbjct: 181 ------NSTPDIALLIGPEGGLSETEIETANQYQF-KNWCIGDRVLRTETAPVVALSILN 233

Query: 239 AIC 241
              
Sbjct: 234 YHF 236


>gi|170765588|ref|ZP_02900399.1| 16S rRNA methyltransferase RsmE [Escherichia albertii TW07627]
 gi|170124734|gb|EDS93665.1| 16S rRNA methyltransferase RsmE [Escherichia albertii TW07627]
          Length = 243

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E +         +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGRLDDHESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P  +LE      D   ++        S N
Sbjct: 121 NERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMSLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|16272258|ref|NP_438470.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae Rd
           KW20]
 gi|260581228|ref|ZP_05849047.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae RdAW]
 gi|1176097|sp|P44627|RSME_HAEIN RecName: Full=Ribosomal RNA small subunit methyltransferase E;
           AltName: Full=16S rRNA m3U1498 methyltransferase
 gi|1573272|gb|AAC21968.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092153|gb|EEW76097.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae RdAW]
          Length = 245

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC    +P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|307543622|ref|YP_003896101.1| hypothetical protein HELO_1033 [Halomonas elongata DSM 2581]
 gi|307215646|emb|CBV40916.1| K09761 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 248

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 110/254 (43%), Gaps = 18/254 (7%)

Query: 1   MKIHSHL---KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK 57
           M     +    R+ V   L              ++A VLR+  G  +++F+G+  E  + 
Sbjct: 1   MSAKHSMGKAPRIHVAAELQAGGDVVLPDGAARHVARVLRLGPGAPVIIFDGQGNEAEAI 60

Query: 58  ISYVGKSIRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITR 115
           ++  G+        +  +   +S   V    +  K +R+DY IQK+VE+G+  I P+ T 
Sbjct: 61  LTEAGRKQVVARVERVAAGRGESPLAVHLGQAISKGDRMDYAIQKAVELGVAEITPLYTE 120

Query: 116 YTQ------NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFAD 169
           +             +   +    SA EQC   TLP +YPP ++   L   D    +V   
Sbjct: 121 HGDVRLKGEREAKKLAHWQAVAASACEQCGRATLPPVYPPRSVVDWLAERDEPLCLVLHP 180

Query: 170 ETCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTA 229
            T G       L         A+LIGPEGG    E +      F   L+LGPRILR++TA
Sbjct: 181 GTPGG------LDRHDDPVRAALLIGPEGGLSHAEVDAAADAGFA-SLTLGPRILRTETA 233

Query: 230 AVAAMALVQAICGD 243
            V A++L+Q   GD
Sbjct: 234 PVVALSLLQNRFGD 247


>gi|301169013|emb|CBW28610.1| predicted protein [Haemophilus influenzae 10810]
          Length = 245

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC    +P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|229543807|ref|ZP_04432866.1| protein of unknown function DUF558 [Bacillus coagulans 36D1]
 gi|229324946|gb|EEN90622.1| protein of unknown function DUF558 [Bacillus coagulans 36D1]
          Length = 250

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 102/247 (41%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+D P   + + + SG+ YH++A V+RM  G         +   + +I  +     
Sbjct: 1   MQRYFLDRPYRGEQEIRLSGENYHHIARVMRMSVGSRFYGVFSDEKVCICEIGEITGDAV 60

Query: 67  FKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
                 +++  +     V       K ++L+++IQK  E+G     P +   +       
Sbjct: 61  VARITGWETAVKELPVHVTVSCGLPKADKLEWIIQKGTELGAFQFLPFLAERSVVKWDTK 120

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE----TCGS 174
                 +R +     AAEQ     LP I PP + + L++        + A E        
Sbjct: 121 KEAKKRERWQKIAQEAAEQSHRSHLPEISPPVSFQQLIEESHTYQYKLVAFEENAKEGEQ 180

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E L  ++   NV  + GPEGG   +E   L +  FV    LGPRILR++TA +  +
Sbjct: 181 HRFAELLSNMSEGGNVLAVFGPEGGLSLDEIRRLEAAGFV-SCGLGPRILRAETAPLYVL 239

Query: 235 ALVQAIC 241
           + +    
Sbjct: 240 SAISYHF 246


>gi|291618768|ref|YP_003521510.1| YggJ [Pantoea ananatis LMG 20103]
 gi|291153798|gb|ADD78382.1| YggJ [Pantoea ananatis LMG 20103]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 113/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   P+ + ++     D   ++  VLRM  G ++ LF+G +  + ++I++V K 
Sbjct: 1   MRIPRIYHSQPVHVGSEITLDEDASGHVGRVLRMTSGQHVELFDGSNLTFAAEITHVDKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                   S+   ++S +         +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  RVKVSITASQEDDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ++A EQC    +P I P   LE      +   ++        S N
Sbjct: 121 AERLAKKIQQWQKIAVAACEQCGRNRVPEIRPAMALEAWCSEAESGLKLNLHPRASHSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPVERVRLLIGPEGGLSTDEIAMTAQHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|310826526|ref|YP_003958883.1| hypothetical protein ELI_0908 [Eubacterium limosum KIST612]
 gi|308738260|gb|ADO35920.1| hypothetical protein ELI_0908 [Eubacterium limosum KIST612]
          Length = 245

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 104/246 (42%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + R FV             G+ + ++  VLR+++ + I + +G+  ++++ +  VGK   
Sbjct: 1   MHRFFVSPGQIEDGLVTIEGEDFKHITKVLRLRDDEAIEVCDGRGTDYIACVETVGKDSL 60

Query: 66  --RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT-----Q 118
             R      SR +T    V       K  +++ +IQK VE G  +I P  +  T      
Sbjct: 61  KGRILESRPSRGETDSLRVTLFQGVPKGQKMESVIQKCVEAGAASIVPFTSERTVVKLGD 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                  R +     AA+Q     +P +   TTL  +    D+   ++ A E     +  
Sbjct: 121 KEEKKTRRWQRVAYEAAKQSKRGIIPHVAEVTTLSAVADTLDNYDLVLIAYEGEEESSLK 180

Query: 179 EKLHAIAH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           + +  +      +A++IGPEGG+   E   +        +SLG RILR++TA V  +A +
Sbjct: 181 DVISCLEFDPERIAVIIGPEGGFAPAEVAMIEEAGGY-SVSLGRRILRTETAGVVLLAQL 239

Query: 238 QAICGD 243
                D
Sbjct: 240 NFFYED 245


>gi|145640243|ref|ZP_01795827.1| hypothetical protein CGSHiR3021_09300 [Haemophilus influenzae
           R3021]
 gi|145274829|gb|EDK14691.1| hypothetical protein CGSHiR3021_09300 [Haemophilus influenzae
           22.4-21]
          Length = 245

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|145636562|ref|ZP_01792230.1| hypothetical protein CGSHiHH_08792 [Haemophilus influenzae PittHH]
 gi|145270387|gb|EDK10322.1| hypothetical protein CGSHiHH_08792 [Haemophilus influenzae PittHH]
          Length = 245

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|54298937|ref|YP_125306.1| 16S ribosomal RNA methyltransferase RsmE [Legionella pneumophila
           str. Paris]
 gi|53752722|emb|CAH14157.1| hypothetical protein lpp3004 [Legionella pneumophila str. Paris]
          Length = 244

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F 
Sbjct: 7   RIYQPGEYQPGQVLELSPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTAFIERVKKKQVFV 66

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 67  RIASVLEVNRESPLKIHLAQAISKGERMEVVMQKSAELGVACITPIITERCQVKIDKEKM 126

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 127 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 186

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                  P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 187 -----QPPDVALIIGPEGGFSDEEITLTSGYGFL-PLSLGPRVLRTETAAITALSVLQAA 240

Query: 241 CGD 243
            GD
Sbjct: 241 GGD 243


>gi|292571762|gb|ADE29677.1| hypothetical protein rpr22_CDS160 [Rickettsia prowazekii Rp22]
          Length = 236

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 74/241 (30%), Positives = 138/241 (57%), Gaps = 8/241 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK +    R++++  L   ++ + + D  HY+  VLR+K  D++ +FNG DGE+L++I+ 
Sbjct: 1   MKYN----RIYINSNLAENSKLELARDYVHYVKTVLRLKIHDSLRIFNGSDGEFLAQITQ 56

Query: 61  VGKSI-RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           +GK+     ++ Q +    +S +    + IK+++L   I  + ++G+  I P+ITR  Q 
Sbjct: 57  IGKNNLSVVLKEQLKKAYIESALTLAVAIIKSDKLMLTINMATQLGITKIIPLITRRCQF 116

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N++R+    I A EQ + L  P I    TL+  LK   +N  I++A+E    ++S+ 
Sbjct: 117 RTVNIERLMKCVIEATEQSERLNPPIIEQAITLKDYLK--KNNNLILYANEHEKVKHSIL 174

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            + ++    ++AI+IGPEGG+ ++E E L        +SLG  ILR++TAA++ ++ V+ 
Sbjct: 175 HISSL-LSKDIAIIIGPEGGFTNDELELLALYNNTQSISLGSNILRTETAAISLISQVRL 233

Query: 240 I 240
           +
Sbjct: 234 L 234


>gi|254492173|ref|ZP_05105347.1| conserved hypothetical protein TIGR00046 [Methylophaga thiooxidans
           DMS010]
 gi|224462498|gb|EEF78773.1| conserved hypothetical protein TIGR00046 [Methylophaga thiooxydans
           DMS010]
          Length = 242

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 112/247 (45%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R F       +         + +   VLR+K+G  I LFNGK  E+ + +++V + 
Sbjct: 1   MRIPRFFCPELDASQRVLPLPEAVHRHAIQVLRLKQGARIQLFNGKGLEYQATLTHVERK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                  E  +++     ++  +    +  R+D+ IQK+VE+G+  I PV+T        
Sbjct: 61  RSEAELGEQLTQASESPLNITLLQGISRGERMDFAIQKAVELGVNQIIPVMTERCNVQLK 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   +SA EQ     LP +     ++  L +     ++V   +     N
Sbjct: 121 HDRIEKRLAHWQGVIVSACEQSGRAVLPTLSEVVDMQNALNSTADTMKLVLDPQAQTRFN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L+          + +LIGPEGG   +E +   S  F T +  GPRILR++TA+ AA+A+
Sbjct: 181 DLQAATQ------LTLLIGPEGGLTDDEVKMATSSGF-TAVQFGPRILRTETASTAALAV 233

Query: 237 VQAICGD 243
           VQ++ GD
Sbjct: 234 VQSLWGD 240


>gi|157825352|ref|YP_001493072.1| 16S ribosomal RNA methyltransferase RsmE [Rickettsia akari str.
           Hartford]
 gi|157799310|gb|ABV74564.1| hypothetical protein A1C_01170 [Rickettsia akari str. Hartford]
          Length = 254

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 69/244 (28%), Positives = 124/244 (50%), Gaps = 9/244 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           M+ +    R++++  L   ++ + + D  HY+  VLR+K  D + +FNG +GE+L+ I+ 
Sbjct: 1   MRFN----RIYINSRLAENSKIELASDHVHYVKTVLRLKVNDGLRIFNGTEGEFLAHITA 56

Query: 61  VGKSIR-FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           +GK     +++ Q +    +S +    + IK ++L   I  + ++G+  I P+IT   Q 
Sbjct: 57  IGKHNISVRLKEQLKKPYTESALTLAVAIIKQDKLMLAINMATQLGITKIIPLITSRCQF 116

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N++R+    I A EQ + L  P I    T++  LK  ++        E   +     
Sbjct: 117 RTVNIERLTKCVIEATEQSERLIPPIIEKAITIQDCLKKHNNFMLYANEHEKEENSILRI 176

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
              +     N+AI+IGPEGG+ ++E E L S      +SLG  ILR++TA + A+  V+ 
Sbjct: 177 ---SSLLDNNIAIIIGPEGGFTNDELELLASYKNTKSVSLGSNILRAETAVITAIVQVK- 232

Query: 240 ICGD 243
           + G 
Sbjct: 233 LLGR 236


>gi|218710623|ref|YP_002418244.1| 16S ribosomal RNA methyltransferase RsmE [Vibrio splendidus LGP32]
 gi|218323642|emb|CAV19930.1| Hypothetical protein VS_2677 [Vibrio splendidus LGP32]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R++    +    Q   S D   ++  VLRMKEG ++LLF+G   E+ + I+ V K 
Sbjct: 1   MRTPRIYHPELINQLGQLALSEDAAGHVGRVLRMKEGQDVLLFDGSGAEFPATIAEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVTVNVTERIERSSESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ    T+P I P   LE          ++        S N
Sbjct: 121 AKRFEKKLAQWQKIAIAACEQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      I  V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PISKVRLLIGPEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|238918250|ref|YP_002931764.1| hypothetical protein NT01EI_0287 [Edwardsiella ictaluri 93-146]
 gi|238867818|gb|ACR67529.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  +     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDGSNRVFDAEIVSADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    R +  +S +         +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 61  NVRVRLDGVREEDSESPLHLHLGQVMSRGEKMEFTIQKSIELGVSVITPLISERCGVRLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +       + +   I+A EQC    +P I P  TLE      D   ++        S N
Sbjct: 121 AERMAKKQQQWQKIAIAACEQCGRNRIPQIRPIMTLEAWCAEPDDGLRLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           + +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PQHRIRLLIGPEGGLSADEIAMTANHRF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|297617813|ref|YP_003702972.1| hypothetical protein Slip_1648 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145650|gb|ADI02407.1| protein of unknown function DUF558 [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 253

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 102/248 (41%), Gaps = 13/248 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLS--KISYVGKS 64
           L R FV             GD+  +L+ VLR+  GD +L+ +G   E L   + +  G  
Sbjct: 4   LHRFFVAHERIKDGYVIIEGDEAKHLSKVLRLGPGDEVLVCDGSGKELLVRLETAEKGLI 63

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               V      +     V  +    K  ++D+++QK+VE+G+  I PV+T          
Sbjct: 64  KGRVVNQNHPEREPGLTVGLVQGVGKGEKMDFIVQKAVELGISRIYPVMTDRGTVRLDGE 123

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
              + + R       A +QC    +P I   T L  ++     +   +F  E        
Sbjct: 124 RAFHRVQRWEKIAKEACKQCGRTVVPEIKGITDLTVVMDECR-DIPGLFFYEGEWKRPLK 182

Query: 179 EKLHAIAHI---PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
             L   A I     V + IG EGG+   E ET      +    LGPRILR++TAA+AA+ 
Sbjct: 183 TILRENARILRDRGVILYIGAEGGFSLREAETARKRG-ILMAGLGPRILRTETAALAAIT 241

Query: 236 LVQAICGD 243
            V    GD
Sbjct: 242 AVMYELGD 249


>gi|148361269|ref|YP_001252476.1| hypothetical protein LPC_3243 [Legionella pneumophila str. Corby]
 gi|148283042|gb|ABQ57130.1| hypothetical protein LPC_3243 [Legionella pneumophila str. Corby]
          Length = 242

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F 
Sbjct: 5   RIYQPGEYQPGQVLELSPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTASIERVKKKQVFV 64

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 65  RIASVLEVNRESPLKIHLAQAISKGERMEVVMQKSAELGVACITPIITERCQVKIDKEKM 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 125 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                  P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 185 -----QPPDVALIIGPEGGFSDEEITLTSGYGFL-PLSLGPRVLRTETAAITALSVLQAA 238

Query: 241 CGD 243
            GD
Sbjct: 239 GGD 241


>gi|224476685|ref|YP_002634291.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222421292|emb|CAL28106.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 250

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 93/247 (37%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKAS-GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F++    I  +   +  +  H+++ V+R +  D I++       +  KI  +    
Sbjct: 1   MQRYFINQNADINQRFFITEKEDIHHISTVMRNQPNDFIIVTFNHGKVYKCKIISIHNEE 60

Query: 66  RFKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
                 +  +       +V      +K ++ ++++QK  E+G     PV           
Sbjct: 61  IEIELNEELNSDTELPVEVTICSGLLKADKYEWLLQKCTELGASHFIPVQMDRSIVKLNQ 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE-- 175
                 + R       AAEQ   L +P     + L+ +  N D    ++ A E    E  
Sbjct: 121 NKIEKKLVRWNKIVKEAAEQSYRLIIPTFEFISNLKQVYVNIDKYDYVLVAYEDAAKEGE 180

Query: 176 --NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
                + L        + I+ GPEGG   EE            + LG RILR++TA + A
Sbjct: 181 ISQLKKTLQQFQSGNRILIVFGPEGGLSEEEVALFQ--GNSEIVGLGKRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|307260690|ref|ZP_07542380.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306869611|gb|EFN01398.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +T    S D  +++  VLRM EG+ I+LF+G +  + + +  VGK 
Sbjct: 1   MRIPRIYHPELLANRTDCILSEDATNHVGRVLRMTEGEQIILFDGSNHIFHTTLQAVGKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +  ++     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAKIDGSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +        V +LIG EGG  +EE     +  F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPNVPE----AGVRLLIGSEGGLSAEEIAMTETQGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|323162608|gb|EFZ48455.1| RNA methyltransferase family protein [Escherichia coli E128010]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   +      D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEITSASKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +E +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVKVLEGKIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 SERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|157085700|gb|ABV15378.1| hypothetical protein CKO_04321 [Citrobacter koseri ATCC BAA-895]
          Length = 254

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             + R++   P+   +Q     D  +++  VLRM  G  + LF+G +  + ++I+    K
Sbjct: 12  MRIPRIYHPEPITSGSQFSLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITNASKK 71

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           S+  KV   +    +    +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 72  SVDVKVLSATLDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 131

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 132 SERLNKKRQQWQKIAIAACEQCGRNWVPEIRPAMDLEAWCAEQDEGLKLNLHPRASASIN 191

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 192 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 245

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 246 LQVRFGD 252


>gi|148827457|ref|YP_001292210.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           PittGG]
 gi|148718699|gb|ABQ99826.1| hypothetical protein CGSHiGG_04330 [Haemophilus influenzae PittGG]
          Length = 245

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCHLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC    +P I P   L+      D   ++        S 
Sbjct: 120 DTERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|160872460|ref|ZP_02062592.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159121259|gb|EDP46597.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 241

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 115/247 (46%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGK-DGEWLSKISYVGK 63
             L R++    L        S +  H+L  VLR++ GD  ++FNG+      + I  +  
Sbjct: 1   MRLTRIYQAHALNTGQIISLSQEAAHHLIRVLRLQVGDECIIFNGQAGEFQATIIERIKT 60

Query: 64  SIRFKV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
           + R K+ E+ + ++     +  + + + ++++DY++QK+VE+G+  + P++T +      
Sbjct: 61  TARVKLGEFNAINRESPLQITLVQAILHSDKMDYLLQKAVELGVTHVIPLLTAHSTLKLT 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +     A EQ     +P +  P T +  +       +I+          
Sbjct: 121 PDRWEKRYVHWQGVMRGACEQSGRTRIPILENPMTFDVAMMALKAETRIILQPAAKKM-- 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
               LH++     V + IGPEGG+   E ++   + F   + +GPR+LRS+TA V AM+L
Sbjct: 179 ----LHSLPFCQRVVLCIGPEGGWSLNELDSAQKMGF-QAMKMGPRVLRSETAGVVAMSL 233

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 234 LQGLYGD 240


>gi|294787701|ref|ZP_06752945.1| RNA methyltransferase, RsmE family [Simonsiella muelleri ATCC
           29453]
 gi|294483994|gb|EFG31677.1| RNA methyltransferase, RsmE family [Simonsiella muelleri ATCC
           29453]
          Length = 239

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 111/246 (45%), Gaps = 16/246 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK--ISYVGKS 64
           + R +    L   ++     +   ++ HVLR++ G+ I LFNG    + ++        +
Sbjct: 1   MPRFYFPVNLIPDSEWTLPDNLVRHI-HVLRLRVGEQITLFNGDGAAYSAQLLQLEKRHA 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               +  Q  +      ++ + +     R+D+ IQKSVE+G+ AI+PV++  +      +
Sbjct: 60  TCRVLFRQPENTESPLSIKLVQAISSGERMDFTIQKSVELGVVAIQPVMSERSVVRLSGE 119

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +   ISA EQC   T+P I P  + E  L+                S    
Sbjct: 120 RADKRVQRWQEIAISACEQCGRNTIPDILPIVSFEQYLRQKSDEL------HILMSLRQA 173

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L  +     V ++IG EGG+   E+    S      + LG R+LR++TA++AA+A +Q
Sbjct: 174 RSLKDLPTPTRVTLMIGAEGGWTQAEENAAFSAN-CQAVVLGKRVLRTETASLAAIAAMQ 232

Query: 239 AICGDW 244
            + GD+
Sbjct: 233 TLWGDF 238


>gi|127514152|ref|YP_001095349.1| hypothetical protein Shew_3224 [Shewanella loihica PV-4]
 gi|126639447|gb|ABO25090.1| protein of unknown function DUF558 [Shewanella loihica PV-4]
          Length = 243

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++      +  Q     +   ++  VLRM  G+ + LFNG    +L++I    K 
Sbjct: 1   MRIPRIYQLGNYDLNQQLMLDEEAAGHVGRVLRMGAGEQLELFNGDGHNYLTEIVTASKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  ++       ++       + +R+D+ +QKSVE+G+  I P+ +        
Sbjct: 61  NVEVRVLSKEANDNESPLNLHLGQVISRGDRMDFTLQKSVELGVNTITPLFSERCGVKLT 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQ    T+P + P   L+          ++          N
Sbjct: 121 GERLEKKIQQWQKIVISACEQSGRSTVPEVRPAMQLDDWCGEATQALKLNLHPRADHGIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L     +   P V +LIGPEGG   +E     +  F T + LGPR+LR++TAA+ A++ 
Sbjct: 181 GL-----VMETPRVRLLIGPEGGLSPQEIAMTETHAF-TDVLLGPRVLRTETAALTAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQLKFGD 241


>gi|296108607|ref|YP_003620308.1| hypothetical protein lpa_04293 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650509|gb|ADG26356.1| hypothetical protein lpa_04293 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 242

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F 
Sbjct: 5   RIYQPGEYQPGQVLELSPEAGQHVGVVLRMEQGEQLTLFNGDNQEFTAFIERVKKKQVFV 64

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 65  RIASVLEVNRESPLKIHLAQAISKGERMEVVMQKSAELGVACITPIITERCQVKIDKEKM 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 125 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                  P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 185 -----QPPDVALIIGPEGGFSDEEITLTSGYGFL-PLSLGPRVLRTETAAITALSVLQAA 238

Query: 241 CGD 243
            GD
Sbjct: 239 GGD 241


>gi|229845005|ref|ZP_04465142.1| hypothetical protein CGSHi6P18H1_04607 [Haemophilus influenzae
           6P18H1]
 gi|229812139|gb|EEP47831.1| hypothetical protein CGSHi6P18H1_04607 [Haemophilus influenzae
           6P18H1]
          Length = 245

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA+++A++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLSAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|32034407|ref|ZP_00134589.1| COG1385: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207721|ref|YP_001052946.1| 16S ribosomal RNA methyltransferase RsmE [Actinobacillus
           pleuropneumoniae L20]
 gi|165975693|ref|YP_001651286.1| 16S ribosomal RNA methyltransferase RsmE [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149504|ref|YP_001968029.1| hypothetical protein APP7_0235 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251645|ref|ZP_07337818.1| hypothetical protein APP6_0849 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303252796|ref|ZP_07338956.1| hypothetical protein APP2_0384 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247218|ref|ZP_07529268.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249446|ref|ZP_07531435.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307251763|ref|ZP_07533666.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307254000|ref|ZP_07535848.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256261|ref|ZP_07538045.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258455|ref|ZP_07540193.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262823|ref|ZP_07544448.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126096513|gb|ABN73341.1| hypothetical protein APL_0233 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875794|gb|ABY68842.1| hypothetical protein APJL_0238 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914635|gb|ACE60887.1| hypothetical protein APP7_0235 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648357|gb|EFL78553.1| hypothetical protein APP2_0384 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302649487|gb|EFL79670.1| hypothetical protein APP6_0849 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306856276|gb|EFM88429.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858520|gb|EFM90587.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860764|gb|EFM92774.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863026|gb|EFM94972.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865225|gb|EFM97124.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867460|gb|EFM99310.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306871838|gb|EFN03557.1| Ribosomal RNA small subunit methyltransferase E [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 243

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +T    S D  +++  VLRM EG+ I+LF+G +  + + +  VGK 
Sbjct: 1   MRIPRIYHPELLANRTDCILSEDATNHVGRVLRMTEGEQIILFDGSNHIFHATLQAVGKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +  ++     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QIIAKIDGSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGVKTITPLWSERCGVKLN 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L    K  D   ++        +  
Sbjct: 121 DERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQDDMLKLNLHPRAKYTIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            L  +        V +LIG EGG  +EE     +  F T + LG R+LR++TA++AA+  
Sbjct: 181 QLPNVPE----AGVRLLIGSEGGLSAEEIAMTETQGF-TEVLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|85059999|ref|YP_455701.1| hypothetical protein SG2021 [Sodalis glossinidius str. 'morsitans']
 gi|84780519|dbj|BAE75296.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 243

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL + T      D  H+++ VLRM     I LF+G +  + ++++ V K 
Sbjct: 1   MRIPRIYHPAPLTVGTVLALGDDAAHHVSRVLRMTVDAPIALFDGSNHVFAARLTRVDKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  Q   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  GVEATVLATQMEDRESLLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLFSARCGVKLE 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + +     I A EQC    L  I P  TLE      +   ++        S N
Sbjct: 121 GERLEKKLQQWHKIAIGACEQCGRNRLAEIRPAMTLEAWCAEQEAGLKLNLHPRAQQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           + +LIGPEGG  +EE     +  F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PAHGIRLLIGPEGGLSAEEIALTANYGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|262042596|ref|ZP_06015752.1| 16S rRNA methyltransferase RsmE [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040030|gb|EEW41145.1| 16S rRNA methyltransferase RsmE [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 243

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L + +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK 
Sbjct: 1   MRIPRIHHPERLIVGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NVTVEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE      D   ++        S N
Sbjct: 121 AERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLETWCAEQDSGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|238754605|ref|ZP_04615959.1| Ribosomal RNA small subunit methyltransferase E [Yersinia ruckeri
           ATCC 29473]
 gi|238707236|gb|EEP99599.1| Ribosomal RNA small subunit methyltransferase E [Yersinia ruckeri
           ATCC 29473]
          Length = 243

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S D  +++  VLRM EG ++ LF+G +  + ++I +V K 
Sbjct: 1   MRIPRIYHPQPLSAHTELALSDDAANHVGRVLRMSEGHHLQLFDGSNQVFSAEIIHVDKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E     +    ++       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVHVHLGEAALEDRESPLNLHLGQVISRGEKMEFTIQKSIELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC   TLP I     LE      D + ++        S N
Sbjct: 121 GERLAKKIQQWQKIAIAACEQCGRNTLPEIREAMQLEAWCAEQDDSLKLNLHPRASNSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E E      F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVNRVRLLIGPEGGLTADEIEMTSHHGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|238759323|ref|ZP_04620489.1| Ribosomal RNA small subunit methyltransferase E [Yersinia aldovae
           ATCC 35236]
 gi|238702484|gb|EEP95035.1| Ribosomal RNA small subunit methyltransferase E [Yersinia aldovae
           ATCC 35236]
          Length = 261

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL   T+   S +  +++  VLRM EG N+ LF+G +  + ++I    K 
Sbjct: 19  MRIPRIYHPQPLQANTELALSDEAANHVGRVLRMMEGQNLQLFDGSNQVFTAEIIRADKK 78

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E     +    ++       +  ++++ +QKS+E+G+  I P+ +        
Sbjct: 79  NLIVRIAEGLLEDRESPLNLHLGQVISRGEKMEFTVQKSIELGVNVITPLFSERCGVKLD 138

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I     L       D + ++        S N
Sbjct: 139 GERLAKKIQQWQKIAIAACEQCGRNKIPEIREAMQLSEWCAEQDDSLKLNLHPRANNSIN 198

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L      A +  V +LIGPEGG  ++E      L F T + LGPR+LR++T A+ A+  
Sbjct: 199 TL-----SASLNKVRLLIGPEGGLSADEIAMTSRLGF-TDILLGPRVLRTETTALTAITA 252

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 253 LQVRFGD 259


>gi|223938953|ref|ZP_03630839.1| protein of unknown function DUF558 [bacterium Ellin514]
 gi|223892380|gb|EEF58855.1| protein of unknown function DUF558 [bacterium Ellin514]
          Length = 251

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 103/247 (41%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + R ++    C +     +  + H+   VLR++EG+ +++ +G   E L +     K   
Sbjct: 1   MHRFYLPPEECKENTLILTDREAHHALQVLRLREGEKLVVLDGAGQEILCEAQKAEKDQL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT----- 120
           + KV  ++        +    +  K   ++ +IQK+ E+G   I P+++           
Sbjct: 61  KLKVLQRNFQPQLPYQITLFQAIPKGKIIETIIQKATELGAFRIVPLLSDRVVTQLDDEG 120

Query: 121 -HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               +++ +   I A +QC    LP +  P + +  L   +     +         +  E
Sbjct: 121 AASKVEKWKQTAIEAIKQCGSPWLPQVDAPVSPKDYLARGEKFELPLIGSLQNDCRHPRE 180

Query: 180 KLHAIAH-----IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 +        V+I IGPEG +   E   + S   V P++LG  +LRS+TAA+ ++
Sbjct: 181 YFKTFHNERKRLPKTVSIWIGPEGDFTPAEMNLIKSAG-VLPITLGKLVLRSETAAIYSL 239

Query: 235 ALVQAIC 241
           +++    
Sbjct: 240 SVLNYEL 246


>gi|212637179|ref|YP_002313704.1| 16S ribosomal RNA methyltransferase RsmE [Shewanella piezotolerans
           WP3]
 gi|212558663|gb|ACJ31117.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 261

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 101/248 (40%), Gaps = 14/248 (5%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
              + R++    L I        +   ++  VLRM  G+ + LFNG    +L++I    K
Sbjct: 18  TMRVPRIYQASSLAIDETVSLHEEAAGHVGRVLRMAAGEQVCLFNGDGNNYLAEILSASK 77

Query: 64  SIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +  +S        +       + +R+D+ IQKSVE+G+  I P+ +       
Sbjct: 78  KNVAVKVLSCESNDSESPLHLHLGQVISRGDRMDFTIQKSVELGVNTITPLFSERCGVKL 137

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   +SA EQ     +P I P   L         + +I          
Sbjct: 138 SGERLEKKIQQWQKIVVSACEQSGRSVVPVIRPAMQLSDWCAEETSSLKINLHPRASHGV 197

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N L           V ++IGPEGG  + E     +  F T + LGPR+LR++TAA+  + 
Sbjct: 198 NGLCL-----PNNRVRLVIGPEGGLSATEITMTETHKF-TDVLLGPRVLRTETAALTTIT 251

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 252 ALQLKFGD 259


>gi|300718242|ref|YP_003743045.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299064078|emb|CAX61198.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+F    L   ++     +  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIFHPELLTAGSEIALCDEAANHVGRVLRMGAGQALELFDGSNLTFAAEIVQADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +SR  +++S +         +  ++++ IQK+VE+G+  I P+ +        
Sbjct: 61  SVRVSLGESREDSRESPLHLHLGQVMSRGEKMEFTIQKAVELGVNVITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +       + +   I+A EQC   ++P +     LE      D   ++        S N
Sbjct: 121 AERLAKKHQQWQKIVIAACEQCGRNSVPEVREAMMLERWSAEQDDGLKLNLHPRASQSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLTADEISMTAQYGF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|152971897|ref|YP_001337006.1| hypothetical protein KPN_03379 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150956746|gb|ABR78776.1| hypothetical protein KPN_03379 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L + +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK 
Sbjct: 1   MRIPRIHHPERLIVGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NVTAEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE      D   ++        S N
Sbjct: 121 AERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLEAWCAEQDSGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|262368644|ref|ZP_06061973.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316322|gb|EEY97360.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 238

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 112/243 (46%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F++  L +    + +   +H+   VLR + G+   LFNG+ GE+   +S V K   
Sbjct: 1   MPRFFMEAELNVDHTVELTETVFHHWVKVLRAQVGETATLFNGQGGEYEVTLSDVAKKSA 60

Query: 67  FKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                 +   ++T            K +R+DY+IQK+VE+G+  I+ + +   +      
Sbjct: 61  SVQVTAFNPTNRTPAFKALLGQVMSKGDRMDYVIQKAVELGVSEIQLLTSERCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  +   I+A EQC +  +P I  P +LE  L +     ++V A      +   
Sbjct: 121 RDQKKIDHWQGIAIAACEQCGMNLVPKILAPVSLEKWLASELPATRLVLAPNKEKLDVLA 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                    PN+A+LIGPEGG    E  T +   F+    +G R+LR++TA V A++++ 
Sbjct: 181 HA------TPNIALLIGPEGGLSEAEIITANEHGFI-SWCIGERVLRTETAPVVALSILN 233

Query: 239 AIC 241
              
Sbjct: 234 YNL 236


>gi|329998571|ref|ZP_08303168.1| 16S rRNA methyltransferase RsmE [Klebsiella sp. MS 92-3]
 gi|328538642|gb|EGF64741.1| 16S rRNA methyltransferase RsmE [Klebsiella sp. MS 92-3]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L + +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK 
Sbjct: 1   MRIPRIHHPERLIVGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NVTVEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE      D   ++        S N
Sbjct: 121 AERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLEAWCAEQDSGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|257095553|ref|YP_003169194.1| 16S ribosomal RNA methyltransferase RsmE [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048077|gb|ACV37265.1| protein of unknown function DUF558 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 254

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 108/244 (44%), Gaps = 10/244 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R     PL +  Q         +   VLR++ GD + LF G  GE+ ++I+ + +    
Sbjct: 5   PRFHCPVPLAVGAQVDLPEVVAQHAVKVLRLRRGDAVTLFTGAGGEYSARIAGIERLRVS 64

Query: 68  K--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
              +++    +     +  + +    +++D  +QK+VE+G+    PVI+R        Q 
Sbjct: 65  VEILQWLPTERESPLSITLVQALQAGDKMDMTVQKAVELGVDRFVPVISRRSVVRLADQR 124

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                +  R    ++ EQC    LP +  P +LE  L        +        +  SL 
Sbjct: 125 ALRRAEHWRGVVAASCEQCGRNRLPEVAIPESLEHWLMRPPPPGVLRLL-LAPVASYSLA 183

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L   +   ++ +L+G EGG   EE        F+  + LGPRILR++TA +AA+A +Q 
Sbjct: 184 MLSGPSADGHIELLVGAEGGLAPEEVRLAALAGFL-SVRLGPRILRTETAGLAALAAIQF 242

Query: 240 ICGD 243
           + GD
Sbjct: 243 LWGD 246


>gi|206576729|ref|YP_002236603.1| ribosomal RNA small subunit methyltransferase RsmE [Klebsiella
           pneumoniae 342]
 gi|290511348|ref|ZP_06550717.1| ribosomal RNA small subunit methyltransferase E [Klebsiella sp.
           1_1_55]
 gi|206565787|gb|ACI07563.1| ribosomal RNA small subunit methyltransferase RsmE [Klebsiella
           pneumoniae 342]
 gi|289776341|gb|EFD84340.1| ribosomal RNA small subunit methyltransferase E [Klebsiella sp.
           1_1_55]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L + +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK 
Sbjct: 1   MRIPRIHHPERLTVGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NVTVEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE      D   ++        S N
Sbjct: 121 AERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLEEWCAEQDSGMKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|86146407|ref|ZP_01064731.1| hypothetical protein MED222_22541 [Vibrio sp. MED222]
 gi|85835886|gb|EAQ54020.1| hypothetical protein MED222_22541 [Vibrio sp. MED222]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 71/247 (28%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     +          D   ++  VLRMKEG +ILLF+G   E+ + I+ V K 
Sbjct: 1   MRIPRIHHPERIHQLGSLALGEDAAGHVGRVLRMKEGQDILLFDGSGAEFPATIAEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G+  I P+I+        
Sbjct: 61  NVTVNVTERIERSSESPLDLHLGQVISRGDKMEFTIQKSVELGVNTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ    T+P I P   LE          ++        S N
Sbjct: 121 TKRFEKKLAQWQKIAIAACEQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      I  V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PISKVRLLIGPEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|52843130|ref|YP_096929.1| 16S ribosomal RNA methyltransferase RsmE [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52630241|gb|AAU28982.1| hypothetical protein lpg2936 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 244

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F 
Sbjct: 7   RIYQPGEYQPGQLLELSPEAGQHVGVVLRMEQGEQLTLFNGDNKEFTASIERVKKKQVFV 66

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 67  RIASVLEVNRESPLKIHLAQAISKGERMEMVMQKSAELGVACITPLITERCQVKIDKEKM 126

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 127 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 186

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                  P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 187 -----QPPDVALIIGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAA 240

Query: 241 CGD 243
            GD
Sbjct: 241 GGD 243


>gi|253574632|ref|ZP_04851972.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251845678|gb|EES73686.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 267

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 104/251 (41%), Gaps = 15/251 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FVD       +   +G+   ++  V+R K GD +++ +G   E L++I+ +     
Sbjct: 14  MQRYFVDPAQFGDREVTIAGEDARHIGRVMRSKPGDKLIVSDGISREVLAEITIIEPQQV 73

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               +E  + S      V    S  K ++++ +IQK  E+G  +  P ++  T   +   
Sbjct: 74  TAAIIEELAASGEPWFQVTVAQSLPKGDKMETVIQKCTEIGAASFLPFLSERTIVQYDSK 133

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R +     AAEQ     +P +  P   + LL    +   +    E        
Sbjct: 134 KEEKRLTRWQKIAKEAAEQAHRSKIPAVELPVKWDKLLVELKNYDLVCLCYEKEDGRQLR 193

Query: 179 EKLHAI------AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
           + L              VA+++GPEGG+    +           + LG RILR++TAA+A
Sbjct: 194 DVLKPFVTGLTPERTVKVAVVVGPEGGFTEA-EVEEAEAAGAVSVGLGRRILRTETAAMA 252

Query: 233 AMALVQAICGD 243
           A+  +    G+
Sbjct: 253 ALTCIMYESGE 263


>gi|288933585|ref|YP_003437644.1| hypothetical protein Kvar_0702 [Klebsiella variicola At-22]
 gi|288888314|gb|ADC56632.1| protein of unknown function DUF558 [Klebsiella variicola At-22]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     L I +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK 
Sbjct: 1   MRIPRIHHPERLTIGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  NVTVEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P I P   LE      D   ++        S N
Sbjct: 121 AERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLEEWCAEQDSGMKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|81428349|ref|YP_395349.1| hypothetical protein LSA0735 [Lactobacillus sakei subsp. sakei 23K]
 gi|78609991|emb|CAI55039.1| Hypothetical protein LCA_0735 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 251

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/246 (18%), Positives = 104/246 (42%), Gaps = 13/246 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV---GK 63
           ++R F++  + +    + +G+  H++  V+RM+ GD I +   ++  +++++       K
Sbjct: 1   MQRYFIEETVTVGQSLQLTGETAHHMLKVMRMQVGDQIEIVTPEELAFITQLQSADATQK 60

Query: 64  SIRFKVEY-QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVI------TRY 116
                VE           +   +    K ++ D+++QK  ++G                 
Sbjct: 61  QATVTVESAVETDVELPIETTIVCGLSKGDKTDWIVQKGTQLGAHRFIFCNSQFSVARWD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + R++     AAEQ     +P I    +L  + +       + + +     E+
Sbjct: 121 AKKQVKKLARLQKIAQEAAEQAHRTHVPVIEWRASLTAIAEESADIKLVAYEESAKAGEH 180

Query: 177 --SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
              ++ L +     ++  + GPEGG   +E E L +  F+    LGPRILR++TA +  +
Sbjct: 181 GQLVQSLQSAQPGQSLICVFGPEGGIAPKEIEALQAAGFLLA-GLGPRILRAETAPLYLL 239

Query: 235 ALVQAI 240
           + +  +
Sbjct: 240 SAISYV 245


>gi|270158328|ref|ZP_06186985.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289163426|ref|YP_003453564.1| Ribosomal RNA small subunit methyltransferase E (16S rRNA m3U1498
           methyltransferase) [Legionella longbeachae NSW150]
 gi|269990353|gb|EEZ96607.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288856599|emb|CBJ10406.1| Ribosomal RNA small subunit methyltransferase E (16S rRNA m3U1498
           methyltransferase) [Legionella longbeachae NSW150]
          Length = 242

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 119/251 (47%), Gaps = 18/251 (7%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEW--LSKI 58
           M+      R++           + S +   ++  VLRM+EG+++ LF G + E+  + + 
Sbjct: 1   MRAV----RIYQPGNYDTGQLLELSPEASQHVGVVLRMQEGEHLTLFCGDNREFDAIIET 56

Query: 59  SYVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT- 117
               + I      +  S+     +    +  K  R+++++QK+VE+G+ +I P++T    
Sbjct: 57  VKKKQVIVVVGSIKKVSRESPLTIHLAQAISKGERMEWVMQKAVELGVASITPILTERCV 116

Query: 118 -----QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETC 172
                +     + + +   I+A EQ    ++P ++ P TL   L+      + +      
Sbjct: 117 VKLDQERMTKKLHQWQAIVIAACEQSGRNSVPQVHAPVTLSRYLEEIQAELKFILHP--- 173

Query: 173 GSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
               +         + ++ +LIGPEGG   +E +      F  PLSLGPRILR++TAA+ 
Sbjct: 174 --GQNKTWRDYTFKVADIVLLIGPEGGLSEQEVQYTSKHGF-QPLSLGPRILRTETAAIT 230

Query: 233 AMALVQAICGD 243
           A++++QA+ GD
Sbjct: 231 ALSVLQAVGGD 241


>gi|153812691|ref|ZP_01965359.1| hypothetical protein RUMOBE_03098 [Ruminococcus obeum ATCC 29174]
 gi|149831207|gb|EDM86296.1| hypothetical protein RUMOBE_03098 [Ruminococcus obeum ATCC 29174]
          Length = 247

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 117/246 (47%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKT--QGKASGDQYHYLAHVLRMKEGDNILLFNG--KDGEWLSKISYVG 62
           ++R FV+     +   Q    G   +++++VLRMK+G+ + + +G  K+     +     
Sbjct: 1   MQRFFVEPHQIDEAAHQIHIIGTDVNHISNVLRMKQGEEVWISDGGQKEYRCAIEAFSAD 60

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           + +   +  Q       S +       K ++++ +IQK+VE+G   I PV T+       
Sbjct: 61  EVLLHIIYAQEPDYELPSRIYLFQGLPKADKMELIIQKAVELGAYEIIPVETKRCVVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPP-TTLEFLLKNWDHNCQIVFADETCGSE 175
            +     ++R +    SAA+Q   + +P ++   +  E L      + +++  +   G +
Sbjct: 121 GKKAAKKVERWQQIAESAAKQSKRMLIPNVHQVLSFKEALKYAESMDIRLIPYELAKGMQ 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            + E L AI    ++ I IGPEGG+  +E E   S     P++LG RILR++TA +A ++
Sbjct: 181 ETKEILAAIEQGQSIGIFIGPEGGFEEKEVEAAISEG-AKPITLGKRILRTETAGLAILS 239

Query: 236 LVQAIC 241
           ++    
Sbjct: 240 VLMFQL 245


>gi|148825417|ref|YP_001290170.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus influenzae
           PittEE]
 gi|229846392|ref|ZP_04466500.1| hypothetical protein CGSHi7P49H1_06965 [Haemophilus influenzae
           7P49H1]
 gi|148715577|gb|ABQ97787.1| hypothetical protein CGSHiEE_01535 [Haemophilus influenzae PittEE]
 gi|229810485|gb|EEP46203.1| hypothetical protein CGSHi7P49H1_06965 [Haemophilus influenzae
           7P49H1]
          Length = 245

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCLLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESNLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + +      V +LIG EGG  ++E        F T + LG R+LR++TA++AA+ 
Sbjct: 180 KTLPTIPS----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIT 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|313905332|ref|ZP_07838698.1| protein of unknown function DUF558 [Eubacterium cellulosolvens 6]
 gi|313469802|gb|EFR65138.1| protein of unknown function DUF558 [Eubacterium cellulosolvens 6]
          Length = 246

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 57/244 (23%), Positives = 117/244 (47%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R F      I  +   +GD  +++ +VLRMK+G+ IL+  G + E+   IS + +   
Sbjct: 1   MYRFFTGREQIIDGKVHITGDDVNHIRNVLRMKKGETILISCGDEWEYTCSISELSEDEI 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                + Q   +  +S +       K+++++ +IQK+VE+G   + PV ++        +
Sbjct: 61  LADVTDAQKPGKELRSKIYLFQCLPKSDKMETVIQKAVELGAFEVVPVSSKRCIVKLDQK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKN-WDHNCQIVFADETCGSENS 177
                + R      SAA+Q   + +P ++        L+   + + +++  +   G   +
Sbjct: 121 RGKQKVARWNGIAESAAKQAKRMIIPTVHEILGFREALEMAKEMDVKLIPYEMESGMSRT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E   +I    ++A+LIGPEGG+   E E      F + ++LG RILR++TA +  ++++
Sbjct: 181 REIFSSIEPGQSIAVLIGPEGGFDEAEVELAKEAGF-SSITLGRRILRTETAGMTTLSIL 239

Query: 238 QAIC 241
             + 
Sbjct: 240 MYLL 243


>gi|296333298|ref|ZP_06875751.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675197|ref|YP_003866869.1| methylase of U1498 in 16S rRNA [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296149496|gb|EFG90392.1| 16S ribosomal RNA methyltransferase RsmE [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413441|gb|ADM38560.1| methylase of U1498 in 16S rRNA [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 256

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 58/249 (23%), Positives = 104/249 (41%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F++     +        +G+  H++ +V+RM EGD I+  +    E   ++  V K
Sbjct: 1   MQRYFIELTKQQMEEAPAFSVTGEDVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSK 60

Query: 64  SI--RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  VE+   ++     V       K ++L+++IQK  E+G  A  P     +    
Sbjct: 61  DNVSCLVVEWTDENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +      +R       AAEQ     +P +    + + LL+      + V A E    +
Sbjct: 121 DDKKAKKKRERWAKIAKEAAEQSYRNEVPQVMDVHSFQQLLQRMQDFDKCVVAYEESSKK 180

Query: 176 NSLEKLHAI----AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
             +    A+        ++ I+ GPEGG    E E L     + P  LGPRILR++TA +
Sbjct: 181 GEISAFSAVVRRLPKGSSLLIVFGPEGGLTEAEVERLTEKDSM-PCGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A++ +   
Sbjct: 240 YALSAISYQ 248


>gi|262376600|ref|ZP_06069828.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308310|gb|EEY89445.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 236

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 112/243 (46%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R ++D  L I    + +   +H+   VLR + G++  LFNG+ GE+   ++ V K   
Sbjct: 1   MPRFYIDADLTIDVSLELTETVFHHWVKVLRAQVGESATLFNGQGGEYDVTLTEVAKKSA 60

Query: 67  FKVEYQSRSQTKQSDVQ--YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                      +    Q        K +R+DY IQK+VE+G+  I+ + + + +      
Sbjct: 61  TVSVNAFNPANRTPKFQALLGQVMSKGDRMDYAIQKAVELGVSEIQLLTSDHCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  +   I+A EQC +  +P I  P +LE  L     N ++V A     ++   
Sbjct: 121 RDQKKLDHWQGIAIAACEQCGLNIVPEILAPMSLEKWLNTELPNTKLVLAPNKDETDVLA 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +         ++A+LIGPEGG    E    +   F+    +G R+LR++TA V A++++ 
Sbjct: 181 DA------TLDLALLIGPEGGLSEAEISAANQKGFLN-WCIGERVLRTETAPVVALSILN 233

Query: 239 AIC 241
            + 
Sbjct: 234 YVL 236


>gi|219871131|ref|YP_002475506.1| 16S ribosomal RNA methyltransferase RsmE [Haemophilus parasuis
           SH0165]
 gi|219691335|gb|ACL32558.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 244

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 110/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  K+    S D ++++  VLRM EG  ++LF+G +  + + I  V K 
Sbjct: 1   MRIPRIYHPEALAGKSHCILSEDAFNHVGRVLRMGEGAELVLFDGSNHIFNAIIDNVSKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QISVKIQNSQLDDRESPLPIHLGQVISRGDRMEFTIQKSVELGVTTITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P   L    +  D   ++        S  
Sbjct: 121 GERQDKKIQQWQKIAISACEQCGRNIIPEIRPIMKLTDWCQEQDGMLKLNLHPRAKYSLK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           SL  +        V +LIG EGG  SEE     +  F T + LG RILR++TA++A +  
Sbjct: 181 SLPNIPK----EGVRLLIGSEGGLSSEEIAMTEAENF-TEVLLGKRILRTETASLATITA 235

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 236 LQMLYGD 242


>gi|51473368|ref|YP_067125.1| hypothetical protein RT0159 [Rickettsia typhi str. Wilmington]
 gi|51459680|gb|AAU03643.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 240

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/241 (30%), Positives = 134/241 (55%), Gaps = 8/241 (3%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
           MK +    R++++  L   ++ +   D  HY+  VLR+K  D++ +FNG DGE+L+ I+ 
Sbjct: 1   MKYN----RIYINSHLAENSKIELVRDNVHYVKTVLRLKINDSLRIFNGSDGEFLAHITK 56

Query: 61  VGKSIR-FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
           +GK+     +  Q +    +  +    + IK+++L  +I  + ++G+  I P+IT   Q 
Sbjct: 57  IGKNNISVVLTEQLKKAYIEPALTLAVAIIKSDKLMLIINMATQLGITKIIPLITSRCQF 116

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              N++R+    I A EQ + L  P I    TL+  LK   +N  I++A+E    +NS+ 
Sbjct: 117 KTVNIERLIKCVIEATEQSERLNPPIIEHAITLKDYLK--KNNNLILYANEHEKVKNSIL 174

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           ++ ++    ++AI+IGPEGG+ ++E E L        +SLG  ILR++TAA+  +A V+ 
Sbjct: 175 RISSLLAN-DIAIIIGPEGGFTNDELELLALYKNTQSISLGSNILRTETAAITVIAQVRL 233

Query: 240 I 240
           +
Sbjct: 234 L 234


>gi|254482677|ref|ZP_05095915.1| conserved hypothetical protein TIGR00046 [marine gamma
           proteobacterium HTCC2148]
 gi|214037036|gb|EEB77705.1| conserved hypothetical protein TIGR00046 [marine gamma
           proteobacterium HTCC2148]
          Length = 243

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 111/247 (44%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  ++          +LA  LRM+E   ++LF+G+ GE+ + I+ VGK 
Sbjct: 1   MRIPRIYAGQVLQAESSFDLEPGPSQHLARALRMQEAGQLILFDGRGGEYPATITSVGKK 60

Query: 65  IRFKVEYQSRSQTKQSD--VQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
               +  Q      +S   +    S  +  R+D++IQK+ E+G+  + P++T  T+    
Sbjct: 61  CVSVLTGQRHDIEVESPLAIHLGISISRGERMDWVIQKATELGVTHVSPLLTERTEVKLK 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                      +   ISA EQC    LP I P T L   L +     ++V          
Sbjct: 121 ADRAEKKRQHWQQIAISACEQCGRNRLPVINPLTLLPKWLNDSQAELKLVLHHRAEN--- 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                       ++ +LIGPEGG   +E        F   L LG R+LR++TA +AA+++
Sbjct: 178 ---LSAQSTPPRSIDLLIGPEGGLSPDEIHLAEQRAF-HALRLGDRVLRTETAPLAALSI 233

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 234 LQARWGD 240


>gi|295097485|emb|CBK86575.1| 16S rRNA m(3)U-1498 methyltransferase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 248

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 57/249 (22%), Positives = 108/249 (43%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++    +    +   S D  +++  VLRM  G  I LF+G +  + ++I+   
Sbjct: 4   LTMRIPRIYHPELITPGGEIALSDDAANHVGRVLRMGAGQAIQLFDGSNQVFDAEITRAD 63

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +  +   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 64  KKSVHVKVLRGEVDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 123

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   I+A EQ     +P I P   LE      +   ++        S
Sbjct: 124 LDAERLNKKIQQWQKIAIAACEQSGRNRIPEIRPAMDLEDWCAEEESGLKLNLHPRASAS 183

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 184 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 237

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 238 TALQVRFGD 246


>gi|87121181|ref|ZP_01077072.1| hypothetical protein MED121_11304 [Marinomonas sp. MED121]
 gi|86163673|gb|EAQ64947.1| hypothetical protein MED121_11304 [Marinomonas sp. MED121]
          Length = 244

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 111/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++VD PL   +        + ++  VLR+K   +++LFNG+ G++ +K+  V K 
Sbjct: 1   MRIPRIYVDLPLQESSVFDLPQASFQHVCKVLRLKNDYSLILFNGQGGQYQAKLINVEKR 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 + YQ+        V    +  +  R+DY IQK+VE G+  I+P+ +   +    
Sbjct: 61  SAQVEVLNYQALENESPIKVTLGQTLSRGERMDYAIQKAVEAGVHRIQPLFSERCEVKLN 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   ISAAEQ     +P +  P  L     N     +I     +    +
Sbjct: 121 TERLDKKIQHWQQIAISAAEQSGRGHVPEVLSPINLLDWTSNCKDMLKITMHHHSAKPIS 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
            + +    A    V++LIGPEGG    E E      F  P++LG R+LR++TA V  +  
Sbjct: 181 EMSEPEDKA----VSVLIGPEGGLTESEVEASIQHGF-QPVALGSRVLRTETAPVVILTC 235

Query: 237 VQAICGD 243
           +  + GD
Sbjct: 236 INLLWGD 242


>gi|269137637|ref|YP_003294337.1| hypothetical protein ETAE_0279 [Edwardsiella tarda EIB202]
 gi|267983297|gb|ACY83126.1| conserved hypothetical protein [Edwardsiella tarda EIB202]
 gi|304557702|gb|ADM40366.1| Ribosomal RNA small subunit methyltransferase E [Edwardsiella tarda
           FL6-60]
          Length = 243

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  +     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDGSNRVFDAEIISADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    +   ++S +         +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 61  SVRVRLNHVQEADRESPLHLHLGQVMSRGEKMEFTIQKSIELGVSVITPLISERCGVRLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +       + +   I+A EQC    +P I P   LE      D   ++        S N
Sbjct: 121 AERMAKKQQQWQKIAIAACEQCGRNRIPQIRPAMDLEAWCAEEDDCLRLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  + E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPLTRVRLLIGPEGGLSAAEIAMTADYRF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|319775828|ref|YP_004138316.1| RNA methyltransferase [Haemophilus influenzae F3047]
 gi|319896636|ref|YP_004134829.1| RNA methyltransferase [Haemophilus influenzae F3031]
 gi|329123672|ref|ZP_08252232.1| 16S rRNA methyltransferase RsmE [Haemophilus aegyptius ATCC 11116]
 gi|317432138|emb|CBY80489.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae F3031]
 gi|317450419|emb|CBY86635.1| conserved hypothetical RNA methyltransferase [Haemophilus
           influenzae F3047]
 gi|327469871|gb|EGF15336.1| 16S rRNA methyltransferase RsmE [Haemophilus aegyptius ATCC 11116]
          Length = 245

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDATNHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++
Sbjct: 180 KTLPTIPA----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIS 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|331085961|ref|ZP_08335044.1| hypothetical protein HMPREF0987_01347 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406884|gb|EGG86389.1| hypothetical protein HMPREF0987_01347 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 246

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 112/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  FV          + +G   +++ +VLRM+ G+ + + +G + ++L +I  +     
Sbjct: 1   MQHFFVVPDQVRDGYIEITGSDVNHMKNVLRMRTGEQLEISDGNNKKYLCEIESLEADKV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               +E +       S +       K+++++ +IQK+VE+G+  + PV T+        +
Sbjct: 61  TARILEEREAENELPSKLYLFQGLPKSDKMELIIQKAVELGVWEVIPVATKRAVVKLDQK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSENS 177
                 +R    + SAA+Q     +P I      +  L      +  ++  +   G + +
Sbjct: 121 KAAKKRERWSGISESAAKQAGRNVIPEIKQVMNFQEALSYAKSLDVLLIPYELAEGMQAT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            E++ AI    +V I IGPEGG+  EE +         P++LG RILR++TA +  ++++
Sbjct: 181 KERIQAIQPGQSVGIFIGPEGGFEQEEVKLAMEAG-AYPITLGRRILRTETAGMTMLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|58579175|ref|YP_197387.1| hypothetical protein ERWE_CDS_05110 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417801|emb|CAI27005.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 239

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 77/231 (33%), Positives = 124/231 (53%), Gaps = 6/231 (2%)

Query: 9   RLFVDFPLCIK-TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
           RL+V        +  K      HY++ V+R  + D + +FNGKDGEW+ +I  +   I+ 
Sbjct: 9   RLYVPEIQLPNPSIIKLDTLASHYISKVMRATKCDYVKIFNGKDGEWIGEICELSNHIKI 68

Query: 68  KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRV 127
           +++  +R Q K  ++   F  +K   L  +I+++ EMG+  ++P+ T++   ++ N+D+ 
Sbjct: 69  RIDKLTRKQVKSKNLTLCFGIVKGTILPNIIRQATEMGVTLLQPIYTKHIATSNINLDKC 128

Query: 128 RTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHI 187
           R + I A+EQC+ L +P I  P +   L K    N   +  DET   +   E L      
Sbjct: 129 RKWAIEASEQCERLDIPQISHPISFTDLKKLDTANINFIICDETGNGKKPAEILTNKN-- 186

Query: 188 PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            N+ I++GPEGG+ SEE +      F   LSLG RILR DTA V+A+A V 
Sbjct: 187 -NIYIIVGPEGGFSSEELDFA--YTFCNGLSLGTRILRVDTAVVSALAYVN 234


>gi|294634386|ref|ZP_06712923.1| 16S rRNA methyltransferase RsmE [Edwardsiella tarda ATCC 23685]
 gi|291092194|gb|EFE24755.1| 16S rRNA methyltransferase RsmE [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 108/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++   PL I  +   S D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPQPLSIPGEVNLSDDAANHVGRVLRMGPGHALQLFDGSNRVFDAEIVSADKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFS--PIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                      + ++S +         +  ++++ IQKS+E+G+  I P+I+        
Sbjct: 61  SVRVRLTAVHEENRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNVITPLISERCGVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                    + +   I+A EQC   +L  I P  TLE      D   ++        S N
Sbjct: 121 AERLAKKQQQWQKIAIAACEQCGRNSLALIRPAMTLEAWCAEPDDGLRLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  + E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TL-----PQPLSRVRLLIGPEGGLSASEIAMTADYHF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|210610069|ref|ZP_03288248.1| hypothetical protein CLONEX_00434 [Clostridium nexile DSM 1787]
 gi|210152680|gb|EEA83686.1| hypothetical protein CLONEX_00434 [Clostridium nexile DSM 1787]
          Length = 245

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + FV      +      G   +++ +VLRMK G+ + + +G + ++L +I  +     
Sbjct: 1   MHQFFVTPMQVKEDHIYIEGLDVNHIKNVLRMKVGEALKVSDGNNRKYLCEIESMTAQQV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               VE Q       S +       K+++++ ++QK+VE+G   I PV T+        +
Sbjct: 61  CVRIVEEQQVDTELPSKIYLFQGLPKSDKMELIVQKAVELGAYEIIPVATKRAVVKLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSENS 177
                ++R R    S A+Q     +P +    + +  L      +  ++  +   G + +
Sbjct: 121 KALKKVERWRGIAESGAKQSGRNVIPKVTNVMSYKDALTYARGLDILLIPYELAEGMKET 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            + +  I    +V I IGPEGG+ ++E E   +      ++LG RILR++TA +  ++++
Sbjct: 181 KQVIEEIKRGQSVGIFIGPEGGFETQEVEDAIANG-ARAITLGKRILRTETAGLTTLSIL 239

Query: 238 QAIC 241
               
Sbjct: 240 MYHL 243


>gi|146312989|ref|YP_001178063.1| 16S ribosomal RNA methyltransferase RsmE [Enterobacter sp. 638]
 gi|145319865|gb|ABP62012.1| 16S rRNA m(3)U-1498 methyltransferase [Enterobacter sp. 638]
          Length = 243

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 110/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +   ++   S D  +++  VLRM  G  + LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPELITAGSEIALSDDAANHVGRVLRMGAGQAVQLFDGSNQVFDAEITRADKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVQVSILRGEVDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQC    +P I PP  LE      +   ++        S N
Sbjct: 121 AERLNKKIQQWQKIAIAACEQCGRNRIPEIRPPMDLEAWCAEEESGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|160895341|ref|ZP_02076112.1| hypothetical protein CLOL250_02900 [Clostridium sp. L2-50]
 gi|156863034|gb|EDO56465.1| hypothetical protein CLOL250_02900 [Clostridium sp. L2-50]
          Length = 248

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 118/245 (48%), Gaps = 11/245 (4%)

Query: 7   LKRLFVDFPLCI-KTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           + R FVDF   +       +G+  +++ +VLR+K  D I++ +G+  ++  +IS +    
Sbjct: 1   MNRFFVDFDGRVFDKSIDITGEDVNHIKNVLRLKVNDEIIISDGRGRDYRCQISVMDHEK 60

Query: 66  RFKVEYQSRSQTKQ--SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------ 117
                        +  +++       K ++++++IQK+VE+G+  I PV+T+ T      
Sbjct: 61  VVADILDVCDNFAELETEITLFQGFPKADKMEWIIQKTVELGVTRIVPVMTKRTVVKLDA 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIY-PPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           +      +R +   ++AA+Q     +P +  P T  E L    + +  ++  +E  G   
Sbjct: 121 KKAGKKTERYQAIALAAAKQSGRGVIPEVTAPVTWKEALAMAKELDMNMIPYEEAEGVAY 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S E   +I    ++ I IGPEGG+  EE      +     ++LG RILR++TA +A M++
Sbjct: 181 SKEVFASIKGKKSLGIFIGPEGGFAGEEVVAATDMG-AKMVTLGHRILRTETAGMAVMSI 239

Query: 237 VQAIC 241
           +    
Sbjct: 240 IMFEL 244


>gi|71898620|ref|ZP_00680790.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|71731567|gb|EAO33628.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
          Length = 244

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 115/247 (46%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++     +
Sbjct: 1   MRLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRR 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
               ++E  S    +    +  + +  +  ++D ++QK+ E+G+ AI PV T        
Sbjct: 61  EAWARIEGVSEVCNESPLAITLVQAITRGEKMDLIVQKATELGVVAIVPVDTERSGVRLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++     +       ISA EQC    +P +  P  L+ L +  D +   +  D       
Sbjct: 121 SERVAKRLAHWNNVVISACEQCGRTRVPEVQMPCALQVLPEILDPDTLRLILDPKSEHRL 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S     +      V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+A+
Sbjct: 181 ST---LSRLTPVEVTIAIGPEGGWSPRDLEILKDAGFI-GFSLGPRILRTETAGLTAIAV 236

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 237 LQAQLGD 243


>gi|332187403|ref|ZP_08389141.1| RNA methyltransferase, RsmE family protein [Sphingomonas sp. S17]
 gi|332012564|gb|EGI54631.1| RNA methyltransferase, RsmE family protein [Sphingomonas sp. S17]
          Length = 247

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/238 (39%), Positives = 130/238 (54%), Gaps = 5/238 (2%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-R 66
            RLFVD  L      +  G   HYL  V+R K GD + LF+ + GEWL   + VGK    
Sbjct: 13  PRLFVDQILAEG-PIRIDGPAAHYLVSVMRTKVGDPVKLFDDRTGEWLGVAASVGKRDLT 71

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDR 126
             V  + R +    D+    +P+K  R+D++ +K+ E+G+  + PV+TR T     N +R
Sbjct: 72  LDVTQRLREREAVPDLWLCAAPLKKGRVDWLAEKACELGVARLVPVVTRRTVVDKPNTER 131

Query: 127 VRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAH 186
           +R + I AAEQC    LP +  P  L  LL++W     + FADE  G           AH
Sbjct: 132 LRAHMIEAAEQCGRTALPQVAEPVKLPALLRDWPEERALFFADENGGLPALE---AMRAH 188

Query: 187 IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
               AILIGPEGG+ SEE+E + +LP    + LGPRILR+DTAA AA++L  A  GDW
Sbjct: 189 QGPAAILIGPEGGFDSEEREAIRALPSAIGIGLGPRILRADTAAAAAVSLWMAAAGDW 246


>gi|222106772|ref|YP_002547563.1| hypothetical protein Avi_5780 [Agrobacterium vitis S4]
 gi|221737951|gb|ACM38847.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 245

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/226 (42%), Positives = 146/226 (64%), Gaps = 2/226 (0%)

Query: 1   MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKIS 59
           M+ +  ++RL+VD  L        + +QY+YLA+VLR+ EG  +L+FNG+DGEW  S   
Sbjct: 1   MRANYKMQRLYVDAGLEAANPVATTPEQYNYLANVLRLTEGAEVLVFNGRDGEWKASLAF 60

Query: 60  YVGKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119
              K I    + Q+R Q + SD+ ++F+P+K  R+DY++QK+VEMG GA++PV+T++ Q 
Sbjct: 61  PTRKRIALIPQSQTRPQPRPSDLTFLFAPLKVGRMDYLVQKAVEMGAGALQPVMTQHVQG 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
              +++R++   I AAEQC IL++P + P   L+ LL+ W    +I+F DE   ++N + 
Sbjct: 121 RIGSIERLQANVIEAAEQCGILSVPKVAPLVKLKDLLETWPATHRIIFCDEDSATDNPMP 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            L AI     +A+L+GPEGG+  EE+  L SL FVT + LGPRILR
Sbjct: 181 ALAAIEERQ-LALLVGPEGGFSDEERSLLRSLGFVTAIPLGPRILR 225


>gi|190571358|ref|YP_001975716.1| hypothetical protein WPa_0963 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018754|ref|ZP_03334562.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357630|emb|CAQ55071.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995705|gb|EEB56345.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 231

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 125/243 (51%), Gaps = 14/243 (5%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-G 62
              + RL+V+  L           Q HY+ +V+R+K+ DNI LFNGKDGEWL ++  +  
Sbjct: 1   MKKI-RLYVEEALSQNVSLALHPRQSHYIYNVMRLKKHDNIYLFNGKDGEWLGEVVNISS 59

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           KS +  ++ +++ Q  + ++    + +K+  L  +++++ EMG+  I+ + T  T   + 
Sbjct: 60  KSTKIIIKERTKQQQHEKNLYLYCALVKSGALSNIVRQATEMGVTCIQFISTERTVVKNI 119

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLH 182
           N+ R +   I AAEQ    ++P I     + F   +   N   V  DET   +   + L 
Sbjct: 120 NLSRAKLQAIEAAEQSGRTSIPQI--FLPINFCELSDSQNKNFVLCDETGEGQPPNKVLK 177

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
                 NVAI++GPEGG+ S E ++     F   LSLG RILR DTA VAA+        
Sbjct: 178 GKK---NVAIIVGPEGGFSSCELDSA--NKFCQKLSLGKRILRVDTAVVAALT-----FT 227

Query: 243 DWY 245
           +WY
Sbjct: 228 NWY 230


>gi|149911573|ref|ZP_01900186.1| hypothetical protein PE36_05278 [Moritella sp. PE36]
 gi|149805352|gb|EDM65364.1| hypothetical protein PE36_05278 [Moritella sp. PE36]
          Length = 243

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 111/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R+F    L + +  + S D   ++  VLRM  GD + LFNGK G++ + I    K 
Sbjct: 1   MRHPRIFESGELIVGSSFELSPDGAGHVGRVLRMTTGDTLTLFNGKGGQYQATIEQTTKK 60

Query: 65  IRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E+Q  +      +    +  + +++D+ IQKSVE+G+ AI P+ +        
Sbjct: 61  SVTVHIDEFQDINSESPLKIHLGQAISRGDKMDFTIQKSVELGVTAITPLFSERCGVKLS 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ     +P + PP  L+          ++        S N
Sbjct: 121 GERLEKKIQQWQKIVIAACEQSGRNFVPQVLPPKQLKDWAAEETTELKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +         V +LIGPEGG  ++E        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PKHGVRLLIGPEGGLSADEINMTEQFNFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQCRFGD 241


>gi|327412916|emb|CAX67930.1| conserved hypothetical protein [Salmonella bongori]
          Length = 243

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQVLQLFDGSNQVFAAEIISASKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +  +  +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVQVMKGETDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I P   LE      +   ++        S N
Sbjct: 121 SERLNKKRQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQEPGLKLNLHPRAHASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSAEEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|159139721|gb|AAK86465.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 239

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/220 (43%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSK-ISYVGKSI 65
           ++RLF++  L      +A+G+Q++YLA+VLRM +G  ILLFNG+DGEW +K      K I
Sbjct: 1   MQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRDGEWKAKLSFPSRKKI 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
                 Q+R Q   +++ Y+F+P+K  R+DY++QK+VEMG G ++PV+T++ Q   +N +
Sbjct: 61  SLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQGKIHNSE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           ++R   I AAEQC IL+LP +  P  L+ +L+ W  + +I++ DE    +N L  L A+ 
Sbjct: 121 KLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYCDEGDAGQNPLPILQAVK 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
               +A+L+GPEGG+  EE+  L SL FVTP+ LGPRILR
Sbjct: 181 E-RKIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILR 219


>gi|167855789|ref|ZP_02478542.1| hypothetical protein HPS_03114 [Haemophilus parasuis 29755]
 gi|167853068|gb|EDS24329.1| hypothetical protein HPS_03114 [Haemophilus parasuis 29755]
          Length = 244

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 110/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  K+    S D ++++  VLRM EG  ++LF+G +  + + I  V K 
Sbjct: 1   MRIPRIYHPEALAGKSHCILSEDAFNHVGRVLRMGEGAELVLFDGSNHIFNAIIDNVSKK 60

Query: 65  IRFKVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                    Q   +     +       + +R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  QISVKIQNSQLDDRESPLPIHLGQVISRGDRMEFTIQKSVELGVTTITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   ISA EQC    +P I P   L    K  D   ++        S  
Sbjct: 121 GERQDKKIQQWQKIAISACEQCGRNIIPEIRPIMKLTDWCKEQDGMLKLNLHPRAKYSLK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           SL  +        V +LIG EGG   EE     +  F T + LG RILR++TA++A + +
Sbjct: 181 SLLNVPQ----EGVRLLIGSEGGLSPEEIAMTEAENF-TEVLLGKRILRTETASLATITV 235

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 236 LQMLYGD 242


>gi|187930070|ref|YP_001900557.1| hypothetical protein Rpic_3002 [Ralstonia pickettii 12J]
 gi|187726960|gb|ACD28125.1| protein of unknown function DUF558 [Ralstonia pickettii 12J]
          Length = 249

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 109/249 (43%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD+I LF+G   E+ +++  + K   
Sbjct: 3   LPRFFVDTPLAPNTTVTLDESVTRHI-HVLRLAAGDDICLFDGSGYEFRARLDAINKRDA 61

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
               V+        +  +         +++D++I+K+VE+G+ A+ P+ T         +
Sbjct: 62  TASLVDATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVNAVAPLQTERGVVRLSGE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE---TCGSE 175
                +   +    +A EQC    +P + P  TL   L                      
Sbjct: 122 RAVKRVQHWQALVQAACEQCGRARVPVVAPVATLREWLATAKSTDAPRVLLSPRGAQSLT 181

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
               +         + +LIGPEGG   +E+    +  F+ PL+LG RILR+++AA+ A++
Sbjct: 182 QWAVQSRTRIVGSGIVLLIGPEGGLSPDEEALAEAAGFL-PLTLGRRILRTESAALVAVS 240

Query: 236 LVQAICGDW 244
            + A+ G++
Sbjct: 241 ALHAVLGEF 249


>gi|84394071|ref|ZP_00992807.1| hypothetical protein V12B01_07800 [Vibrio splendidus 12B01]
 gi|84375313|gb|EAP92224.1| hypothetical protein V12B01_07800 [Vibrio splendidus 12B01]
          Length = 243

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R+     +          D   ++  VLRMKEG ++LLF+G   E+ + I+ V K 
Sbjct: 1   MRIPRIHHPERIHQLGSLALGEDAAGHVGRVLRMKEGQDVLLFDGSGAEFPATIAEVSKK 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  E   RS     D+       + +++++ IQKSVE+G   I P+I+        
Sbjct: 61  NVTVNVTERIERSSESPLDLHLGQVISRGDKMEFTIQKSVELGANTITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQ    T+P I P   LE          ++        S N
Sbjct: 121 TKRFEKKLAQWQKIAIAACEQSGRNTVPVIRPIMQLEEWCSEPSEALKLNLHPRAKYSIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L +      +  V +LIGPEGG  +EE        F   L LGPR+LR++TAA+ A+  
Sbjct: 181 TLPE-----PVSKVRLLIGPEGGLSAEEIGMTEQYKFEETL-LGPRVLRTETAALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|238896476|ref|YP_002921214.1| hypothetical protein KP1_4654 [Klebsiella pneumoniae NTUH-K2044]
 gi|238548796|dbj|BAH65147.1| hypothetical protein KP1_4654 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 268

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/248 (24%), Positives = 108/248 (43%), Gaps = 14/248 (5%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
              + R+     L + +Q   S D  +++  VLRM  G ++ LF+G +  + + I+  GK
Sbjct: 25  SMRIPRIHHPERLIVGSQIALSDDAANHVGRVLRMTAGQHLQLFDGSNQVFDAVITEAGK 84

Query: 64  SIRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                  +  +   +     +       +  ++++ IQKS+E+G+  I P+ +       
Sbjct: 85  KNVTVEVLSGEPDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKL 144

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQ     +P I P   LE      D   ++        S 
Sbjct: 145 DAERLQKKIQQWQKIAIAACEQSGRNVVPEIRPAMQLEAWCAEQDSGLKLNLHPRASASI 204

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  V +LIGPEGG  +EE        F T + LGPR+LR++T A+ A+ 
Sbjct: 205 NTLPL-----PVERVRLLIGPEGGLSAEEIAMTAQYQF-TDILLGPRVLRTETTALTAIT 258

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 259 ALQVRFGD 266


>gi|162139548|ref|YP_218021.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
          Length = 243

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++ F      S N
Sbjct: 121 NERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNFHPRAHASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|307611825|emb|CBX01538.1| hypothetical protein LPW_32251 [Legionella pneumophila 130b]
          Length = 242

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM+ G+ + LFNG + E+ + I  V K   F 
Sbjct: 5   RIYQPGEYQPGQLLELSPEAGQHVGVVLRMEPGEQLTLFNGDNKEFTASIEMVKKKQVFV 64

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 65  RIASVLEVNRESPLKIHLAQAISKGERMEMVMQKSAELGVACITPIITERCQVKIDKEKM 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 125 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
            H     P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 185 QH-----PDVALIIGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAA 238

Query: 241 CGD 243
            GD
Sbjct: 239 GGD 241


>gi|254496687|ref|ZP_05109550.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354115|gb|EET12787.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 242

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 116/243 (47%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++             S +   ++A VLRM+ G+ + LF G + E+ + I  V K     
Sbjct: 5   RIYQPGSYQSNELLALSPEASQHVAVVLRMQIGEQLTLFCGDNREFTATIEAVKKKQVMV 64

Query: 69  VEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
                 + ++     +    +  K  R++ ++QK+VE+G+  I P+I+         +  
Sbjct: 65  TVNAVTAINKESPLAIHLAQAISKGERMELVMQKAVELGVTRITPIISERCVVKLDQERM 124

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              + + +   I+A EQ    T+P I+PP TL   L+      +++       +      
Sbjct: 125 GKKLHQWQAIVIAACEQSGRNTVPVIHPPLTLARYLQEESAQLKLILHPGGNKNWRDYTF 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
             +     N+A+LIGPEGG    E  +  +  F  PLSLGPRILR++TAA+ A++++QA+
Sbjct: 185 TQS-----NIALLIGPEGGLSDAEVHSASAQGF-QPLSLGPRILRTETAAITALSVLQAV 238

Query: 241 CGD 243
            GD
Sbjct: 239 AGD 241


>gi|169349834|ref|ZP_02866772.1| hypothetical protein CLOSPI_00572 [Clostridium spiroforme DSM 1552]
 gi|169293402|gb|EDS75535.1| hypothetical protein CLOSPI_00572 [Clostridium spiroforme DSM 1552]
          Length = 246

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 108/241 (44%), Gaps = 9/241 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+D  L  K     +G+  H+L +V+R K G+ I+  +     +L  +  + + + 
Sbjct: 1   MQRYFIDEDLKDKDCLILTGNDLHHLKNVMRSKNGEKIICIDINGMVYLCVLDDLDQGLI 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
             VE    +     +V  +++  K ++ + ++QK+ E+G+  I P+ITR           
Sbjct: 61  KIVEELDENNELDVEVTLVYALPKGDKFELVLQKTTELGVSRIVPLITRRCVVKSDKAKF 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              + R       A +Q     +P I     L+ L +       + + ++     +   K
Sbjct: 121 SKKLTRYEKILKEATQQSRRNKVPEIVNVIKLDELKEYLGDYNLVAYEEKAKNDTDFALK 180

Query: 181 --LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
             L  +     + I++G EGG+  EE   + S+  +   SLG RILRS+TA +  ++++ 
Sbjct: 181 ECLKQLNPGDKITIIVGSEGGFDYEEISMMESMN-INACSLGKRILRSETAPLYLLSVIG 239

Query: 239 A 239
            
Sbjct: 240 F 240


>gi|163816746|ref|ZP_02208109.1| hypothetical protein COPEUT_02936 [Coprococcus eutactus ATCC 27759]
 gi|158448003|gb|EDP24998.1| hypothetical protein COPEUT_02936 [Coprococcus eutactus ATCC 27759]
          Length = 245

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 11/244 (4%)

Query: 7   LKRLFVDFP-LCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           + R FVD     I T  + +G   +++ +VLR+K G+ IL+ +G+  ++  +IS +    
Sbjct: 1   MNRFFVDIDGRDIGTDIEITGGDVNHIKNVLRLKIGEEILVSDGRGRDYTCRISRIDPDK 60

Query: 66  RFKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
                             V       K++++D ++QK VE+G+  I PV T         
Sbjct: 61  VVCNIEDISDNFAELPVKVTLFQGYPKSDKMDLIVQKMVELGVCRIVPVFTSRTIVKLDQ 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDH-NCQIVFADETCGSEN 176
           +      +R RT   SAA+Q     +P I  P +    L      +  I+  +E  G E 
Sbjct: 121 KKATKKTERYRTIAESAAKQSGRGIVPEITEPVSFAKALDMASELDMNIIPYEEAEGIEE 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S + +  +    ++ I IGPEGG+  EE E   +      ++LG RILR++TA +A MA+
Sbjct: 181 SRQIIANVRGKRSLGIFIGPEGGFAREEVEEAVAAG-AECITLGHRILRTETAGLAVMAI 239

Query: 237 VQAI 240
           +   
Sbjct: 240 IMFQ 243


>gi|40889966|pdb|1VHY|A Chain A, Crystal Structure Of Haemophilus Influenzae Protein
           Hi0303, Pfam Duf558
 gi|40889967|pdb|1VHY|B Chain B, Crystal Structure Of Haemophilus Influenzae Protein
           Hi0303, Pfam Duf558
          Length = 257

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 111/247 (44%), Gaps = 15/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLR  EG+ + LF+G +  + +KI       
Sbjct: 4   RIPRIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIE-SNKK 62

Query: 66  RFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
             KVE    +   +     +       +  R ++ IQKSVE+G+  I P+ +        
Sbjct: 63  SVKVEILGRELADKESHLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLD 122

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 123 AERXDKKIQQWQKIAIAACEQCGRNIVPEIRPLXKLQDWCAENDGALKLNLHPRAHYSIK 182

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++ 
Sbjct: 183 TLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAISA 237

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 238 LQICFGD 244


>gi|313618886|gb|EFR90752.1| ribosomal RNA small subunit methyltransferase E [Listeria innocua
           FSL S4-378]
          Length = 255

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 103/248 (41%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV++ L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVNYELENDNDTLSITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVIPEVHYAASFKELMFDHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALASLFQTMKPGQSVLCIFGPEGGISEKELLLLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|15894567|ref|NP_347916.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium
           acetobutylicum ATCC 824]
 gi|15024214|gb|AAK79256.1|AE007641_2 Uncharacterized conserved protein, ortholog of YQEU B.subtilis
           [Clostridium acetobutylicum ATCC 824]
 gi|4104515|gb|AAD02055.1| unknown [Clostridium acetobutylicum DSM 1731]
 gi|325508699|gb|ADZ20335.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 250

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 103/246 (41%), Gaps = 10/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + FV             GD   ++  VLR+K G+ + + +    E+L +I  + K   
Sbjct: 1   MHKFFVGAENICDNTAYIYGDDVKHIYKVLRLKVGEKVSINDCNSHEFLGEIEQINKENV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN- 123
               +E    +     +V       K  ++D ++QK+ E+G+  I P+IT+     +   
Sbjct: 61  KVKIIENLDINNESPLNVYLYQGFPKAAKMDIIVQKNTELGIREIIPLITQRVVVKNEKS 120

Query: 124 ----MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               +DR       AA+Q     +P +    +    ++       ++   E        +
Sbjct: 121 ELKKVDRWNRIAFEAAKQSKRSVIPKVKDIASFNSAIEELKEMDLVLVPYENQEKVGMKK 180

Query: 180 KLHAIAHIP--NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              AI      NVAI+IGPEGG+   E E L  +     ++LGPRILR++TA +   +LV
Sbjct: 181 VAAAIEKNKIKNVAIVIGPEGGFEETEIEELKKIG-AYIITLGPRILRTETAGLVCTSLV 239

Query: 238 QAICGD 243
                D
Sbjct: 240 MYELSD 245


>gi|255693403|ref|ZP_05417078.1| RNA methyltransferase, RsmE family [Bacteroides finegoldii DSM
           17565]
 gi|260620787|gb|EEX43658.1| RNA methyltransferase, RsmE family [Bacteroides finegoldii DSM
           17565]
          Length = 232

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 89/235 (37%), Gaps = 10/235 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   +           +   ++  +   VLR+  GD I L +GK   + ++I+       
Sbjct: 1   MHVFYTPDIQKSN---ELPDEEAQHCIRVLRLNIGDEITLTDGKGNFYKAEITAATNKRC 57

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIK---TNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
                ++  Q                  +R ++  +K+ E+G   +  +  R+++     
Sbjct: 58  LVAIKETVFQEPLWPCHLHIGMAPTKNMDRNEWFAEKATEIGFDELTFLNCRFSERKVIK 117

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
            +R+    ISA +Q     LP +   T  +  +       + +              L  
Sbjct: 118 TERIEKILISAIKQSLKARLPKLNEMTDFDKFITREFKGQKFIAHCYEGDKPLLKNIL-- 175

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
                +  +LIGPEG +  EE +      FV P+SLG   LR++TAA+AA  ++ 
Sbjct: 176 -KPGEDALVLIGPEGDFSEEEVKKAIEQGFV-PISLGKSRLRTETAALAACHILN 228


>gi|23464129|gb|AAN33944.1| conserved hypothetical protein TIGR00046 [Brucella suis 1330]
          Length = 242

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 112/239 (46%), Positives = 153/239 (64%), Gaps = 2/239 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++R +V+  L       A     HYL HVLRMKEGD +L+FNG+DGEW  S      K +
Sbjct: 1   MQRPYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEVLVFNGRDGEWKASLQPEGRKRL 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
             +   Q+R Q K S++ Y F+P+K  +LDYM+QK+VEMG G ++PVIT++TQ      +
Sbjct: 61  LLEPLEQTRPQPKPSELIYCFAPLKQGQLDYMMQKAVEMGAGVLQPVITQHTQVPRLGTE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   I AAEQC +L+LP        +  L  WD + +++F DE   S++ L  L  + 
Sbjct: 121 RIRANAIEAAEQCGVLSLPDCREALRFDRFLDQWDTSRRLIFCDEGHESDDPLSILTGLE 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244
             P+  +LIGPEGG+  EE++ LH LPFVT + LGPRILR+DTAAVAAMALVQA+ GDW
Sbjct: 181 PGPS-GLLIGPEGGFSEEERQLLHRLPFVTAIPLGPRILRADTAAVAAMALVQAVLGDW 238


>gi|68171492|ref|ZP_00544876.1| Conserved hypothetical protein 46 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658073|ref|YP_507353.1| hypothetical protein ECH_0540 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999098|gb|EAM85765.1| Conserved hypothetical protein 46 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599530|gb|ABD44999.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 241

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 78/234 (33%), Positives = 119/234 (50%), Gaps = 5/234 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+VD  L   +         HY+ HV+R  + D + LFNG+DGEW+ +I  +  + + +
Sbjct: 11  RLYVDCTLSKSSIVILDNIASHYICHVMRAAKLDEVKLFNGRDGEWIGEIFELSSNTKIR 70

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V    R Q     +    S +K   L  +I+++ EMG+  I+P+ T++   ++ N+ + +
Sbjct: 71  VNELIRRQYVPKSLTLCLSIVKNTALQNVIRQATEMGVTFIQPIYTQHIATSNINLSKCK 130

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
            + I AAEQC  L +P I  P     L +    +   V  DET       E L       
Sbjct: 131 KWAIEAAEQCGRLDIPDISFPIDFIDLKQLKTDDNNFVICDETGKGHPPSEVLKGKN--- 187

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242
           NV I+IGPEGG+ ++E    +S  F   LSLG  ILR DTA V+A+A V+   G
Sbjct: 188 NVHIIIGPEGGFSNDELSFAYS--FCDGLSLGTTILRVDTAVVSALAYVKEYYG 239


>gi|15603733|ref|NP_246807.1| hypothetical protein PM1868 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722296|gb|AAK03952.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 244

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 112/247 (45%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L      + S D  +++  VLRM+ GD ++LF+G +  + ++I+ + K 
Sbjct: 1   MRIPRIYHPVLLQGVKHCELSEDAANHVGRVLRMQAGDKLVLFDGSNHVYDAQITQISKK 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +++Q   +     +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  HVEVDILQHQWDDRESPLKIHLGQVISRGERMEFTIQKSVELGVHVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   ++A EQC    +P I P   L+      D   ++        S  
Sbjct: 121 ADRLEKKIQQWQKIAVAACEQCGRNVVPEIRPMMKLQDWCAEKDGALKLNLHPRAQYSIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG  ++E        F+  + LG R+LR++TA++AA+  
Sbjct: 181 TLPDIPA----AGVRLLIGSEGGLSAQEIAQTEQQDFIE-VLLGKRVLRTETASLAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQICFGD 242


>gi|332293484|ref|YP_004432093.1| protein of unknown function DUF558 [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332171570|gb|AEE20825.1| protein of unknown function DUF558 [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 234

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 54/236 (22%), Positives = 98/236 (41%), Gaps = 6/236 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           ++  + +             D+  ++  VLR K GD I L NG    +            
Sbjct: 1   MQLFYSETLTIDSDTYTLPKDESKHVIRVLRKKTGDAIHLTNGHGYLFNAIVAEENPNKC 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIK-TNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
           R ++E  S  + +   +    +P K  +R ++ ++K+ E+G+  I P++  +++      
Sbjct: 61  RLQIESYSYQEPRNYKLHLAVAPTKLNDRFEWFLEKATEIGITEITPLLCDHSERKVIKE 120

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           +R      SA +Q     LP +   T+    + + +H    +   E    E+  + L   
Sbjct: 121 ERFMKIIQSAMKQSLHYHLPKMNALTSFSDFVGHQNHEDTFIAHCEDLKKESLKDYLKPN 180

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
               +  ILIGPEG +   E E       + P+SLG   LR++TAA+ A   V  I
Sbjct: 181 K---SYTILIGPEGDFSPAEIELALKQG-IIPVSLGKSRLRTETAAIVACHSVAFI 232


>gi|73667112|ref|YP_303128.1| hypothetical protein Ecaj_0493 [Ehrlichia canis str. Jake]
 gi|72394253|gb|AAZ68530.1| Conserved hypothetical protein 46 [Ehrlichia canis str. Jake]
          Length = 239

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 79/230 (34%), Positives = 123/230 (53%), Gaps = 5/230 (2%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           RL+V   L   +         HY+ +V+R    D I LFNGKDGEW+ +I  V  + +  
Sbjct: 9   RLYVTCALNKSSIITLDKLASHYICNVMRAANLDEIKLFNGKDGEWIGEIFEVSHNTKII 68

Query: 69  VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVR 128
           V  Q R Q     +   F+ +K   L  ++++S EMG+  ++P+ T++   ++ N+D+ +
Sbjct: 69  VNEQIRKQVATKCLVLCFAIVKNTALQNVVRQSTEMGVTLMQPLYTKHIATSNINLDKCK 128

Query: 129 TYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP 188
            + I AAEQC+ L +P I  P +   L K    +   V  DET   ++  E L    +  
Sbjct: 129 KWAIEAAEQCERLDIPDILSPISFVDLGKLKSSDNNFVICDETGKGKHPSEVL---KNKD 185

Query: 189 NVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           N+ I+IGPEGG+ ++E    +S  F   LSLG RIL+ DTA V+A+A V 
Sbjct: 186 NIHIIIGPEGGFSNDELNFAYS--FCDGLSLGTRILKVDTAVVSALAYVN 233


>gi|288550384|ref|ZP_05970221.2| 16S rRNA methyltransferase RsmE [Enterobacter cancerogenus ATCC
           35316]
 gi|288314998|gb|EFC53936.1| 16S rRNA methyltransferase RsmE [Enterobacter cancerogenus ATCC
           35316]
          Length = 248

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 108/249 (43%), Gaps = 14/249 (5%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +   + R++    +    +   S D  +++  VLRM  G  I LF+G +  + ++I+   
Sbjct: 4   LTMRIPRIYHPELITAGREIALSDDAANHVGRVLRMGAGQAIQLFDGSNQVFDAEITRAD 63

Query: 63  KS--IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           K       +  +   +     +       +  ++++ IQKS+E+G+  I P+ +      
Sbjct: 64  KKSVHVNVLRGEVDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVK 123

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGS 174
              +  +  + + +   ++A EQ     +P I P   LE      +   ++        S
Sbjct: 124 LDAERLNKKIQQWQKIAVAACEQSGRNRIPEIRPAMDLEDWCAEEESGLKLNLHPRASAS 183

Query: 175 ENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N+L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+
Sbjct: 184 INTLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAI 237

Query: 235 ALVQAICGD 243
             +Q   GD
Sbjct: 238 TALQVRFGD 246


>gi|90409107|ref|ZP_01217229.1| hypothetical protein PCNPT3_05034 [Psychromonas sp. CNPT3]
 gi|90309781|gb|EAS37944.1| hypothetical protein PCNPT3_05034 [Psychromonas sp. CNPT3]
          Length = 275

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 112/247 (45%), Gaps = 15/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R +      +  + + + +   ++ HVLR+KEG NI+LFNG  G++ + +  V K 
Sbjct: 34  MRYPRFYDPQSFSLHNEFELADNVAQHI-HVLRLKEGLNIILFNGLGGQFTATLINVKKR 92

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPI--KTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                         +S +      +  +  R++++IQKSVE+G+  I P+++        
Sbjct: 93  SCTVKITAFTQTDNESPLHLHLGQVISRGERMEFIIQKSVELGVNEITPLLSERCGVKVN 152

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +       + +   I+A EQ     +P ++PP  ++          Q+        S  
Sbjct: 153 VERMAKKHQQWQKIAIAACEQSGRNIVPIVHPPQQMQQWCTQSTDALQLTLHPRALLSIK 212

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L       +I N+ +LIGPEGG    E     +L F   L LGPR+LR++TA + A++ 
Sbjct: 213 TLPD-----NISNIRLLIGPEGGLSDGEINLTKTLNFTETL-LGPRVLRTETATLTAISA 266

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 267 LQFRFGD 273


>gi|317128303|ref|YP_004094585.1| hypothetical protein Bcell_1591 [Bacillus cellulosilyticus DSM
           2522]
 gi|315473251|gb|ADU29854.1| protein of unknown function DUF558 [Bacillus cellulosilyticus DSM
           2522]
          Length = 250

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 97/247 (39%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F++  +  +     SGD   +++ V+RM++GDNI+        +   IS +  S  
Sbjct: 1   MQRYFINPQMFHEDHVVISGDDAKHISRVMRMEQGDNIICCTTSGVCYECVISEMKDSYI 60

Query: 67  FKVEYQSRSQTK--QSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
           +    +  S++     +V       K ++ +++IQK  E+G     P     +      +
Sbjct: 61  YATIEKQESKSVELPVNVTIGHGLPKGDKFEWVIQKGTELGAKNFLPFEAERSIVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
                +DR       AAEQ     LP +        LL + D    ++ A E        
Sbjct: 121 KADKKIDRWNKIAKEAAEQSHRQQLPKVMEVQRFSQLLDHVDGYSYVLVAYEEAAKNDEK 180

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                 L  +    ++  L GPEGG+   E   L          LGPRILRS+TA +  +
Sbjct: 181 SQLFSVLQEVKKGESILFLFGPEGGFSDREINELTKKG-ALICGLGPRILRSETAPLYGL 239

Query: 235 ALVQAIC 241
             +    
Sbjct: 240 TAISYHL 246


>gi|167571263|ref|ZP_02364137.1| hypothetical protein BoklC_15582 [Burkholderia oklahomensis C6786]
          Length = 253

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 100/251 (39%), Gaps = 12/251 (4%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S + R FVD  L          D   ++  VLR+  GD + LFNG  G++ ++   + K
Sbjct: 5   TSAIPRFFVDAELQSDATLALPADVARHV-QVLRLAAGDAVTLFNGAGGQYRAEFVELDK 63

Query: 64  SIRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                    +          +         +++D++I+K+VE+G  AI P+ T       
Sbjct: 64  RAALVRIGAFTPADVEAPYRITLAQGIAGGDKMDWLIEKAVELGAAAIAPLSTARGVVRL 123

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     +   +    ++ EQC    +P + P   +   L                   
Sbjct: 124 SGERAQKRVAHWQGVVRASCEQCGRNRVPDVAPVRDIHAWLAALPAAPAPDELRLMLSPR 183

Query: 176 NS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            S     L  +     V +LIGPEGG   +E+E      F   + LGPR+LR++TA +A 
Sbjct: 184 ASVGFADLPGMPPAGGVTLLIGPEGGLAPDEEEAARERGFA-SILLGPRVLRTETAGIAM 242

Query: 234 MALVQAICGDW 244
           +A + A  G W
Sbjct: 243 LAALAARWGGW 253


>gi|28198087|ref|NP_778401.1| hypothetical protein PD0156 [Xylella fastidiosa Temecula1]
 gi|28056147|gb|AAO28050.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|307579179|gb|ADN63148.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 244

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 115/247 (46%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++     +
Sbjct: 1   MRLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRR 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
               ++E  S    +    +  + +  +  ++D ++QK+ E+G+ AI PV T        
Sbjct: 61  EAWARIEGVSEVCNESPLAITLVQAITRGEKMDLIVQKATELGVVAIVPVDTERSGVRLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++     +       ISA EQC    +P +  P  L+ L +  D +   +  D       
Sbjct: 121 SERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQVLPEILDPDTLRLILDPKSEHRL 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S     +      V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+A+
Sbjct: 181 ST---LSRLTPVEVIIAIGPEGGWSPRDLEILKDAGFI-GFSLGPRILRTETAGLTAIAV 236

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 237 LQAQLGD 243


>gi|14026505|dbj|BAB53102.1| mll6903 [Mesorhizobium loti MAFF303099]
          Length = 238

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 99/220 (45%), Positives = 137/220 (62%), Gaps = 2/220 (0%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           ++RLFV   L    +  A   Q HYL HVLR+ EG  ILLFNG+DGEW + I+   K   
Sbjct: 1   MQRLFVPDDLGPDAEFDADQQQSHYLIHVLRLGEGAEILLFNGRDGEWSAAIAAKSKKAV 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
           R +V+   R Q    D+ Y F+P+K  RLDY++QK+VEMG G ++PVIT++TQ    ++D
Sbjct: 61  RLRVQTLQRPQPPLPDLIYCFAPLKQGRLDYLVQKAVEMGAGILQPVITQHTQVAKPSID 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIA 185
           R+R   + AAEQC IL +P +      E LL  WD   ++VF DE   + N L  L A+ 
Sbjct: 121 RLRANVVEAAEQCGILAVPEVREAEKFERLLAGWDKERRLVFCDEDASTNNPLPALRAVK 180

Query: 186 HIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
               +A+L+GPEGG+  +E++ L +LPFVT + LGPRILR
Sbjct: 181 E-KKLALLVGPEGGFSDDERKMLRALPFVTAIPLGPRILR 219


>gi|255656430|ref|ZP_05401839.1| hypothetical protein CdifQCD-2_12199 [Clostridium difficile
           QCD-23m63]
 gi|296450123|ref|ZP_06891884.1| RsmE family RNA methyltransferase [Clostridium difficile NAP08]
 gi|296878504|ref|ZP_06902509.1| RsmE family RNA methyltransferase [Clostridium difficile NAP07]
 gi|296260886|gb|EFH07720.1| RsmE family RNA methyltransferase [Clostridium difficile NAP08]
 gi|296430311|gb|EFH16153.1| RsmE family RNA methyltransferase [Clostridium difficile NAP07]
          Length = 252

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 105/248 (42%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLC--IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + R FV+              G+   +++ VLR K G+ + + +  + E++ +I  + KS
Sbjct: 1   MDRFFVEKNNINLQDKTCTIEGEDVKHISKVLRYKPGEKLEICDKNNNEYICEIVNIDKS 60

Query: 65  IRF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           I     +E    ++  +  ++      K  +++ ++QK  E+G+  I  V T+ +     
Sbjct: 61  IVNLNILEKVDINRESELKIRLYQGLPKAPKMEMILQKLTEVGVEEIILVQTKRSVAKVD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +      +R       AA+Q     +P +    T +  L++   N   +   E   +  
Sbjct: 121 DKKEDKKFERWERIIYEAAKQSKRGKIPKLRGVLTFKEALEDMKKNNINICPYENERTVP 180

Query: 177 SLEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
               L        +V I IGPEGG+  EE E +        +SLGPRILR++TA+V A  
Sbjct: 181 MKHALQNCDSNIDSVGIFIGPEGGFSEEEIEQI-QKNNCNVVSLGPRILRTETASVVAST 239

Query: 236 LVQAICGD 243
           +      D
Sbjct: 240 IALYELSD 247


>gi|161353586|ref|NP_462010.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|267995259|gb|ACY90144.1| hypothetical protein STM14_3738 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
          Length = 243

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++        S N
Sbjct: 121 SERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|182680714|ref|YP_001828874.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa M23]
 gi|182630824|gb|ACB91600.1| protein of unknown function DUF558 [Xylella fastidiosa M23]
          Length = 242

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 115/245 (46%), Gaps = 12/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GKSI 65
           + R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++     +  
Sbjct: 1   MSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRREA 60

Query: 66  RFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
             ++E  S    +    +  + +  +  ++D ++QK+ E+G+ AI PV T        ++
Sbjct: 61  WARIEGVSEVCNESPLAITLVQAITRGEKMDLIVQKATELGVVAIVPVDTERSGVRLDSE 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +       ISA EQC    +P +  P  L+ L +  D +   +  D       S 
Sbjct: 121 RVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQVLPEILDPDTLRLILDPKSEHRLST 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
               +      V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+A++Q
Sbjct: 181 ---LSRLTPVEVIIAIGPEGGWSPRDLEILKDAGFI-GFSLGPRILRTETAGLTAIAVLQ 236

Query: 239 AICGD 243
           A  GD
Sbjct: 237 AQLGD 241


>gi|54295775|ref|YP_128190.1| hypothetical protein lpl2865 [Legionella pneumophila str. Lens]
 gi|53755607|emb|CAH17109.1| hypothetical protein lpl2865 [Legionella pneumophila str. Lens]
          Length = 244

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 9   RLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFK 68
           R++           + S +   ++  VLRM++G+ + LFNG + E+ + I  V K   F 
Sbjct: 7   RIYQPGEYQPGQFLELSPEAGQHVGVVLRMEQGEQLTLFNGDNKEFTASIEMVKKKQVFV 66

Query: 69  VE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NT 120
                   ++     +    +  K  R++ ++QKS E+G+  I P+IT   Q        
Sbjct: 67  RIASVLEVNRESPLKIHLAQAISKGERMEMVMQKSAELGVACITPIITERCQVKIDKEKM 126

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              M +     I A EQC    +P +  P  L+  ++    + +++       +      
Sbjct: 127 AKKMHQWLNIIIGACEQCGRNQIPELRQPVYLDQFVREAKEHLKLILHPAFSKTWRDYPV 186

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                  P+VA++IGPEGG+  EE        F+ PLSLGPR+LR++TAA+ A++++QA 
Sbjct: 187 -----QPPDVALIIGPEGGFSDEEIRLTSGHGFL-PLSLGPRVLRTETAAITALSVLQAA 240

Query: 241 CGD 243
            GD
Sbjct: 241 GGD 243


>gi|254473523|ref|ZP_05086919.1| conserved hypothetical protein TIGR00046 [Pseudovibrio sp. JE062]
 gi|211957235|gb|EEA92439.1| conserved hypothetical protein TIGR00046 [Pseudovibrio sp. JE062]
          Length = 242

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 139/223 (62%), Gaps = 5/223 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSI 65
           ++RLFVD  L      +A   Q +YL +VLRMKEG  +L+FNGK GEW ++I     KS 
Sbjct: 1   MQRLFVDQELRAGLHLEADRAQANYLLNVLRMKEGGEVLVFNGKHGEWRAQILPTGRKSC 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMD 125
              V  Q R QT   D+ Y+F+P+K  RLDYM+QK+VEMG G +RPVIT++TQN    ++
Sbjct: 61  ELIVTEQLREQTPTPDLDYLFAPLKLARLDYMVQKAVEMGAGRLRPVITQFTQNPKIKLE 120

Query: 126 RVRTYTISAAEQCDILTLPFIYPPTTLEF---LLKNWDHNCQIVFADETCGSENSLEKLH 182
           R+ +  + A EQC +L++P +  P  ++      +  + + QI+F DE  G+ N LE L 
Sbjct: 121 RMESNALEACEQCGVLSVPSVLEPVQIKKLLSTWEQEEGDRQIIFCDEGHGTHNPLEALK 180

Query: 183 AIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILR 225
            +     +A+LIGPEGG+  EE+  LHS PFV  + LGPRILR
Sbjct: 181 DVP-KAPLAVLIGPEGGFSEEERALLHSKPFVHAIPLGPRILR 222


>gi|29726851|pdb|1NXZ|A Chain A, X-Ray Crystal Structure Of Protein Yggj_haein Of
           Haemophilus Influenzae. Northeast Structural Genomics
           Consortium Target Ir73.
 gi|29726852|pdb|1NXZ|B Chain B, X-Ray Crystal Structure Of Protein Yggj_haein Of
           Haemophilus Influenzae. Northeast Structural Genomics
           Consortium Target Ir73
          Length = 246

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 111/247 (44%), Gaps = 15/247 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
            + R++    L  +TQ   S D  +++A VLR  EG+ + LF+G +  + +KI       
Sbjct: 1   RIPRIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIE-SNKK 59

Query: 66  RFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
             KVE    +   +     +       +  R ++ IQKSVE+G+  I P+ +        
Sbjct: 60  SVKVEILGRELADKESHLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLD 119

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 120 AERXDKKIQQWQKIAIAACEQCGRNIVPEIRPLXKLQDWCAENDGALKLNLHPRAHYSIK 179

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG  ++E        F T + LG R+LR++TA++AA++ 
Sbjct: 180 TLPTIPA----GGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAISA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQICFGD 241


>gi|84786494|gb|ABC62676.1| hypothetical protein ELI_02920 [Erythrobacter litoralis HTCC2594]
          Length = 260

 Score =  138 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 79/257 (30%), Positives = 120/257 (46%), Gaps = 25/257 (9%)

Query: 13  DFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RFKVEY 71
             P+   T     G+  HYL  V+R+  GD ++L +   GEW  K++ V K I   +   
Sbjct: 2   PEPIAAGTAVTVDGNAAHYLGKVMRVSAGDAVILCDDATGEWACKVTDVEKRIVTLEPVE 61

Query: 72  QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYT 131
           + R + +  D     + +K +R D +++K+ E+G+ AIRPV+TR       N +R R   
Sbjct: 62  KLREREQVPDFWLCPALLKKDRFDLVLEKATELGVRAIRPVVTRRCVADKLNAERARAIV 121

Query: 132 ISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE--------------------- 170
             AAEQC    LP +  P  L+ LL++W  +  + FADE                     
Sbjct: 122 TEAAEQCARTALPELAEPVKLDSLLRDWPEDRALFFADELGGAPAGEAFVTYSESLRRQG 181

Query: 171 ---TCGSENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
                      +           A+LIGPEGG+   E++ + + P    ++LGPRILR +
Sbjct: 182 PQAGKDPHLDDQAARGPRLRGGAALLIGPEGGFDDAERKAIRAHPQARAITLGPRILRGE 241

Query: 228 TAAVAAMALVQAICGDW 244
           TAA+AA AL     GDW
Sbjct: 242 TAAIAATALWMGTVGDW 258


>gi|16800575|ref|NP_470843.1| 16S ribosomal RNA methyltransferase RsmE [Listeria innocua
           Clip11262]
 gi|16413980|emb|CAC96738.1| lin1507 [Listeria innocua Clip11262]
          Length = 255

 Score =  138 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 103/248 (41%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV++ L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVNYELENDNDTLSITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVIPEVHYAASFKELMFDHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSVLTNLFQTMKPGQSVLCIFGPEGGISEKELLLLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|153815335|ref|ZP_01968003.1| hypothetical protein RUMTOR_01569 [Ruminococcus torques ATCC 27756]
 gi|317501690|ref|ZP_07959881.1| RsmE family RNA methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088425|ref|ZP_08337340.1| hypothetical protein HMPREF1025_00923 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847397|gb|EDK24315.1| hypothetical protein RUMTOR_01569 [Ruminococcus torques ATCC 27756]
 gi|316896941|gb|EFV19021.1| RsmE family RNA methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330408192|gb|EGG87680.1| hypothetical protein HMPREF1025_00923 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 255

 Score =  138 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 106/243 (43%), Gaps = 10/243 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +++ F +     +++    G   +++ +VLRMK G+++ + +G+   +L  ++   K   
Sbjct: 1   MQQFFAEPSWITESEILIRGADLNHMKNVLRMKVGEDVRINDGQGTTYLCCLNRYEKDQA 60

Query: 67  FKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               ++         S++       K +++++++QKSVE+G   I P   +        +
Sbjct: 61  VLDVFRKLDTETELPSEIILFQGLPKGDKMEWIVQKSVELGAHKIVPFSAKRSVVKLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADE-TCGSENS 177
                 +R +     AAEQ     +P +    +    L+  +    ++   E   G   +
Sbjct: 121 KAVKKQERWQLIAKGAAEQSGRGVIPEVCGVCSFTEALEQAESLDVVLIPYELEEGMAET 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           +  +  I    +V I IGPEGG+   E           P++LG RILR++TA +  ++++
Sbjct: 181 VRVIEQIEPGQSVGIFIGPEGGFEEAEVLRAKEKG-ARPVTLGKRILRTETAGLTTLSIL 239

Query: 238 QAI 240
              
Sbjct: 240 MYH 242


>gi|225568735|ref|ZP_03777760.1| hypothetical protein CLOHYLEM_04814 [Clostridium hylemonae DSM
           15053]
 gi|225162234|gb|EEG74853.1| hypothetical protein CLOHYLEM_04814 [Clostridium hylemonae DSM
           15053]
          Length = 245

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 52/244 (21%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  FV             G   +++ +VLRMK G+ + + +G + ++L  +    +   
Sbjct: 1   MQHFFVTPFQVGNGYIFIEGQDVNHMKNVLRMKPGEELTVSDGDNRKFLCAVDRYEEGQA 60

Query: 67  FKVEYQSRSQTKQ--SDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
                +      +  S +       K ++++ ++QK+VE+G+  + PV+TR        +
Sbjct: 61  VLKICREEMSDTELASRICLFQGLPKQDKMELIVQKAVELGVSEVVPVMTRRSVVRLDEK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPP-TTLEFLLKNWDHNCQIVFADETCGSENS 177
                ++R ++   SA++Q     +P + P     E L +    +  ++  +   G + +
Sbjct: 121 KAARKVERWQSIAGSASKQAGRGYIPKVAPVAGFGEALRQASAMDVLLIPYELAEGMQET 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
              + +I    +V + IGPEGG+  EE E       V P++LG RILR++TA +  ++++
Sbjct: 181 KRVISSIVPGQSVGVFIGPEGGFEREEVELAVEAGAV-PITLGRRILRTETAGLTTLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 MFHL 243


>gi|333029175|ref|ZP_08457236.1| Ribosomal RNA small subunit methyltransferase E [Bacteroides
           coprosuis DSM 18011]
 gi|332739772|gb|EGJ70254.1| Ribosomal RNA small subunit methyltransferase E [Bacteroides
           coprosuis DSM 18011]
          Length = 231

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 52/236 (22%), Positives = 98/236 (41%), Gaps = 9/236 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   +      I    +   D+  + + VLR+ EGD+I L +GK   + ++I+       
Sbjct: 1   MPIFYTPN---IDQIKELPSDEAKHCSRVLRLTEGDHITLTDGKGNFYEAEITLTTPKKC 57

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +E  + +  K      +      +R +++ +K+ E+G      +  ++++      
Sbjct: 58  LFNILETHTPTPPKVYIHLAMGPTKNMDRNEWVAEKATEIGFNEFTFLNCQFSERKIIKT 117

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           DRV    +SA +Q    TLP +   T  +  +    +  + +        E   E     
Sbjct: 118 DRVEKILVSAMKQSKRATLPKLNEMTPFKTFITQPFNGQKFIAHCYKENQELLKEL---Y 174

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
               N  ILIGPEG +  EE +      F  P+SLG   LR++TAA+ A + +  +
Sbjct: 175 TIGENALILIGPEGDFSPEEIQLALDNGF-QPISLGDSRLRTETAAIFACSTINIL 229


>gi|145631448|ref|ZP_01787218.1| hypothetical protein CGSHi22421_06337 [Haemophilus influenzae
           R3021]
 gi|144982985|gb|EDJ90494.1| hypothetical protein CGSHi22421_06337 [Haemophilus influenzae
           R3021]
          Length = 245

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+G +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCLLSEDATNHVARVLRMTEGEQLELFDGSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESNLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + +      V +LIG EGG  ++E        F T + LG R+LR++TA++AA+ 
Sbjct: 180 KTLPTIPS----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIT 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|313623733|gb|EFR93877.1| ribosomal RNA small subunit methyltransferase E [Listeria innocua
           FSL J1-023]
          Length = 255

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 101/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVTNELENDNDTLTITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEDE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVVPEVHYAASFKELMFDHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSVLASLFQTMKPGQSVLCIFGPEGGISEKELLLLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|167564119|ref|ZP_02357035.1| hypothetical protein BoklE_16297 [Burkholderia oklahomensis EO147]
          Length = 253

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 102/251 (40%), Gaps = 12/251 (4%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S + R FVD  L          D   ++  VLR+  GD + LFNG  G++ +++  + K
Sbjct: 5   TSAIPRFFVDAELQSDATLALPADVARHV-QVLRLAAGDAVTLFNGAGGQYRAEVVELDK 63

Query: 64  SIRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                    +          +  +      +++D++I+K+VE+G  AI P+ T       
Sbjct: 64  RAALVRIGAFTPADVEAPYRITLVQGIAGGDKMDWLIEKAVELGAAAIAPLSTARGVVRL 123

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     +   +    ++ EQC    +P + P   +   L                   
Sbjct: 124 SGERAQKRVAHWQAVVRASCEQCGRNRVPDVAPVRDIHAWLAALPAAPAPDELRLMLSPR 183

Query: 176 NS--LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
            S     L  +     V +LIGPEGG   +E+E      F   + LGPR+LR++TA +A 
Sbjct: 184 ASVGFADLPGMPPAGGVTLLIGPEGGLAPDEEEAARERGFA-SILLGPRVLRTETAGIAM 242

Query: 234 MALVQAICGDW 244
           +A + A  G W
Sbjct: 243 LAALAARWGGW 253


>gi|56415032|ref|YP_152107.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363961|ref|YP_002143598.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|229307087|ref|YP_001590023.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|229597264|ref|YP_002047082.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|56129289|gb|AAV78795.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095438|emb|CAR60997.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 243

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++        S N
Sbjct: 121 NERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|296104610|ref|YP_003614756.1| 16S ribosomal RNA methyltransferase RsmE [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059069|gb|ADF63807.1| 16S ribosomal RNA methyltransferase RsmE [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 243

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    +    +   S D  +++  VLRM  G  I LF+G +  + ++I+   K 
Sbjct: 1   MRIPRIYHPELITAGREIALSDDAANHVGRVLRMGAGQAIQLFDGSNQVFDAEITRADKK 60

Query: 65  --IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                 +  +   +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVHVNVLRGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +  + + +   I+A EQ     +P I P   LE      +   ++        S N
Sbjct: 121 AERLNKKIQQWQKIAIAACEQSGRNRIPEIRPAMDLEDWCAEEESGLKLNLHPRASASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|223985669|ref|ZP_03635717.1| hypothetical protein HOLDEFILI_03023 [Holdemania filiformis DSM
           12042]
 gi|223962360|gb|EEF66824.1| hypothetical protein HOLDEFILI_03023 [Holdemania filiformis DSM
           12042]
          Length = 258

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 12/242 (4%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           +++++F+     + +  +    Q H+L  VLRMKEG+ + + + +   +   +   G+  
Sbjct: 21  NMQQIFIQQKTHVGSVIEPDPQQRHHLQRVLRMKEGETLRVIDAEGAVFCGVLDGAGQIQ 80

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
             ++  + R       +  +   IK  R D+++QK  E+G+  I P  +  T        
Sbjct: 81  ITELLDEDREL--PVTLTLVAGLIKGERWDWLLQKCTELGVSRIVPFQSSRTVVKLESDK 138

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               ++R +     A++QC     P +  P  L            + + DE         
Sbjct: 139 VDKKLERWQKIVQEASQQCKRTQRPQVCAPIELADAGAWRSEQNFVAYEDEALHGGLLSA 198

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
           +L       +V ++IGPEGG+   E E L +  +    SLG RILR++TAAVAA+ L  A
Sbjct: 199 QLEK---GRSVTLVIGPEGGFSPAEIERLQTQGY-RCCSLGKRILRAETAAVAAVCLAGA 254

Query: 240 IC 241
           + 
Sbjct: 255 VL 256


>gi|282875997|ref|ZP_06284864.1| RNA methyltransferase, RsmE family [Staphylococcus epidermidis
           SK135]
 gi|281295022|gb|EFA87549.1| RNA methyltransferase, RsmE family [Staphylococcus epidermidis
           SK135]
          Length = 250

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 99/247 (40%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKAS-GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F++              + YH++ +V+R KEG NI++    +  +  KI  +    
Sbjct: 1   MQRYFMNQSADENQCFFIENKEDYHHIVNVMRYKEGQNIIVTFSDENVFKCKIISINDQS 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
                VE Q  +     ++      IK ++ ++MIQK+ EMG      V           
Sbjct: 61  IEIKLVEKQQINTELPQNITICSGLIKADKYEWMIQKATEMGANEFIAVAMERSVVKLND 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 + R +     AAEQ   LT+P I   + L+ +         ++ A E       
Sbjct: 121 SKVEKKLSRWQKIIKEAAEQSYRLTIPNIKFKSNLKEIYGMISQYDYVLIAYEEQAKHGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + +        V I+ GPEGG    E      +   T + LGPRILR++TA + A
Sbjct: 181 LSQFKQTIKQFKTQDRVLIIFGPEGGLSDSEISLFGDV--STIVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ V   
Sbjct: 239 LSAVSYE 245


>gi|241664175|ref|YP_002982535.1| hypothetical protein Rpic12D_2592 [Ralstonia pickettii 12D]
 gi|240866202|gb|ACS63863.1| protein of unknown function DUF558 [Ralstonia pickettii 12D]
          Length = 249

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + K   
Sbjct: 3   LPRFFVDTPLAPNTTVTLPEAVTRHI-HVLRLAVGDDVCLFDGSGHEFRARLDAINKRDA 61

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                +        +  +         +++D++I+K+VE+G+ A+ P+ T         +
Sbjct: 62  TASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVHAVTPLQTERAVVRLSGE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
                +   +    +A EQC    +P + P +TL   L                G++   
Sbjct: 122 RAAKRVQHWQALVQAACEQCGRARVPAVAPVSTLREWLAAARSTDAPRVLLSPRGTQSLT 181

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
               +         + +LIGPEGG   +E+    S  F+ PL+LG RILR+++AA+ A++
Sbjct: 182 QWAVQSRTRIEGSGIVLLIGPEGGLSPDEEALAESAGFL-PLTLGRRILRTESAALVAVS 240

Query: 236 LVQAICGDW 244
            + A+ G++
Sbjct: 241 ALHAVLGEF 249


>gi|295092115|emb|CBK78222.1| RNA methyltransferase, RsmE family [Clostridium cf. saccharolyticum
           K10]
          Length = 247

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 105/244 (43%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FVD           +G   +++ +VLRMK G+ +L+ NG+D ++L ++S +     
Sbjct: 1   MYHFFVDRSQIHPEHITITGPDVNHIRNVLRMKTGEQVLISNGEDRDYLCRLSRIDPDEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               +  +  +    + V       K ++++ +IQK+VE+G   I PV +R        +
Sbjct: 61  EAEIIREKEETTELPARVCLFQGLPKGDKMELIIQKAVELGAYQIIPVASRRAVVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R    + SAA+Q     +P I P       L             E      ++
Sbjct: 121 KEEAKLRRWNAISESAAKQSKRRIIPQIAPVMEFREALSAVSGFDLACIPYECESGMEAV 180

Query: 179 EKLHAIAH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            K    A     +A+ IGPEGG+   E E       V P+SLG RILR++TA +  ++++
Sbjct: 181 RKFVGQADAGQRIAVFIGPEGGFEEAEVEAAVQAG-VVPVSLGKRILRTETAGLCMLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 AFKL 243


>gi|77163661|ref|YP_342186.1| hypothetical protein Noc_0123 [Nitrosococcus oceani ATCC 19707]
 gi|254435009|ref|ZP_05048516.1| conserved hypothetical protein TIGR00046 [Nitrosococcus oceani
           AFC27]
 gi|76881975|gb|ABA56656.1| 16S rRNA m(3)U-1498 methyltransferase [Nitrosococcus oceani ATCC
           19707]
 gi|207088120|gb|EDZ65392.1| conserved hypothetical protein TIGR00046 [Nitrosococcus oceani
           AFC27]
          Length = 243

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 106/247 (42%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L I +          Y+  VLR++ G  + LF+G+  E+ + +  + K 
Sbjct: 1   MRVPRVYFPLSLSIGSSVSLDERALQYVIRVLRLRLGAQLRLFDGRGAEYQAVLETIEKR 60

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 +E           +       +  R+DY +QK+VE+G+  I P++T  +     
Sbjct: 61  AVKVRILERIEHHVESPLHIILGQGISRGERMDYALQKAVELGVSRIIPLLTERSAVNLS 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   +   ISA EQC    +P +  P  L   L++      ++    +     
Sbjct: 121 AERAEKRLRHWQGVIISACEQCGRNYIPPVDTPRPLADFLRDDHRGLAVLLDPRSRRPLK 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L           + +LIGPEGG +  E +      F+  + LGPRILR++TA VAA+  
Sbjct: 181 ALPL----PLDNRLIVLIGPEGGLNKGEAKQAQQADFI-GVCLGPRILRTETATVAALTA 235

Query: 237 VQAICGD 243
           +Q + GD
Sbjct: 236 LQLLWGD 242


>gi|332520272|ref|ZP_08396734.1| protein of unknown function DUF558 [Lacinutrix algicola 5H-3-7-4]
 gi|332043625|gb|EGI79820.1| protein of unknown function DUF558 [Lacinutrix algicola 5H-3-7-4]
          Length = 234

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 107/230 (46%), Gaps = 6/230 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKI-SYVGKSI 65
           ++  +       + Q   S ++  ++  VLR ++GD + + NGK   + + I     KS 
Sbjct: 1   MQLFYSPDISKNQDQFTFSKEESRHIVKVLRKRDGDILHITNGKGDVFTAVILIAAIKSC 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTN-RLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
             +++          ++    +P K N R ++ ++K+ E+G+ +I P+I  +++      
Sbjct: 61  TVEIKEVVTQNPLNYNLHLAVAPTKMNDRYEWFLEKATEIGISSITPIICDHSERKVIKE 120

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           DR      SA +Q     LP + P    +  LK   ++   +   E    ++  + L   
Sbjct: 121 DRFEKILQSAMKQSLSAYLPKLNPAIAFKEFLKQDFNSALYIAHCEETNKKSLKKVLQT- 179

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               ++ ILIGPEG + ++E E   +  ++ P++LG   LR++TAA+ A 
Sbjct: 180 --NTDITILIGPEGDFSTKEIELALANNYI-PVTLGETRLRTETAAIVAC 226


>gi|78224577|ref|YP_386324.1| 16S ribosomal RNA methyltransferase RsmE [Geobacter metallireducens
           GS-15]
 gi|78195832|gb|ABB33599.1| conserved hypothetical protein [Geobacter metallireducens GS-15]
          Length = 263

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 108/248 (43%), Gaps = 11/248 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             ++R             +  GD + ++  VLR+K    + L +G   E    I  +G+ 
Sbjct: 1   MSVRRFMAPGADLAGESVRIEGDLFRHMVKVLRLKIDTRVRLADGHGVECAGIIQEIGRD 60

Query: 65  I---RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                 +  +          +  I    K  +++ ++QK  E+G+  + P     +    
Sbjct: 61  HLTVAVEERHAVAPVGGSLRITLIQGLPKGEKMELILQKGTELGVNEVVPFQADRSVSRI 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
                   + R +     AA Q   L +P +     ++  +++ DH+ +++  +E   + 
Sbjct: 121 PADRQDERLRRWQRIAAEAARQAGRLDIPTVQLAQGMDEAVRDTDHDLKLLLWEEE-RAT 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
                ++      ++A+++GPEGG   EE ET     F+ P++LG RILR++TA +A +A
Sbjct: 180 TLQGAINVRPRPASIAVIVGPEGGLTREEAETARRTGFI-PVTLGRRILRTETAGIALLA 238

Query: 236 LVQAICGD 243
           ++Q + GD
Sbjct: 239 ILQYLYGD 246


>gi|293400698|ref|ZP_06644843.1| RNA methyltransferase, RsmE family [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305724|gb|EFE46968.1| RNA methyltransferase, RsmE family [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 258

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 106/249 (42%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL-SKISYVGKSI 65
           +++ F+  PL +    +   +Q H++ HV+RMK  + I L +GK   +    +    K  
Sbjct: 1   MQQYFLHKPLQVHDLVEMEPEQAHHIQHVMRMKPDEIIRLADGKGHMYYAHVVFRDHKVF 60

Query: 66  RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQN 119
               E          D+      IK  + D+++QKS E+G+  I P  +         + 
Sbjct: 61  ACVDEEMEDHTRTPVDMILAQGLIKKEKWDFLLQKSAELGVQRIIPFTSSRTVVKTKDEK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
                 R       A EQC   TL  +  P +   L+K  +     + A E    +++  
Sbjct: 121 VDKKRLRWNKILQEACEQCKRSTLVALDSPKSFAELIKASEDADVKLIAYERADVKSAHV 180

Query: 180 K--LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
           K  L        V I++G EGG+  +E   L  + F   +SLG RILR++TAA++ +A +
Sbjct: 181 KEVLQKYPAPHKVFIVVGCEGGFSEDEVIQLEEVGF-HRVSLGARILRAETAALSLLACI 239

Query: 238 QAIC---GD 243
                  GD
Sbjct: 240 SFFYEMAGD 248


>gi|120436000|ref|YP_861686.1| 16S ribosomal RNA methyltransferase RsmE [Gramella forsetii KT0803]
 gi|117578150|emb|CAL66619.1| protein containing DUF558 [Gramella forsetii KT0803]
          Length = 237

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 94/230 (40%), Gaps = 5/230 (2%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  +         Q     D+  ++  VLR  EGD + + NG      ++I        
Sbjct: 1   MQLFYNPEISEKDKQIIFPKDESKHIVKVLRKSEGDILNITNGNGLLINAEIIKADIKQC 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +  + +          +      +R ++ ++K++E+G+  I P+I  +++     +
Sbjct: 61  LAKVISVEKQPAPPYYVHMIVAPTKMNDRYEWFLEKAMEIGVHEITPIICDHSERKVVKL 120

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           +R      SA +Q     +P +  P      +       + +   E    +N L+  + I
Sbjct: 121 NRFERVLQSAMKQSLHYRMPKLNDPINFSDFIATEIEGSKYIAHCEEETGKNYLQ--NEI 178

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               N+ ILIGPEG +  EE E   +  +   +SLG   LR++TAA+ A 
Sbjct: 179 IPGENINILIGPEGDFSKEEIEKAINKGW-NAVSLGDSRLRTETAAIVAC 227


>gi|331007217|ref|ZP_08330426.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC1989]
 gi|330418984|gb|EGG93441.1| Ribosomal RNA small subunit methyltransferase E [gamma
           proteobacterium IMCC1989]
          Length = 257

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 71/258 (27%), Positives = 118/258 (45%), Gaps = 19/258 (7%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF-----NGKDGEWLSKIS 59
            H+ R+++  PL   TQ +      H+L  V+RMK G  ++LF     +G+ GE+ + ++
Sbjct: 1   MHIPRIYIPLPLSEHTQIELDKASMHHLVTVMRMKVGRQVILFNNVPIDGRYGEFTATLA 60

Query: 60  YVGKSIRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT 117
            V K        E+ S        V      IK +R+D+++QK+ E+G+  I P+ ++YT
Sbjct: 61  SVDKKQARVDIGEFVSPQIESPLQVHLGACLIKNDRMDWLLQKATELGVSEITPLFSQYT 120

Query: 118 Q------NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADET 171
                       M   R   I+A EQ   + LP ++ P  LE  + +  H  Q       
Sbjct: 121 DVKLPAERIEKKMGHWRKIVINACEQSGRVRLPVLHTPLALEKWVASSTHVRQKFVLHPY 180

Query: 172 CGSENSLEKLHAIAHIPN-----VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRS 226
             S              +     +A+L+GPEGG   +E +      F   + LGPRILR+
Sbjct: 181 ASSSPHTSADRPQESSLSSDINAIALLVGPEGGLTEDEVDLAVQSQF-KGMRLGPRILRA 239

Query: 227 DTAAVAAMALVQAICGDW 244
           +TA + A+A++    GD+
Sbjct: 240 ETAPLVALAVLSQQLGDF 257


>gi|217964384|ref|YP_002350062.1| protein YqeU [Listeria monocytogenes HCC23]
 gi|217333654|gb|ACK39448.1| protein YqeU [Listeria monocytogenes HCC23]
 gi|307571051|emb|CAR84230.1| conserved hypothetical protein [Listeria monocytogenes L99]
          Length = 255

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 100/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVTNELENDNDTLSITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     A EQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEATEQSHRTVIPEVHYAASFKELMYDHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALASLFQTMKPGQSVLCIFGPEGGISEKELLHLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|205374146|ref|ZP_03226946.1| 16S rRNA m3U1498 methyltransferase [Bacillus coahuilensis m4-4]
          Length = 248

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 110/247 (44%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F+        + +  GD +H++  V+RMKEGD+ L     +   + KI  +     
Sbjct: 1   MQRYFLQTD--SNERVRVKGDDFHHMIRVMRMKEGDSFLSVFQDNKSAICKIEEISNDSL 58

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVI------TRYTQ 118
               VE++  S      +  +    K ++L+ +IQK  E+G     P            +
Sbjct: 59  TASVVEWELNSTEMPVRITIVSGLPKGDKLESIIQKGTELGATEFIPFKATRSIVKWDDK 118

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
             H  ++R       AAEQ    T+PFI  P TL+ +L+    N   + A E    +   
Sbjct: 119 KAHKKIERFEKIAKEAAEQSHRRTIPFISEPKTLKQILQTVPSNAVKLVAFEEEAKQGES 178

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
               E+L  + +  ++ ++ GPEGG   EE   L +  F+    LGPRILR++TA + A+
Sbjct: 179 SQFKEELQKVQNGDHIMMIFGPEGGLTEEEVHELKNHDFI-SCGLGPRILRTETAPLYAL 237

Query: 235 ALVQAIC 241
           A +    
Sbjct: 238 AAISYEL 244


>gi|218778356|ref|YP_002429674.1| hypothetical protein Dalk_0499 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759740|gb|ACL02206.1| protein of unknown function DUF558 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 257

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 113/243 (46%), Gaps = 8/243 (3%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
           +R +++       +   +G    +   VLR+ +GD ++L +    E++  I   G     
Sbjct: 5   RRFYIEPEQITGDRAFITGQDAKHAKKVLRLAKGDPVILLDNSGLEYMGVILSAGARDME 64

Query: 68  KVEY--QSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----QNTH 121
                 +  +      +    + IKT+++D +++   E+GM   RP     +    ++  
Sbjct: 65  VEIQDRRLGATESPLKIDLAMAMIKTSKMDKLLKGVTELGMHGWRPFYASRSVPKVKDPE 124

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIY-PPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              DR +     A +QC+ + LP ++ P +  E    + +++  +VF +++      + +
Sbjct: 125 DRRDRWKKIAAEAVKQCERVRLPDVHAPVSFEELCAISAEYDLGVVFWEKSRTPFQQVLQ 184

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
               +   +V ++IGPEGG+   E   L     V    LGPRILR++TAA+A+ AL+QA 
Sbjct: 185 SRLDSPPKSVLVVIGPEGGFEDHETARLEESGMVHA-GLGPRILRAETAALASCALIQAG 243

Query: 241 CGD 243
            GD
Sbjct: 244 FGD 246


>gi|154482579|ref|ZP_02025027.1| hypothetical protein EUBVEN_00246 [Eubacterium ventriosum ATCC
           27560]
 gi|149736604|gb|EDM52490.1| hypothetical protein EUBVEN_00246 [Eubacterium ventriosum ATCC
           27560]
          Length = 245

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 107/243 (44%), Gaps = 10/243 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV      +      G   +++ +VLRMK+G+ IL+ +G+D E++  I  +     
Sbjct: 1   MYRFFVKKDQIQEDAVIIIGSDVNHIKNVLRMKKGETILISDGEDREYVCTIDELENEQV 60

Query: 67  FKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                     ++     V    +  K ++++ +IQK +E+G   I PV T+         
Sbjct: 61  RAKIEDVNGVAKELPIKVTLFQALPKGDKMETVIQKMIELGAYEIVPVFTKRCIVKLDNK 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKN-WDHNCQIVFADETCGSENS 177
                  R  +   SAA+Q     +P +  P T +  LK     +  ++  +      ++
Sbjct: 121 KAVSKTKRWNSIAESAAKQSKRGIIPKVSMPVTYKEALKMAEAMDMVLIPYENAENMAHT 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            + +  I     V I IGPEGG+  EE E   +      ++LG RILR++TA +A M+++
Sbjct: 181 RQVVSQIKTGMTVGIFIGPEGGFAEEEVEQAINTG-AYDITLGKRILRTETAGMALMSVL 239

Query: 238 QAI 240
              
Sbjct: 240 MFE 242


>gi|284801857|ref|YP_003413722.1| hypothetical protein LM5578_1612 [Listeria monocytogenes 08-5578]
 gi|284994999|ref|YP_003416767.1| hypothetical protein LM5923_1564 [Listeria monocytogenes 08-5923]
 gi|284057419|gb|ADB68360.1| hypothetical protein LM5578_1612 [Listeria monocytogenes 08-5578]
 gi|284060466|gb|ADB71405.1| hypothetical protein LM5923_1564 [Listeria monocytogenes 08-5923]
          Length = 255

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 101/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVTSELENDNDTLAITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTIIPEVHYAASFKELMFDHVHYDFVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALANLFQTMKPGQSVLCVFGPEGGISEKELMQLQEVN-AKLAGLGPRILRTETAPLYC 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|50085384|ref|YP_046894.1| hypothetical protein ACIAD2284 [Acinetobacter sp. ADP1]
 gi|49531360|emb|CAG69072.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 243

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 105/244 (43%), Gaps = 16/244 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L + T    +   +H+   VLR +  D  + FNG+ GE+   +  + K   
Sbjct: 1   MNRFYIEADLSVNTDTLLTESVFHHWVRVLRAQVNDCAIFFNGQGGEYQVTLQEINKKNA 60

Query: 67  FKVEYQSRSQTKQSDV--QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
                Q     +             K +R+DY IQK+ E+G+  I+ + +   +      
Sbjct: 61  TVSIDQFNPVDRTPAFKAILGQVMSKGDRMDYAIQKATELGVSKIQLLTSERCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWD-HNCQIVFADETCGSENS 177
                +D  ++  I+A EQC +  +P I PP +L   +      N ++V A E       
Sbjct: 121 RDQKKIDHWQSIAIAACEQCGMNRVPEILPPVSLNEWINTATLPNTKLVLAPEKEQQNVL 180

Query: 178 LEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
                       +A+LIGPEGG    E    ++  F+    +G R+LR++TA V A++++
Sbjct: 181 KNA------QSELALLIGPEGGLSENEIIAANNKGFIN-WCIGERVLRTETAPVVALSIL 233

Query: 238 QAIC 241
               
Sbjct: 234 NYRF 237


>gi|86139068|ref|ZP_01057639.1| hypothetical protein MED193_10953 [Roseobacter sp. MED193]
 gi|85824299|gb|EAQ44503.1| hypothetical protein MED193_10953 [Roseobacter sp. MED193]
          Length = 259

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 126/257 (49%), Gaps = 30/257 (11%)

Query: 18  IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI-RFKVEYQSRSQ 76
                    +Q HYL  V+R + G  + LFNG DGEW ++++  GK         QS++ 
Sbjct: 3   AGQSIPLEKEQAHYLFGVMRQRLGGAVALFNGFDGEWQAEVTEAGKRGGTLTCVAQSKTL 62

Query: 77  TKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAE 136
               D+  IF+PIK  R D++++K+ EMG   I PV T YT +     DR++ + + AAE
Sbjct: 63  QMPPDLWLIFAPIKKARTDFIVEKAAEMGAARILPVGTDYTNSERIRQDRLQAHAVEAAE 122

Query: 137 QCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPN------- 189
           QC    +P +     L  LL +W    Q++F DE    +    ++   +  P        
Sbjct: 123 QCGGTYVPEVCDLQKLSQLLDHWPDERQLMFCDEAEVGQRRFLEVARGSAGPEGGREAPA 182

Query: 190 ----------------------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSD 227
                                  AILIGPEGG+  +E++ LH++     +SLGPRILR+D
Sbjct: 183 LGGGTGADRSASEPFGKLSLQPWAILIGPEGGFSDKERKRLHAMAQAHVVSLGPRILRAD 242

Query: 228 TAAVAAMALVQAICGDW 244
           TAAVAAM L Q   GDW
Sbjct: 243 TAAVAAMTLWQQTLGDW 259


>gi|319787981|ref|YP_004147456.1| hypothetical protein Psesu_2392 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466493|gb|ADV28225.1| protein of unknown function DUF558 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 112/247 (45%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             L R  V+ PL   +         ++L  VLR++EG++ +LFNG   ++ ++++ V K 
Sbjct: 1   MRLTRCHVELPLQPGSTITLPEHAANHLVRVLRLREGESCVLFNGDGHDYAARLASVTKR 60

Query: 65  IR--FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT-- 120
                 +   +        +  +    +  ++D ++QK+ E+G+ AI PV    T+    
Sbjct: 61  EVSAEVLSATAVDNESPLRIVLLQGIARGEKMDLILQKATELGVAAIVPVNGERTEVRLD 120

Query: 121 ----HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  +   R+   SA EQ     +P + PP +LE        +   +  D     + 
Sbjct: 121 AERAQKRLAHWRSVVESACEQSGRARVPEVQPPASLETAAATLPGDALRLLLD----PQG 176

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                        V + IGPEGG+   +++ L +  F + L LGPR+LR++TA +AA+A 
Sbjct: 177 EHRLASMQPDASTVVVAIGPEGGWSPRDRQALQAAGF-SGLRLGPRVLRTETAGLAAIAA 235

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 236 LQARFGD 242


>gi|290894231|ref|ZP_06557200.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290556228|gb|EFD89773.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 255

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 101/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVTNELENDNDTLSITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVIPEVHYAASFKELMFDHVHYDYVITAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALASLFQTMKPGQSVLCIFGPEGGISEKELLHLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|288555682|ref|YP_003427617.1| RNA methyltransferase, RsmE [Bacillus pseudofirmus OF4]
 gi|288546842|gb|ADC50725.1| RNA methyltransferase, RsmE [Bacillus pseudofirmus OF4]
          Length = 250

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 101/247 (40%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R FV       +    +GD   ++A V+RM+EG+ I++ N      L+K+  + +S  
Sbjct: 1   MQRYFVSEDQLNGSIVTITGDDVKHIARVMRMQEGEEIIVSNNAGRTVLAKLKKLSESDI 60

Query: 67  --FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN- 123
               +E           V       K ++L+ + QK  E+G+   +P     +       
Sbjct: 61  QAEVLEELDPKTELPIKVTVAQGLPKGDKLELITQKGTELGVSCFQPFQASRSIVKWDMK 120

Query: 124 -----MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
                ++R+      AAEQ     +P I    +   LL+  +     + A E        
Sbjct: 121 KAKKKVERLEKIAKEAAEQSYREIIPTIKEAASFTQLLETIESYTHTIVAYEESAKTGEA 180

Query: 176 -NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            N    L+ +    +V I+IGPEGG   EE   L     V    LGPRI+R++TA +  M
Sbjct: 181 SNLHNVLNQVKSGDSVLIVIGPEGGLTEEEVSALEGKGAVL-CGLGPRIIRTETAPLYVM 239

Query: 235 ALVQAIC 241
           A +    
Sbjct: 240 AAISYHL 246


>gi|262372152|ref|ZP_06065431.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262312177|gb|EEY93262.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 239

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 110/243 (45%), Gaps = 15/243 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R +++  L      + +   +H+   VLR K  +  + FNGK GE+   ++ + K   
Sbjct: 1   MNRFYIETELNTGNTIELTESVFHHWVRVLRAKVQEKAIFFNGKGGEYRVTLTEINKKNA 60

Query: 67  FKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
           F     +++  +T    V       K +R+DY IQK+ E+G+  I+ + +   +      
Sbjct: 61  FVSVDHFEAIDRTAPFKVILGQVMSKGDRMDYAIQKATELGVTTIQLLTSDRCEMRLKYD 120

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                +D  ++  ++A EQC +  +P +  P ++E  ++      + V A         L
Sbjct: 121 RDQKKLDHWQSVAVAACEQCGMNIVPKVLAPISIEEWIQTDLPISRFVMAPNKDQKNVLL 180

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           +        P +A+LIGPEGG    E    +   FV    +G R+LR++TA V A++++ 
Sbjct: 181 DA------QPELALLIGPEGGLSESEIRLSNQHGFVN-WCIGDRVLRTETAPVVALSILN 233

Query: 239 AIC 241
              
Sbjct: 234 YHF 236


>gi|92118652|ref|YP_578381.1| 16S ribosomal RNA methyltransferase RsmE [Nitrobacter hamburgensis
           X14]
 gi|91801546|gb|ABE63921.1| protein of unknown function DUF558 [Nitrobacter hamburgensis X14]
          Length = 261

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               RL+VD PL    +     +Q +YL +VLR+  G N+L+FNG+DGEW + IS   + 
Sbjct: 6   FRSPRLYVDAPLEPGGKVPLDRNQGNYLGNVLRLGSGANVLVFNGRDGEWRAAISGRKRP 65

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               +   +R+Q +  D+ Y+F+P+K  RLDYM+QK+VEMG+ A++PV+TR+TQ    N 
Sbjct: 66  ECLDIVAAARAQDRLPDLHYVFAPLKHARLDYMVQKAVEMGVSALQPVLTRFTQVARVNG 125

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           +R+R   I AAEQC IL+L  +  P TL+  L        +V  DE     N    L  +
Sbjct: 126 ERMRANVIEAAEQCGILSLAAVEEPVTLDRWLGRRAPERLLVLCDEAALVTNPAAALEPM 185

Query: 185 AH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243
                 + +L+GPEGG+  +E+  L + P    LSLGPRILR+DTAAVAA+ALVQ + GD
Sbjct: 186 RGAAHGIDVLVGPEGGFAEDERANLLNQPNTLRLSLGPRILRADTAAVAAIALVQTVLGD 245

Query: 244 W 244
           W
Sbjct: 246 W 246


>gi|332878544|ref|ZP_08446264.1| RNA methyltransferase, RsmE family [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683445|gb|EGJ56322.1| RNA methyltransferase, RsmE family [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 242

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 98/230 (42%), Gaps = 3/230 (1%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++  +        +      ++  ++A VLR K+GD + + NGK   +  ++S+      
Sbjct: 1   MQLFYHPNIDKNTSNCFFDKEESQHIAKVLRKKQGDTLHITNGKGFLFEGQLSFASPKQC 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNM 124
               ++ Q +          +       R ++ ++K+ E+G+  I P+I ++++ T   +
Sbjct: 61  EVSILKCQEQIHRPYHLHLVVAPTKMNERYEWFLEKATEIGIDEITPIICQHSERTSLKL 120

Query: 125 DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAI 184
           +R     +SA +Q     LP +  P T     K    +    +      +E  L      
Sbjct: 121 ERFEKIILSAMKQSLQCYLPTLNSPITSAAFFKQMMTDTSDKYIAHCQENEKILLSNALT 180

Query: 185 AHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
                + ILIGPEG +  EE  T  +  F  P+SLG   LR++TAA+ A 
Sbjct: 181 PLSERITILIGPEGDFSEEEISTAIAQGF-RPISLGDTRLRTETAAIVAC 229


>gi|320355424|ref|YP_004196763.1| hypothetical protein Despr_3346 [Desulfobulbus propionicus DSM
           2032]
 gi|320123926|gb|ADW19472.1| protein of unknown function DUF558 [Desulfobulbus propionicus DSM
           2032]
          Length = 260

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 93/241 (38%), Gaps = 10/241 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           ++R F           + SG +  ++A VLR+K G  + LF+G+     + +  VGK   
Sbjct: 1   MRRFFFPHHAHSGDLIELSGAEARHIASVLRLKPGQAVELFDGQGQVCAAVLQTVGKHQV 60

Query: 67  FKVEYQSRSQTKQSDVQYIFSPI-----KTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
                  R++     V    +       K + L     +        +         +  
Sbjct: 61  TARVTAIRNERPAVSVPLTLAQCLLKGKKMDLLVQKATELGAQAFMPVVSAYCENHGDRD 120

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL 181
           +  +R +   I A +QC       I P   L+        +    +  E      +    
Sbjct: 121 HQRERWQRIMIEACKQCHRSNPMAILPVARLDQADFTPYDHRLAAWEGE----RQAALPT 176

Query: 182 HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAIC 241
             I H   + + +GPEGG H ++   L    F TP SLG  ILR +TAA+AA+++VQ + 
Sbjct: 177 RFIDHPGPLCLFLGPEGGLHDDDLRLLTQWSF-TPFSLGRHILRGETAALAALSIVQYLS 235

Query: 242 G 242
           G
Sbjct: 236 G 236


>gi|291557449|emb|CBL34566.1| RNA methyltransferase, RsmE family [Eubacterium siraeum V10Sc8a]
          Length = 257

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 6   HLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
              R F D           + +   ++A VLRM++GD  ++ +    ++L ++S      
Sbjct: 15  RYPRFFSDTIDENDRIIYMNDEDSKHIAQVLRMRKGDKAIICDKNGHDYLCELSSADNKN 74

Query: 66  RFK---VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
             +   ++ +  S     ++    +  K ++LD+++QK+ E+G   I P +++   +   
Sbjct: 75  SVEFAILDKKDNSAEPDIEITLYQAIPKNDKLDFIVQKATELGAVRIVPFMSKRCVSRPD 134

Query: 123 ------NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + R++     A++QC    +P + P T  +  + + D +   +   E  G + 
Sbjct: 135 AKSADKKVQRLQRIAYEASKQCGRGKIPGVMPFTDFKSAVNSIDSDTLPIIFYECGGKKL 194

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S   L        +A+ IG EGG+  EE +   S    T + LG RILR +TA VAA+A+
Sbjct: 195 SELDLS----YKKIAVFIGSEGGFEKEEVDYALSKG-ATAVHLGERILRCETAPVAALAV 249

Query: 237 VQAICGD 243
           +  + G+
Sbjct: 250 LMNLTGN 256


>gi|283796176|ref|ZP_06345329.1| RNA methyltransferase, RsmE family [Clostridium sp. M62/1]
 gi|291076395|gb|EFE13759.1| RNA methyltransferase, RsmE family [Clostridium sp. M62/1]
 gi|295115547|emb|CBL36394.1| RNA methyltransferase, RsmE family [butyrate-producing bacterium
           SM4/1]
          Length = 247

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 105/244 (43%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FVD           +G   +++ +VLRMK G+ +L+ NG+D ++L ++S +     
Sbjct: 1   MYHFFVDRSQIHPEHITITGPDVNHIRNVLRMKTGEQVLISNGEDRDYLCRLSRIDPDEV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQ 118
               +  +  +    + V       K ++++ +IQK+VE+G   I PV ++        +
Sbjct: 61  EAEIIREKEETTELPARVCLFQGLPKGDKMELIIQKAVELGAYQIIPVASKRAVVKLDKK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                + R    + SAA+Q     +P I P       L             E      ++
Sbjct: 121 KEEAKLRRWNAISESAAKQSKRRIIPQIAPVMEFREALSAVSGFDLACIPYECESGMEAV 180

Query: 179 EKLHAIAH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            K    A     +A+ IGPEGG+   E E       V P+SLG RILR++TA +  ++++
Sbjct: 181 RKFVGQADAGQRIAVFIGPEGGFEEAEVEAAVQAG-VVPVSLGKRILRTETAGLCMLSVL 239

Query: 238 QAIC 241
               
Sbjct: 240 AFKL 243


>gi|83589451|ref|YP_429460.1| hypothetical protein Moth_0587 [Moorella thermoacetica ATCC 39073]
 gi|83572365|gb|ABC18917.1| conserved hypothetical protein [Moorella thermoacetica ATCC 39073]
          Length = 246

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/243 (22%), Positives = 102/243 (41%), Gaps = 8/243 (3%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR- 66
              F+   +         G+  H+   VLR+++G++I L +     + ++I  + +    
Sbjct: 3   HHFFLPIVVAPGETVLLEGENAHHAIRVLRLRQGESITLADSNGQGYRAEIVAITEGRVA 62

Query: 67  FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------TQNT 120
             ++    S   +  V       K +++D +I+K  E+G+  I  + T         Q  
Sbjct: 63  AAIKDPLDSPEPRVRVTLYQGWPKGDKMDLIIEKCTELGVDRIVVLATERSIPRPDQQTC 122

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
               +R +    +AA Q     +P +  P  L   L     +  ++   E   + +    
Sbjct: 123 ARRRERWQQKAHAAARQSRRHRIPVVDGPLGLAEALVKLRPDTLLLVPWEEERTRDLKSI 182

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
           L  +     +A+LIGPEGG    E +       + PL+LGPRILR++TA +A +A +   
Sbjct: 183 LATVPADRELALLIGPEGGLSRAEVDLACRFGGL-PLTLGPRILRTETAGLACLAAIMYA 241

Query: 241 CGD 243
            G+
Sbjct: 242 MGE 244


>gi|46907698|ref|YP_014087.1| 16S ribosomal RNA methyltransferase RsmE [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47093476|ref|ZP_00231239.1| conserved hypothetical protein TIGR00046 [Listeria monocytogenes
           str. 4b H7858]
 gi|226224071|ref|YP_002758178.1| hypothetical protein Lm4b_01480 [Listeria monocytogenes Clip81459]
 gi|254824471|ref|ZP_05229472.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254932655|ref|ZP_05266014.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|254991899|ref|ZP_05274089.1| 16S ribosomal RNA methyltransferase RsmE [Listeria monocytogenes
           FSL J2-064]
 gi|46880967|gb|AAT04264.1| conserved hypothetical protein TIGR00046 [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47018152|gb|EAL08922.1| conserved hypothetical protein TIGR00046 [Listeria monocytogenes
           str. 4b H7858]
 gi|225876533|emb|CAS05242.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|293584214|gb|EFF96246.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293593708|gb|EFG01469.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|328465513|gb|EGF36742.1| 16S ribosomal RNA methyltransferase RsmE [Listeria monocytogenes
           1816]
 gi|332311912|gb|EGJ25007.1| Protein YqeU [Listeria monocytogenes str. Scott A]
          Length = 255

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 100/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++  V+RMKE D + +        ++ I+ +    
Sbjct: 1   MQRYFVTNELENDNETLSITGENFHHITRVMRMKESDQVFIVFPSKKTCIAAITAINDDE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
            F   V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VFLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTIIPEVHYAASFKELMFDHVHYDFVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALANLFQTMKPGQSVLCVFGPEGGISEKELMQLQEVN-AKLAGLGPRILRTETAPLYC 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|309783107|ref|ZP_07677826.1| RNA methyltransferase, RsmE family [Ralstonia sp. 5_7_47FAA]
 gi|308918215|gb|EFP63893.1| RNA methyltransferase, RsmE family [Ralstonia sp. 5_7_47FAA]
          Length = 249

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           L R FVD PL   T          ++ HVLR+  GD++ LF+G   E+ +++  + K   
Sbjct: 3   LPRFFVDTPLAPNTTVTLPEAVTRHI-HVLRLAVGDDVCLFDGSGHEFRARLDAINKRDA 61

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------Q 118
                +        +  +         +++D++I+K+VE+G+ A+ P+ T         +
Sbjct: 62  TASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVNAVAPLQTERAVVRLSGE 121

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE--- 175
                +   +    +A EQC    +P + P +TL   L                G++   
Sbjct: 122 RAAKRVQHWQALVQAACEQCGRARVPAVAPVSTLREWLAAARSTDAPRVLLSPRGTQSLT 181

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
               +         + +LIGPEGG   +E+    S  F+ PL+LG RILR+++AA+ A++
Sbjct: 182 QWAVQSRTRIEGSGIVLLIGPEGGLSPDEEALAESAGFL-PLTLGRRILRTESAALVAVS 240

Query: 236 LVQAICGDW 244
            + A+ G++
Sbjct: 241 ALHAVLGEF 249


>gi|150015721|ref|YP_001307975.1| 16S ribosomal RNA methyltransferase RsmE [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902186|gb|ABR33019.1| protein of unknown function DUF558 [Clostridium beijerinckii NCIMB
           8052]
          Length = 255

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 14/250 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + + F +     +T+GK  GD   ++  VLR+ EG+ ++L N +  E+L +I  + KS  
Sbjct: 1   MHKFFTEPHNISETEGKILGDDVKHIYKVLRLSEGEEVVLNNCEGIEYLGEIETITKSEV 60

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               ++    +   +  V       K  ++D ++QK  E+G+    PV T          
Sbjct: 61  IVKIIKRLDINNESKVKVHLFQGLPKGQKMDLIVQKGTELGVSEFIPVTTARVDVKLKGE 120

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +DR+    + A +Q     +P +         +        I+   E          
Sbjct: 121 FKKLDRLNRIALEACKQSKRSVIPQVKEVIDFNEAINELKKMDLIIVPYENAEDFGIKTL 180

Query: 181 LHAIAH-------IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           +  +         I NV ILIGPEGG+   E + L        ++LG RILR++TA   A
Sbjct: 181 VRKLERDSVDLDTINNVGILIGPEGGFEESEIDDLKEQG-AYIVTLGNRILRTETAGFTA 239

Query: 234 MALVQAICGD 243
            AL+Q   GD
Sbjct: 240 TALIQYELGD 249


>gi|94311915|ref|YP_585125.1| 16S ribosomal RNA methyltransferase RsmE [Cupriavidus metallidurans
           CH34]
 gi|93355767|gb|ABF09856.1| conserved hypothetical protein DUF558 [Cupriavidus metallidurans
           CH34]
          Length = 247

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 108/247 (43%), Gaps = 12/247 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R FVD  L   T  +       ++  VLR+  GD I LFNG+ G   + ++ +GK    
Sbjct: 3   PRFFVDAALAADTVLELPDAVVRHV-QVLRLAPGDAITLFNGQGGSHPATLTEIGKRHAS 61

Query: 68  KV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
                + +        V         +++D++I+K+VE+G+ AI+P+    +      + 
Sbjct: 62  ATLGTHDASEAETPFAVTLAQGLAGGDKMDWLIEKAVELGVSAIQPLQAARSVVRLSGER 121

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSL 178
                   +    +A EQC    LP + P      +L        ++  +     S   L
Sbjct: 122 ATKRQAHWQALIEAACEQCGRNRLPALAPVANLESWLTSVPATAARLALSPRASASLPEL 181

Query: 179 EKLHAIAH-IPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALV 237
            +    A     V +LIGPEGG   EE++      F+  +SLGPRILR++TA +  +A +
Sbjct: 182 AQAEREAWRAGGVTLLIGPEGGLSPEEEDRARRAGFI-GVSLGPRILRTETAGLTCLATL 240

Query: 238 QAICGDW 244
            AI G +
Sbjct: 241 NAILGGF 247


>gi|254281685|ref|ZP_04956653.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR51-B]
 gi|219677888|gb|EED34237.1| PAS/PAC sensor signal transduction histidine kinase [gamma
           proteobacterium NOR51-B]
          Length = 242

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 65/247 (26%), Positives = 106/247 (42%), Gaps = 16/247 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
               R+F D PL    +     +   ++  VLR+  G  + +FNG   ++ + I+ V K 
Sbjct: 1   MRTPRIFADLPLAQGAEFTLPDNASLHIGRVLRLDSGQPLTVFNGDGEDYHATITTVTKR 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
                 +   +   T   +V+   +  K +R D+ +QK+ E+G+  I P+++        
Sbjct: 61  SVSIEVHSVATNGTTSPLEVELGLALSKGDRFDWAVQKATELGVAHITPLVSERVEVRLN 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            Q             ISA EQC   TL  +  PT L   L+  +   ++V    +     
Sbjct: 121 PQREEKKRTHWHNIVISACEQCGRSTLAGVSSPTQLRPWLERVEAPLKLVLDHRSAT--- 177

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
                        VA+LIGPEGG    E E   +  F   L LGPR+LR++TA V A+++
Sbjct: 178 ----ALPEEKPDRVALLIGPEGGLTESELELAEASGF-QRLQLGPRVLRTETAPVVALSV 232

Query: 237 VQAICGD 243
           +    GD
Sbjct: 233 LGNRWGD 239


>gi|126700066|ref|YP_001088963.1| hypothetical protein CD2449 [Clostridium difficile 630]
 gi|254976043|ref|ZP_05272515.1| hypothetical protein CdifQC_12049 [Clostridium difficile QCD-66c26]
 gi|255093431|ref|ZP_05322909.1| hypothetical protein CdifC_12334 [Clostridium difficile CIP 107932]
 gi|255101609|ref|ZP_05330586.1| hypothetical protein CdifQCD-6_12419 [Clostridium difficile
           QCD-63q42]
 gi|255307478|ref|ZP_05351649.1| hypothetical protein CdifA_12867 [Clostridium difficile ATCC 43255]
 gi|255315176|ref|ZP_05356759.1| hypothetical protein CdifQCD-7_12527 [Clostridium difficile
           QCD-76w55]
 gi|255517845|ref|ZP_05385521.1| hypothetical protein CdifQCD-_12086 [Clostridium difficile
           QCD-97b34]
 gi|255650961|ref|ZP_05397863.1| hypothetical protein CdifQCD_12291 [Clostridium difficile
           QCD-37x79]
 gi|260684030|ref|YP_003215315.1| hypothetical protein CD196_2295 [Clostridium difficile CD196]
 gi|260687690|ref|YP_003218824.1| hypothetical protein CDR20291_2342 [Clostridium difficile R20291]
 gi|115251503|emb|CAJ69336.1| putative methyltransferase [Clostridium difficile]
 gi|260210193|emb|CBA64400.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260213707|emb|CBE05588.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 252

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 106/248 (42%), Gaps = 12/248 (4%)

Query: 7   LKRLFVDFPLC--IKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           + R FV+              G+   +++ VLR K G+ + + +  + E++ +I  + KS
Sbjct: 1   MDRFFVEKNNINLQDKTCTIEGEDVKHISKVLRCKLGEKLEICDKNNNEYICEIMNIDKS 60

Query: 65  IR--FKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           I     +E    ++  +  V+      K  +++ ++QK  E+G+  I  V T+ +     
Sbjct: 61  IVNLEILEKVDINRESELKVRLYQGLPKAPKMEMILQKLTEVGVEEIILVQTKRSVVKVD 120

Query: 123 NM------DRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           +       +R       AA+Q     +P +    + +  L++   N   +   E   + +
Sbjct: 121 DKKEDKKFERWERIIYEAAKQSKRGKIPKLRGVLSFKEALEDMKKNNVNICPYENERTVS 180

Query: 177 SLEKLHAIAHI-PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
               L        +V I IGPEGG+  EE E +        +SLGPRILR++TA+V A  
Sbjct: 181 IKHALKKCDSNIDSVGIFIGPEGGFSEEEIEQI-QKNNCNVVSLGPRILRTETASVVAST 239

Query: 236 LVQAICGD 243
           +      D
Sbjct: 240 IALYELSD 247


>gi|15836795|ref|NP_297483.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa 9a5c]
 gi|9104989|gb|AAF83003.1|AE003872_14 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 244

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 113/247 (45%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++     +
Sbjct: 1   MRLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRR 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
               ++E  S    +    +  + +  +  ++D + QK+ E+G+ AI PV T        
Sbjct: 61  EAWARIEGVSEVCNESPLAITLVQAIARGEKMDLIAQKATELGVVAIVPVDTERSGVRLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++     +       ISA EQC    +P +  P  L+ L +    +   +  D       
Sbjct: 121 SERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQALPEILHPDTLRLILDPKSEHRL 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S     +      V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+A+
Sbjct: 181 ST---LSRLTPVAVTIAIGPEGGWSPRDLEILKDAGFI-GFSLGPRILRTETAGLTAIAV 236

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 237 LQAQLGD 243


>gi|71275479|ref|ZP_00651765.1| Conserved hypothetical protein 46 [Xylella fastidiosa Dixon]
 gi|71900654|ref|ZP_00682779.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|170729396|ref|YP_001774829.1| 16S ribosomal RNA methyltransferase RsmE [Xylella fastidiosa M12]
 gi|71163779|gb|EAO13495.1| Conserved hypothetical protein 46 [Xylella fastidiosa Dixon]
 gi|71729589|gb|EAO31695.1| Conserved hypothetical protein 46 [Xylella fastidiosa Ann-1]
 gi|167964189|gb|ACA11199.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 244

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 115/247 (46%), Gaps = 12/247 (4%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             L R  V+ PL +  +        ++L  VLR+ EGD  +LFNG   ++L+++     +
Sbjct: 1   MRLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDGHDYLARLIATGRR 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
               ++E  S    +    +  + +  +  ++D ++QK+ E+G+ AI PV T        
Sbjct: 61  EAWARIEGVSEVCNESPLAITLVQAIARGEKMDLIVQKATELGVVAIVPVDTERSGVRLD 120

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
           ++     +       +SA EQC    +P +  P  L+ L +  D +   +  D       
Sbjct: 121 SERVAKRLAHWNNVVVSACEQCGRTRVPEVQMPRALQALPEILDPDTLRLILDPKSEHRL 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           S     +      V I IGPEGG+   + E L    F+   SLGPRILR++TA + A+A+
Sbjct: 181 ST---LSRLTPVAVTIAIGPEGGWSPRDLEILKDAGFI-GFSLGPRILRTETAGLTAIAV 236

Query: 237 VQAICGD 243
           +QA  GD
Sbjct: 237 LQAQLGD 243


>gi|284048078|ref|YP_003398417.1| protein of unknown function DUF558 [Acidaminococcus fermentans DSM
           20731]
 gi|283952299|gb|ADB47102.1| protein of unknown function DUF558 [Acidaminococcus fermentans DSM
           20731]
          Length = 244

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 103/245 (42%), Gaps = 12/245 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLF--NGKDGEWLSKISYVGKS 64
           + R FV             G   H++ HVLRMK G+ + +   +              + 
Sbjct: 1   MYRFFVPRDF--GETMSIDGQDAHHITHVLRMKLGEQLQIVSLDQVAAVMKITGFGENRV 58

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
               VE   +S      V  I    K ++L+++IQK++E+G+  IRP I  ++       
Sbjct: 59  DLALVETLEKSHEPSVKVTLIQGLPKQDKLEWVIQKAIELGVTEIRPAIMDHSVVKVDPA 118

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                 +R +    +AA+Q     +P +  P     ++       +I  A E   +    
Sbjct: 119 KAAKKQERWQKIAEAAAKQSKRDIIPQVALPAKFRDIVTQCPAELKI-VAYEVEDTRGIR 177

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           E L A      +A LIGPEGG   +E      L +   +SLGPRI+R++TAA+A +  + 
Sbjct: 178 EVLAAHKDARTIAFLIGPEGGISKDEFALTQELGW-HSVSLGPRIMRTETAALATLTAIM 236

Query: 239 AICGD 243
              G+
Sbjct: 237 YETGN 241


>gi|313608746|gb|EFR84566.1| ribosomal RNA small subunit methyltransferase E [Listeria
           monocytogenes FSL F2-208]
          Length = 255

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 100/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++A V+RMKE D + +        ++ I+ + +  
Sbjct: 1   MQRYFVTNELENDNDTLSITGENFHHIARVMRMKESDQVFIVFPSKKTCIAAITAINEEE 60

Query: 66  RF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++         ++       K ++L+ +IQKS E+G           +      
Sbjct: 61  VLLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFITYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVIPEVHYAASFKELMFDHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALASLFQTMKPGQSVLCIFGPEGGISEKELLHLQEVN-AKLAGLGPRILRTETAPLYV 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|254852095|ref|ZP_05241443.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300765613|ref|ZP_07075592.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|258605395|gb|EEW18003.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300513714|gb|EFK40782.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
          Length = 255

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 100/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++  V+RMKE D + +        ++ I+ +    
Sbjct: 1   MQRYFVTNELENDNETLSITGENFHHITRVMRMKESDQVFIVFPSKKTCIAAITAINDDE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
            F   V++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VFLNLVKWLKEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTIIPEVHYAASFKELMFDHVHYDFVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALANLFQTMKPGQSVLCVFGPEGGISEKELMQLQEVN-AKLAGLGPRILRTETAPLYC 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|254827758|ref|ZP_05232445.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258600138|gb|EEW13463.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
          Length = 255

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 100/248 (40%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++  V+RMKE D + +        ++ I+ +    
Sbjct: 1   MQRYFVTNELENDNDTLSITGENFHHITRVMRMKESDQVFIVFPSKKTCIAAITAINDDE 60

Query: 66  RF--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
            F   +++         ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VFLNVLKWLEEDTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTIIPEVHYAASFKELMFDHVHYDFVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALANLFQTMKPGQSVLCVFGPEGGISEKELMQLQEVN-AKLAGLGPRILRTETAPLYC 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|328474981|gb|EGF45775.1| 16S ribosomal RNA methyltransferase RsmE [Listeria monocytogenes
           220]
          Length = 255

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 99/248 (39%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPL-CIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++  V+RMKE D + +        ++ I+ +    
Sbjct: 1   MQRYFVTNELENDNETLSITGENFHHITRVMRMKESDQVFIVFPSKKTCIAAITAINDDE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
            F   V++         ++       K ++L+ +IQK  E+G     P     +      
Sbjct: 61  VFLNLVKWLEEDTELPIEITIASGLPKGDKLELIIQKRTELGAHKFIPYKAERSVVKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P ++   + + L+ +  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTIIPEVHYAASFKELMFDHVHYDFVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L  +       LGPRILR++TA +  
Sbjct: 181 DSALANLFQTMKPGQSVLCVFGPEGGISEKELMQLQEVN-AKLAGLGPRILRTETAPLYC 239

Query: 234 MALVQAIC 241
           ++      
Sbjct: 240 LSAASFYF 247


>gi|194017737|ref|ZP_03056347.1| protein YqeU [Bacillus pumilus ATCC 7061]
 gi|194010637|gb|EDW20209.1| protein YqeU [Bacillus pumilus ATCC 7061]
          Length = 256

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 64/249 (25%), Positives = 105/249 (42%), Gaps = 16/249 (6%)

Query: 7   LKRLFVD---FPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
           ++R F+D     +  K     +G+  H+L++V+RMK G  IL       E LSKI  + K
Sbjct: 1   MQRYFIDLTKEEVIAKGSIVINGEDVHHLSNVMRMKAGQEILCLTTDGFEGLSKIDTITK 60

Query: 64  SIRFKVE--YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY----- 116
                    + ++ +     V       K ++L+ +IQK  E+G  A  P          
Sbjct: 61  EEVICHVEGWTNQDRELPVRVTIASGLPKGDKLELIIQKGTELGASAFIPFQAARSITKI 120

Query: 117 -TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             + +H   +R       AAEQ     +P + P +T + L +      + V A E    E
Sbjct: 121 DQKKSHKKRERWEKIAKEAAEQSYRNIIPRVDPVSTFKELTQLAGEFDKCVVAYEESSKE 180

Query: 176 ----NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAV 231
                    L  +     + ++ GPEGG   +E E L +   V    LGPRILR++TA +
Sbjct: 181 GEQSRFQTVLQQMKGGQTLLVVFGPEGGLAEKEIEALETHGAV-ICGLGPRILRTETAPL 239

Query: 232 AAMALVQAI 240
            A++ +   
Sbjct: 240 YALSAISYQ 248


>gi|186681306|ref|YP_001864502.1| 16S ribosomal RNA methyltransferase RsmE [Nostoc punctiforme PCC
           73102]
 gi|186463758|gb|ACC79559.1| protein of unknown function DUF558 [Nostoc punctiforme PCC 73102]
          Length = 249

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 109/251 (43%), Gaps = 17/251 (6%)

Query: 4   HSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
            S L+R+ +      + Q   + +Q HYL  VLR++EGD  +  +GK   WL++++    
Sbjct: 1   MSQLQRIAIAPSQFQQGQILLTKEQQHYLGRVLRLREGDRFIAMDGKGKWWLAQLAGEQA 60

Query: 64  SIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--QNTH 121
                +E           +  + +  K N  D +++   E+G+  I PV++  T    + 
Sbjct: 61  Q---VLESLLVETELPVSITLMVALPKGNGFDEVVRCCTELGVTCIAPVLSDRTLLDPSP 117

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTTLEF-----LLKNWDHNCQIVFADETCGSEN 176
             ++R R     AAEQ +   +P I  P          +      N Q    +      +
Sbjct: 118 QKLERWRRIAAEAAEQSERSFVPTILEPVAFNTGLSLVIGHLSFANSQQYICEARAEFPH 177

Query: 177 SLEKLHAIAHIPN------VAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
               L     + +      + I  GPEGG+ ++E E   +  F  P+SLG RILR+ TA 
Sbjct: 178 LKHCLQHKGQMTSDKGQETIVIATGPEGGWTTQEIENAIASGF-QPVSLGRRILRAVTAP 236

Query: 231 VAAMALVQAIC 241
           V A++L+ A C
Sbjct: 237 VVALSLITASC 247


>gi|62129237|gb|AAX66940.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322716087|gb|EFZ07658.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 259

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 107/247 (43%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 17  MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKK 76

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 77  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 136

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++ F      S N
Sbjct: 137 NERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNFHPRAHASIN 196

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 197 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 250

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 251 LQVRFGD 257


>gi|254467996|ref|ZP_05081402.1| conserved hypothetical protein TIGR00046 [beta proteobacterium
           KB13]
 gi|207086806|gb|EDZ64089.1| conserved hypothetical protein TIGR00046 [beta proteobacterium
           KB13]
          Length = 247

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 109/246 (44%), Gaps = 9/246 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI- 65
           + R +    +   ++   S D   +L   LR+K  D I+LFNG   ++  ++S + K   
Sbjct: 2   MNRFYHPDTISAHSEINLSEDASKHLVKSLRLKPSDKIILFNGDGFDYHGEVSDIDKKNV 61

Query: 66  -RFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY-- 122
                E +  +     D+  + S    ++LD++ QK+ E+G+     + T          
Sbjct: 62  KIAVNEKKHNASEAVIDISILQSVTSRDKLDFIFQKNTELGIKNFYLINTERVNFKIPQS 121

Query: 123 ----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSL 178
                ++ ++   ISA EQ     +P ++        L N D +   +  +       S 
Sbjct: 122 KIENRIEHLKKVVISACEQSGRSKIPTVHETILGLNKLTNEDDHSCKLILNPYTDYSLSN 181

Query: 179 EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
            + + + +  +  ILIGPEGG+   E +   +  F   LSLG R+LR++TA+++  + + 
Sbjct: 182 LRNNDLINKKSFQILIGPEGGFSEAEIKVAENAGF-KSLSLGKRVLRTETASLSIASAIL 240

Query: 239 AICGDW 244
           A+  ++
Sbjct: 241 ALTNNF 246


>gi|260582598|ref|ZP_05850388.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae NT127]
 gi|260094409|gb|EEW78307.1| ribosomal RNA small subunit methyltransferase E [Haemophilus
           influenzae NT127]
          Length = 245

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 112/248 (45%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L  +TQ   S D  +++A VLRM EG+ + LF+  +  + +KI      
Sbjct: 1   MRIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDDSNHIYPAKIIE-SNK 59

Query: 65  IRFKVE---YQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
              KVE    +   +     +       +  R+++ IQKSVE+G+  I P+ +       
Sbjct: 60  KSVKVEILGRELADKESNLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKL 119

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC   ++P I P   L+      D   ++        S 
Sbjct: 120 DAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSI 179

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            +L  + +      V +LIG EGG  ++E        F T + LG R+LR++TA++AA+ 
Sbjct: 180 KTLPSIPS----EGVRLLIGSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAIT 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQICFGD 242


>gi|239627767|ref|ZP_04670798.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239517913|gb|EEQ57779.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 249

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 54/246 (21%), Positives = 107/246 (43%), Gaps = 12/246 (4%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +   FV     +    + +G   +++ + LRMK G+ +L+ +G   ++   +S +     
Sbjct: 1   MHHFFVAPAQVMGDCIRITGPDVNHMKNALRMKPGEEVLISDGTGTDYRCALSSLDSDCV 60

Query: 67  F--KVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITR------YTQ 118
               V      +   S +       K+++++ +IQK+VE+G   I PV T+        +
Sbjct: 61  EARIVSVDRDGRELPSRIWLFQGLPKSDKMELIIQKAVELGAACIVPVSTKNAVVKLDAK 120

Query: 119 NTHYNMDRVRTYTISAAEQCDILTLPFIYPPT---TLEFLLKNWDHNCQIVFADETCGSE 175
                  R +    SAA+Q     +P +            ++      +++  +   G E
Sbjct: 121 KEEAKRKRWQAIAESAAKQSGRSLMPEVMGLMTLGQAFDYIEKEQFALRLIPYEHEAGME 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
            S ++L  +    ++A+ IGPEGG+   E         V P+SLG RILR++TA +A ++
Sbjct: 181 GSRQELSRVGPGQDIAVFIGPEGGFDEAEINLALKKG-VRPVSLGKRILRTETAGLAMLS 239

Query: 236 LVQAIC 241
           ++    
Sbjct: 240 VLMMRL 245


>gi|126663640|ref|ZP_01734636.1| hypothetical protein FBBAL38_11239 [Flavobacteria bacterium BAL38]
 gi|126624223|gb|EAZ94915.1| hypothetical protein FBBAL38_11239 [Flavobacteria bacterium BAL38]
          Length = 234

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 106/231 (45%), Gaps = 8/231 (3%)

Query: 7   LKRLFVDFPLCIKT-QGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKIS-YVGKS 64
           ++ LF +  +           ++  ++  VLR KEGD I + NG    + S+I     K 
Sbjct: 1   MQ-LFYNSEIKQGDSTYFFDKEESKHIVKVLRKKEGDTIFITNGLGFLFESEIILASEKK 59

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSPIKTNRL-DYMIQKSVEMGMGAIRPVITRYTQNTHYN 123
              K+  ++  +          +P K N   ++ ++K+ E+G+  I P+I  +++   Y 
Sbjct: 60  CEVKIAKETFQEPVAFYTHIAVAPTKMNDRLEWFLEKATEIGIDEITPIICDHSERKVYK 119

Query: 124 MDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA 183
           +DR      +A +Q     LP I  PT+L   +K      + +   E    ++   ++  
Sbjct: 120 IDRAEKIIQAAMKQSLHYYLPKINEPTSLSQFVKLNFEGQKFIAHCEETDKKSFKNEI-- 177

Query: 184 IAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
             H   + ILIGPEG + ++E     +  F+ P++LG   LR++TAA+ A 
Sbjct: 178 -KHNEKITILIGPEGDFSTKEINLAIANQFI-PVTLGNTRLRTETAALVAC 226


>gi|302333253|gb|ADL23446.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus JKD6159]
          Length = 250

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDQ 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|323141893|ref|ZP_08076754.1| RNA methyltransferase, RsmE family [Phascolarctobacterium sp. YIT
           12067]
 gi|322413640|gb|EFY04498.1| RNA methyltransferase, RsmE family [Phascolarctobacterium sp. YIT
           12067]
          Length = 247

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 112/247 (45%), Gaps = 13/247 (5%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           + R FV             G    +++ VLRM+ G  + + +      L++IS +     
Sbjct: 1   MHRFFVPQLY--NETMTIEGVDARHISKVLRMQPGAQLQIVSDDGVSALAEISAIDSECV 58

Query: 67  FK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT---- 120
               +E  + S      +       K  +++++IQK+VEMG  ++ PV   ++       
Sbjct: 59  TVHCLEKLAESHEPAVRLILAQGLAKGEKMEFIIQKAVEMGAYSVVPVAMEHSVVRLDGA 118

Query: 121 --HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQI--VFADETCGSEN 176
                ++R +    SAA+Q     +P + P  T+  +L   D   +I     ++    + 
Sbjct: 119 KAAKKVERWQKIAESAAKQSKRDIIPEVQPVQTMAQMLAANDCATKIIAYECEDKKSLKA 178

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L++  A   + ++ ++IGPEGG    E ET  +   V P+SLG RILR++TA + A++ 
Sbjct: 179 ALKEAQAKGALTDLLLIIGPEGGISEAELETARAAGAV-PVSLGRRILRAETAGLVAISA 237

Query: 237 VQAICGD 243
           +    GD
Sbjct: 238 IFYETGD 244


>gi|319400913|gb|EFV89132.1| RNA methyltransferase family protein [Staphylococcus epidermidis
           FRI909]
          Length = 250

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 99/247 (40%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKAS-GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F++              + YH++ +V+R KEG NI++    +  +  KI  +    
Sbjct: 1   MQRYFMNQSADENQCFFIENKEDYHHIVNVMRYKEGQNIIVTFSDENVFRCKIISINDQS 60

Query: 66  RFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------T 117
                 E Q  +     ++      IK ++ ++MIQK+ EMG      V           
Sbjct: 61  IEIKLEEKQQINTELPQNITICSGLIKADKYEWMIQKATEMGANEFIAVAMERSVVKLND 120

Query: 118 QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 + R +     AAEQ   LT+P I   + L+ +    +    ++ A E       
Sbjct: 121 SKVEKKLSRWQKIIKEAAEQSYRLTIPNIKFKSNLKEIYGMINQYDYVLIAYEEQAKHGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + +        V I+ GPEGG    E      +   T + LGPRILR++TA + A
Sbjct: 181 LSQFKQTIKQFKTQDRVLIIFGPEGGLSDSEIALFDDV--STIVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ V   
Sbjct: 239 LSAVSYE 245


>gi|91978577|ref|YP_571236.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisB5]
 gi|91685033|gb|ABE41335.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisB5]
          Length = 251

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 101/246 (41%), Positives = 144/246 (58%), Gaps = 3/246 (1%)

Query: 2   KIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV 61
           +      RLFVD  L    +     DQ +YL +VLR+  G  +L FNG+DGEW + I+  
Sbjct: 3   RYDFRSPRLFVDAALAPGARVPLDRDQSNYLGNVLRLGAGAPVLTFNGRDGEWRAAIAGR 62

Query: 62  GKSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTH 121
            +    +V  Q+R Q +  D+ Y+F+P+K +RLDYM QK+VEMG G ++PV+TR+TQ   
Sbjct: 63  KRPEELEVTDQTRPQDRLPDLTYVFAPLKHSRLDYMTQKAVEMGAGRLQPVLTRHTQVHR 122

Query: 122 YNMDRVRTYTISAAEQCDILTLPFIYPPTT-LEFLLKNWDHNCQIVFADETCGSENSLEK 180
            N DR+R   I AAEQC IL++  +        +L    D    + F DE     + +  
Sbjct: 123 LNTDRMRANAIEAAEQCGILSVAAVEESIALERWLAARADGGRLLAFCDEDAEIADPVAA 182

Query: 181 LHAIAHI--PNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQ 238
           L          + +L+GPEGG+ +EE+E L   P +  L+LGPRI+R+DTAAVAA+ALVQ
Sbjct: 183 LQGARATAAQGIDLLVGPEGGFSNEERELLLRQPNILRLALGPRIMRADTAAVAALALVQ 242

Query: 239 AICGDW 244
           A+ GDW
Sbjct: 243 AVIGDW 248


>gi|15924567|ref|NP_372101.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|15927157|ref|NP_374690.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus N315]
 gi|148268061|ref|YP_001247004.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150394129|ref|YP_001316804.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus JH1]
 gi|156979895|ref|YP_001442154.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus Mu3]
 gi|253316052|ref|ZP_04839265.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus str. CF-Marseille]
 gi|255006363|ref|ZP_05144964.2| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus Mu50-omega]
 gi|257793653|ref|ZP_05642632.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258411047|ref|ZP_05681327.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258420149|ref|ZP_05683104.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258437409|ref|ZP_05689393.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258443615|ref|ZP_05691954.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|258446822|ref|ZP_05694976.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258448736|ref|ZP_05696848.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|258453553|ref|ZP_05701531.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|269203205|ref|YP_003282474.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282893078|ref|ZP_06301312.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus A8117]
 gi|282928210|ref|ZP_06335815.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus A10102]
 gi|296275801|ref|ZP_06858308.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus MR1]
 gi|13701375|dbj|BAB42669.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247348|dbj|BAB57739.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|147741130|gb|ABQ49428.1| protein of unknown function DUF558 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946581|gb|ABR52517.1| protein of unknown function DUF558 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722030|dbj|BAF78447.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|257787625|gb|EEV25965.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840197|gb|EEV64661.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257843860|gb|EEV68254.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257848614|gb|EEV72602.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257851021|gb|EEV74964.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|257854397|gb|EEV77346.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257858014|gb|EEV80903.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|257864284|gb|EEV87034.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262075495|gb|ACY11468.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282590017|gb|EFB95099.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus A10102]
 gi|282764396|gb|EFC04522.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus A8117]
 gi|285817259|gb|ADC37746.1| Ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus 04-02981]
 gi|312829965|emb|CBX34807.1| RNA methyltransferase family protein [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315129856|gb|EFT85846.1| hypothetical protein CGSSa03_02183 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727099|gb|EGG63555.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 250

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNT--- 120
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 121 ---HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVVKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|271502142|ref|YP_003335168.1| hypothetical protein Dd586_3632 [Dickeya dadantii Ech586]
 gi|270345697|gb|ACZ78462.1| protein of unknown function DUF558 [Dickeya dadantii Ech586]
          Length = 244

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 61/248 (24%), Positives = 110/248 (44%), Gaps = 15/248 (6%)

Query: 5   SHLKRLFVDFPLCI-KTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK 63
             + R+F    L     +   S D  +++  VLRM  G  + LF+G +  + ++I   GK
Sbjct: 1   MRIPRIFHPDTLAPQGGETDLSEDAANHVGRVLRMSAGQALQLFDGSNQVFEAEIVQAGK 60

Query: 64  SIRFKV--EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT---- 117
                     Q+  +     +       +  ++++ IQKS+E+G+  I P+++       
Sbjct: 61  KSVRVRYATGQTEDRESPLHLHLGQVMSRGEKMEFTIQKSIELGVNIITPLLSERCGVKL 120

Query: 118 --QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSE 175
             +     + + +   I+A EQC    +P I P  TLE      D+  ++          
Sbjct: 121 DGERLEKKIAQWQKIAIAACEQCGRNRVPDIRPVQTLESWCAESDNGLKLNLHPRASQHI 180

Query: 176 NSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMA 235
           N+L        +  + +LIGPEGG  ++E     +  F T + LGPR+LR++T A+ A+ 
Sbjct: 181 NTLPL-----PVSRIRLLIGPEGGLSADEIAMTATQGF-TDILLGPRVLRTETTALTAIT 234

Query: 236 LVQAICGD 243
            +Q   GD
Sbjct: 235 ALQVRFGD 242


>gi|311108286|ref|YP_003981139.1| methyltransferase [Achromobacter xylosoxidans A8]
 gi|310762975|gb|ADP18424.1| RNA methyltransferase family protein [Achromobacter xylosoxidans
           A8]
          Length = 243

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 105/230 (45%), Gaps = 10/230 (4%)

Query: 8   KRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRF 67
            R F D PL    +        H+   VLR++ G+ + LFNG+ GE+ + +   GK+   
Sbjct: 4   PRFFCDIPLTAGARVALPDALAHHALRVLRLRAGEAVALFNGQGGEYPATLEVDGKAGFA 63

Query: 68  KV-EYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QNT 120
           ++ ++  R       +  +      +++D++++K+VE+G   + P+  + +         
Sbjct: 64  QLGQFLPREAELAGRITLVQGLPSGDKMDWVVEKAVELGAARVCPIAAQRSVLQLSGPRL 123

Query: 121 HYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEK 180
              +   +    SA+EQC    L  +  P TL   L+      +++   E    ++    
Sbjct: 124 DKRVAHWQRIAQSASEQCGRNRLMAVDAPFTLADWLQQPADGLRLMCHPEAS--DDLAGA 181

Query: 181 LHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAA 230
           L A+ ++  + +L+GPEGG+  +E         V  +  GPR+LR++TA 
Sbjct: 182 LRAVPNLQALTLLVGPEGGWSDKELAQAREAG-VQAVRFGPRVLRTETAG 230


>gi|27468182|ref|NP_764819.1| hypothetical protein SE1264 [Staphylococcus epidermidis ATCC 12228]
 gi|57867034|ref|YP_188721.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus
           epidermidis RP62A]
 gi|251810994|ref|ZP_04825467.1| protein of hypothetical function DUF558 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|293366462|ref|ZP_06613139.1| RsmE family RNA methyltransferase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315728|gb|AAO04863.1|AE016748_97 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57637692|gb|AAW54480.1| conserved hypothetical protein TIGR00046 [Staphylococcus
           epidermidis RP62A]
 gi|251805504|gb|EES58161.1| protein of hypothetical function DUF558 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|291319231|gb|EFE59600.1| RsmE family RNA methyltransferase [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 253

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 60/248 (24%), Positives = 100/248 (40%), Gaps = 15/248 (6%)

Query: 6   HLKRLFVDFPLCIKTQGKAS-GDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
           +L+R F++              + YH++ +V+R KEG NI++    +  +  KI  +   
Sbjct: 3   NLQRYFMNQSADENQCFFIENKEDYHHIVNVMRYKEGQNIIVTFSDENVFKCKIISINDQ 62

Query: 65  IRFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY------ 116
                 VE Q  +     ++      IK ++ ++MIQK+ EMG      V          
Sbjct: 63  SIEIKLVEKQQINTELPQNITICSGLIKADKYEWMIQKATEMGANEFIAVAMERSVVKLN 122

Query: 117 TQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + R +     AAEQ   LT+P I   + L+ +         ++ A E      
Sbjct: 123 DSKVEKKLSRWQKIIKEAAEQSYRLTIPNIKFKSNLKEIYGMISQYDYVLIAYEEQAKHG 182

Query: 177 SL----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVA 232
            L    + +        V I+ GPEGG    E      +   T + LGPRILR++TA + 
Sbjct: 183 ELSQFKQTIKQFKTQDRVLIIFGPEGGLSDSEISLFGDV--STIVGLGPRILRAETAPLY 240

Query: 233 AMALVQAI 240
           A++ V   
Sbjct: 241 ALSAVSYE 248


>gi|21283258|ref|NP_646346.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49486412|ref|YP_043633.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|21204698|dbj|BAB95394.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49244855|emb|CAG43316.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|329733247|gb|EGG69584.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 250

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|282916847|ref|ZP_06324605.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus D139]
 gi|283770653|ref|ZP_06343545.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus H19]
 gi|282319334|gb|EFB49686.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus D139]
 gi|283460800|gb|EFC07890.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus H19]
          Length = 250

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNNQTVYLCEIADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|146296762|ref|YP_001180533.1| hypothetical protein Csac_1755 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410338|gb|ABP67342.1| protein of unknown function DUF558 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 242

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 60/244 (24%), Positives = 109/244 (44%), Gaps = 10/244 (4%)

Query: 7   LKRLFVDFPLCIKTQGKA-SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           +   F++    +         D  +++  VLR +EG+ + L +G        +      I
Sbjct: 1   MPIFFIESKNIVNDIAYITDKDDLNHVVKVLRKREGEVLNLCDGIYDYKAKILEISKDKI 60

Query: 66  RFKVEYQSRSQTKQSDVQ-YIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRY-----TQN 119
           +  +E +  +Q +           IK  ++D +IQK+ E+G+  + PVI++      ++ 
Sbjct: 61  KVAIEEKVLNQREPQKDVFLFQCIIKNQKMDIIIQKATELGVKVLIPVISKRVVIDISEK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
               + R +     A +QC     P I  P  +  +    D    ++   E    +    
Sbjct: 121 EEKKIQRWQRIAKEAQKQCLRPYSPQIQRPIEIGRVKDFLDELDLLIIPYEKENKKTY-- 178

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239
            L   ++I  V ILIGPEGG+  +E E    L  V  +SLG RILRS+TAA++ +++V  
Sbjct: 179 -LDINSNINRVGILIGPEGGFEEDEIEIFKDLQKVRIVSLGKRILRSETAAISVISIVMH 237

Query: 240 ICGD 243
           + G+
Sbjct: 238 LLGE 241


>gi|317493538|ref|ZP_07951959.1| RsmE family RNA methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918481|gb|EFV39819.1| RsmE family RNA methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 243

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 109/247 (44%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L    +   S +  +++  VLRM EG  I LF+G +  +++ I    K 
Sbjct: 1   MRIPRIYHPERLEAPCEIDLSEEAANHVGRVLRMSEGHEIQLFDGSNQVFVAHIVAASKK 60

Query: 65  IRFKVEYQSRSQTKQSDVQYIFSP--IKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                      + ++S +         +  ++++ IQKS+E+G   I P+I+        
Sbjct: 61  NVRVKVQSGVLEDRESPLHLHLGQVISRGEKMEFTIQKSIELGASIITPLISERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +     + + +   I+A EQC    +P I P   LE      D + ++        S N
Sbjct: 121 AERMAKKLGQWQKIAIAACEQCGRNVIPEIRPTMLLEQWCAEQDDSLKLNLHPRANASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTAGYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|251793469|ref|YP_003008198.1| 16S ribosomal RNA methyltransferase RsmE [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534865|gb|ACS98111.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 244

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 13/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYV-GK 63
             + R++    L   T    S D  +++  VLRM  G+++ LF+G +  + + I+ V  K
Sbjct: 1   MRVPRIYHPTALNHLTFCTLSEDGANHVGRVLRMLPGEHLELFDGTNHIYQAVITQVGKK 60

Query: 64  SIRFKVEYQSRSQTKQS-DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
           S+  ++  Q     +    +       +  R+++ IQKSVE+G+  I P+ +        
Sbjct: 61  SVDVEILSQQFDDRESPLSIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
                  + + +   I+A EQC    +P I P   L+      D   ++        S  
Sbjct: 121 SDRMEKKIQQWQKIAIAACEQCGRNKIPEIRPLMKLQQWCAEQDDTLKLNLHPRATHSIR 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L  + A      V +LIG EGG   +E        FV  + LG R+LR++TAA+AA+  
Sbjct: 181 TLPAIPA----AGVRLLIGSEGGLSPQEIAQTEQQGFVE-VLLGKRVLRTETAAMAAITA 235

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 236 LQVCFGD 242


>gi|49483825|ref|YP_041049.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|257425702|ref|ZP_05602126.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428363|ref|ZP_05604761.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431000|ref|ZP_05607380.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433688|ref|ZP_05610046.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436602|ref|ZP_05612646.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904159|ref|ZP_06312047.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905986|ref|ZP_06313841.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282908896|ref|ZP_06316714.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911215|ref|ZP_06319017.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914384|ref|ZP_06322170.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus M899]
 gi|282919353|ref|ZP_06327088.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus C427]
 gi|282924678|ref|ZP_06332346.1| hypothetical protein SARG_02226 [Staphylococcus aureus subsp.
           aureus C101]
 gi|283958341|ref|ZP_06375792.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293503458|ref|ZP_06667305.1| hypothetical protein SCAG_01980 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510475|ref|ZP_06669181.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293531015|ref|ZP_06671697.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus M1015]
 gi|295428155|ref|ZP_06820787.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|49241954|emb|CAG40649.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257271396|gb|EEV03542.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275204|gb|EEV06691.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278430|gb|EEV09066.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281781|gb|EEV11918.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283953|gb|EEV14076.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313513|gb|EFB43908.1| hypothetical protein SARG_02226 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282317163|gb|EFB47537.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus C427]
 gi|282321565|gb|EFB51890.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus M899]
 gi|282324910|gb|EFB55220.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327160|gb|EFB57455.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331278|gb|EFB60792.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282595777|gb|EFC00741.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus C160]
 gi|283790490|gb|EFC29307.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|290920283|gb|EFD97349.1| RNA methyltransferase, RsmE family [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095124|gb|EFE25389.1| hypothetical protein SCAG_01980 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466839|gb|EFF09359.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295128513|gb|EFG58147.1| ribosomal RNA small subunit methyltransferase E [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|315195480|gb|EFU25867.1| hypothetical protein CGSSa00_07415 [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 250

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAHEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|16761869|ref|NP_457486.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29143356|ref|NP_806698.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|291084775|ref|ZP_06542159.2| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
 gi|25345391|pir||AF0877 conserved hypothetical protein STY3247 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504171|emb|CAD02918.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138990|gb|AAO70558.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 243

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 1   MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGAGQALQLFDGSNQVFDAEIISASKK 60

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 61  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 120

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++        S N
Sbjct: 121 NERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLRLNLHPRAHASIN 180

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 181 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 234

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 235 LQVRFGD 241


>gi|323443249|gb|EGB00867.1| 16S ribosomal RNA methyltransferase RsmE [Staphylococcus aureus
           O46]
          Length = 250

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +I+ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  ITVDLKEKQNINTELPVDVTICSGLIKGDKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|332531193|ref|ZP_08407106.1| 16S ribosomal RNA methyltransferase RsmE [Hylemonella gracilis ATCC
           19624]
 gi|332039300|gb|EGI75713.1| 16S ribosomal RNA methyltransferase RsmE [Hylemonella gracilis ATCC
           19624]
          Length = 248

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 107/244 (43%), Gaps = 15/244 (6%)

Query: 7   LKRLFVDFP----LCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           + R          L    + +   +   ++  VLR++ GD + LFNG+ GEW + +  +G
Sbjct: 1   MPRFHCPEEPSSVLRAGGEVELPPETARHV-QVLRLQPGDTLTLFNGRSGEWTATVLRMG 59

Query: 63  KSIRFKVEYQSR--SQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT--- 117
           ++             +    DV          R+D++++K+VE+G+ +I+P+ T  +   
Sbjct: 60  RASVTVRVDHHHAVEREAPLDVHLAVGMPANERMDWLVEKAVELGVASIQPLQTERSVLR 119

Query: 118 ---QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFAD-ETCG 173
              +         +   I+A EQC    LP ++    L+ +        Q  F       
Sbjct: 120 LSGERALKKQLHWQGIAIAACEQCGRNRLPPVHAVRPLQDVAAWSPPEVQRRFVLSLDDD 179

Query: 174 SENSLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
                + L +     +V +L GPEGG    E++   +  F  P+SLG R LR++TA +AA
Sbjct: 180 CVPISQVLASRGSTGSVLLLSGPEGGLSPTEEQAARAAGF-QPVSLGQRTLRAETAPLAA 238

Query: 234 MALV 237
           +A++
Sbjct: 239 LAVL 242


>gi|283470856|emb|CAQ50067.1| protein YqeU [Staphylococcus aureus subsp. aureus ST398]
          Length = 250

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 103/247 (41%), Gaps = 15/247 (6%)

Query: 7   LKRLFVDFPLCIKTQGKASG-DQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R F+D    +  +   +  +  H++ +V+R   G  I+L       +L +++ +    
Sbjct: 1   MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEVADITSDK 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                 E Q+ +     DV      IK ++ ++++QK+ E+G  +   V    +      
Sbjct: 61  IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R +     AAEQ   L +P I   + L+ +    D+   I+ A E    +  
Sbjct: 121 AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE 180

Query: 178 L----EKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
           L    + L        V ++ GPEGG    E          T + LGPRILR++TA + A
Sbjct: 181 LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLF--SNTSTVVGLGPRILRAETAPLYA 238

Query: 234 MALVQAI 240
           ++ +   
Sbjct: 239 LSAISYE 245


>gi|115522898|ref|YP_779809.1| 16S ribosomal RNA methyltransferase RsmE [Rhodopseudomonas
           palustris BisA53]
 gi|115516845|gb|ABJ04829.1| protein of unknown function DUF558 [Rhodopseudomonas palustris
           BisA53]
          Length = 258

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 109/244 (44%), Positives = 148/244 (60%), Gaps = 2/244 (0%)

Query: 3   IHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVG 62
           +     RLFVD PL   TQ   + +Q +YL +VLR+  G  +L FNG DGEW + I    
Sbjct: 4   LDFRSPRLFVDAPLVAGTQVPLTREQANYLGNVLRLSPGGRVLAFNGSDGEWQALIVGGK 63

Query: 63  KSIRFKVEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY 122
           +  R ++  Q+R Q +  DV Y ++P+K  RLDYM+QK+VE+G  A+ PV+TR+TQ T  
Sbjct: 64  RLERLEMLLQTRPQDRLPDVTYAYAPLKHARLDYMVQKAVELGAAALVPVLTRFTQATRV 123

Query: 123 NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKL- 181
           N +R+R   I AAEQC IL+L  +  PT LE  L   D    +VF DE     + +  L 
Sbjct: 124 NTERMRANVIEAAEQCGILSLAAVEEPTKLERWLTARDGQRLLVFCDEDAEIADPVAALA 183

Query: 182 -HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240
                    + +LIGPEGG+  EE++ L   P V  L+LGPRI+R+DTAAVAA+ALVQA+
Sbjct: 184 GARDRAQAGIDVLIGPEGGFAEEERDLLLRQPSVLRLALGPRIMRADTAAVAALALVQAV 243

Query: 241 CGDW 244
            GDW
Sbjct: 244 LGDW 247


>gi|197263143|ref|ZP_03163217.1| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|200388493|ref|ZP_03215105.1| protein YggJ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205357558|ref|ZP_02571479.2| protein YggJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|16421647|gb|AAL21969.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197241398|gb|EDY24018.1| protein YggJ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|199605591|gb|EDZ04136.1| protein YggJ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205331209|gb|EDZ17973.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261248225|emb|CBG26062.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|301159649|emb|CBW19168.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914116|dbj|BAJ38090.1| 16S rRNA methyltransferase RsmE [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225767|gb|EFX50821.1| Ribosomal RNA small subunit methyltransferase E [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323131450|gb|ADX18880.1| protein YggJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332989961|gb|AEF08944.1| 16S ribosomal RNA methyltransferase RsmE [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 259

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 106/247 (42%), Gaps = 14/247 (5%)

Query: 5   SHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKS 64
             + R++    L   TQ     D  +++  VLRM  G  + LF+G +  + ++I    K 
Sbjct: 17  MRIPRIYHPELLTSGTQISLCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEIISASKK 76

Query: 65  IRFKVEYQ--SRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT----- 117
                  +     +     +       +  ++++ IQKS+E+G+  I P+ +        
Sbjct: 77  SVEVQVMKGEIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD 136

Query: 118 -QNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSEN 176
            +  +    + +   I+A EQC    +P I PP  LE      D   ++        S N
Sbjct: 137 SERLNKKRQQWQKIAIAACEQCGRNRVPEIRPPMALEAWCAEQDSGLKLNLHPRAHASIN 196

Query: 177 SLEKLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMAL 236
           +L        +  V +LIGPEGG  ++E        F T + LGPR+LR++T A+ A+  
Sbjct: 197 TLPL-----PVERVRLLIGPEGGLSADEIAMTARYQF-TDILLGPRVLRTETTALTAITA 250

Query: 237 VQAICGD 243
           +Q   GD
Sbjct: 251 LQVRFGD 257


>gi|313897356|ref|ZP_07830899.1| RNA methyltransferase, RsmE family [Clostridium sp. HGF2]
 gi|312957726|gb|EFR39351.1| RNA methyltransferase, RsmE family [Clostridium sp. HGF2]
          Length = 252

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 8/235 (3%)

Query: 7   LKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIR 66
           +++ FV+           + +Q H++  V+RM++GD I + +      L+++ Y  +   
Sbjct: 1   MQQYFVNTLAMPGELIPMTKEQTHHIRRVMRMQQGDVIRVADNSGRVLLAEVEYHQEEAA 60

Query: 67  FKVEYQSRSQTKQSDV-QYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYT------QN 119
            +V  + R  ++ S         IK  + DY++QKS E+G+  I P ++         + 
Sbjct: 61  ARVVREVRDCSQTSVELILAQGMIKGEKWDYLLQKSAELGVAEIIPFVSSRCVVKIKDEK 120

Query: 120 THYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLE 179
           +   + R       A EQC   TL  + PP T   L +       I + D  C SE   E
Sbjct: 121 SEKKIVRWNKILCEACEQCKRSTLVRLQPPCTFSQLSQIDADLRLIAYEDADCKSERLCE 180

Query: 180 KLHAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAM 234
            L A      V +++G EGG+ ++E E L +  F   +SLG RILR++TAA++ +
Sbjct: 181 VLRAHPSPKRVLMVVGSEGGFSADEVEALTATGF-HRVSLGGRILRAETAAISLL 234


>gi|116872901|ref|YP_849682.1| hypothetical protein lwe1485 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741779|emb|CAK20903.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 255

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 98/248 (39%), Gaps = 14/248 (5%)

Query: 7   LKRLFVDFPLCIK-TQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSI 65
           ++R FV   L         +G+ +H++  V+RMKE D + +        ++ I+ +    
Sbjct: 1   MQRYFVTNELENDHDTIFITGENFHHITRVMRMKEADQVFIVFPSKKTCVATITAINDEE 60

Query: 66  RFK--VEYQSRSQTKQSDVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHY- 122
                V++   +     ++       K ++L+ +IQKS E+G     P     +      
Sbjct: 61  VVLNLVKWLEENTELPIEITIASGLPKGDKLELIIQKSTELGAHKFIPYKAERSVAKWDD 120

Query: 123 -----NMDRVRTYTISAAEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENS 177
                 ++R++     AAEQ     +P +    + + L+ N  H   ++ A E    E  
Sbjct: 121 KKVIKKIERLQKIAQEAAEQSHRTVIPEVQYAASFKELMLNHVHYDYVIAAYEESAREGE 180

Query: 178 LEKL----HAIAHIPNVAILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAA 233
              L      +    +V  + GPEGG   +E   L          LGPRILR++TA +  
Sbjct: 181 DSALPSLFQTMKKGQSVLCIFGPEGGISEKELILLQDANTTLA-GLGPRILRTETAPLYV 239

Que