RPSBLAST alignment of GI: 254781160 and MMDB domain: 1vhy_A_1-77

>1vhy_A (A:1-77) Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae}Length = 77
 Score = 67.5 bits (165), Expect = 1e-12
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60
          ++I     R++    L  +TQ   S D  +++A VLR  EG+ + LF+G +  + +KI  
Sbjct: 3  LRIP----RIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIE 58

Query: 61 VGK-SIRFKVEYQSRSQT 77
            K S++ ++  +  +  
Sbjct: 59 SNKKSVKVEILGRELADK 76