RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter asiaticus str. psy62] (245 letters) >1vhk_A Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis} (A:78-268) Length = 191 Score = 144 bits (364), Expect = 1e-35 Identities = 42/174 (24%), Positives = 67/174 (38%), Gaps = 11/174 (6%) Query: 81 DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTISA 134 V K ++L+++IQK E+G A P + +R A Sbjct: 5 KVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKLDDKKAKKKRERWTKIAKEA 64 Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIP----NV 190 AEQ +P + + + LL+ + V A E + + AI ++ Sbjct: 65 AEQSYRNEVPRVXDVHSFQQLLQRXQDFDKCVVAYEESSKQGEISAFSAIVSSLPKGSSL 124 Query: 191 AILIGPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244 I+ GPEGG E E L LGPRILR++TA + A++ + Sbjct: 125 LIVFGPEGGLTEAEVERLTEQDG-VTCGLGPRILRTETAPLYALSAISYQTELL 177 >3kw2_A Probable R-RNA methyltransferase; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE ADN; 2.00A {Porphyromonas gingivalis atcc 33277} (A:75-257) Length = 183 Score = 143 bits (363), Expect = 1e-35 Identities = 35/170 (20%), Positives = 71/170 (41%), Gaps = 7/170 (4%) Query: 81 DVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCD 139 + +P K R ++ ++K VE+G+ + + + +++ +R+ ISA +Q Sbjct: 4 RITIAIAPTKQSERXEWXLEKLVEIGVDEVVFIESEHSERRRIKAERLERIAISAXKQSL 63 Query: 140 ILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHA-----IAHIPNVAILI 194 + P I ++ ++ + + A + + +V ILI Sbjct: 64 KASFPVIRVNIPIQTVIADTPKAAVRLIAYVDEAVRAEITQGRGYPSDFYHVGQDVLILI 123 Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244 GPEG + E E+ F P+SLG LR++TA + A + + + Sbjct: 124 GPEGDFSPSEVESALLAGF-APVSLGESRLRTETAGLVACQWIHTLQACY 172 >1vhy_A Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae} (A:78-257) Length = 180 Score = 141 bits (357), Expect = 7e-35 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 11/170 (6%) Query: 81 DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQ------NTHYNMDRVRTYTISA 134 + + R ++ IQKSVE+G+ I P+ + + + + I+A Sbjct: 4 KIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLDAERXDKKIQQWQKIAIAA 63 Query: 135 AEQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILI 194 EQC +P I P L+ D ++ + S++ L V +LI Sbjct: 64 CEQCGRNIVPEIRPLXKLQDWCAENDGALKLNLHPR---AHYSIKTLPT-IPAGGVRLLI 119 Query: 195 GPEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGDW 244 G EGG ++E F T + LG R+LR++TA++AA++ +Q GD Sbjct: 120 GSEGGLSAQEIAQTEQQGF-TEILLGKRVLRTETASLAAISALQICFGDL 168 >2egv_A UPF0088 protein AQ_165; RSME, methyltransferase, rRNA modification, PUA domain, M3U, SAM, structural genomics, NPPSFA; HET: SAM; 1.45A {Aquifex aeolicus} PDB: 2egw_A* (A:68-229) Length = 162 Score = 136 bits (345), Expect = 2e-33 Identities = 31/164 (18%), Positives = 66/164 (40%), Gaps = 12/164 (7%) Query: 81 DVQYIFSPIKT-NRLDYMIQKSVEMGMGAIRPVITRYTQ----NTHYNMDRVRTYTISAA 135 D+ S +D +++++ E+G+ P+I+ + ++ + I A Sbjct: 5 DITLYQSVTVDLKTMDTIVRQATELGVLTFVPIISERSFQKEEAILKKTEKWKRIVIEAM 64 Query: 136 EQCDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIG 195 +Q I P L L+ + N + E ++ ++++G Sbjct: 65 KQSRRPIPMEIKKPVRLSDLIPESEENIILDNFYE------GVKPKDVNLEAKTYSVVVG 118 Query: 196 PEGGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQA 239 PEGG+ E + L F + L P LR++TA V+ ++++ Sbjct: 119 PEGGFSKRESQILREKGF-KSVLLEPYTLRTETAVVSIVSILMN 161 >1v6z_A Hypothetical protein TTHA0657; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.00A {Thermus thermophilus HB8} (A:68-228) Length = 161 Score = 134 bits (338), Expect = 1e-32 Identities = 47/165 (28%), Positives = 85/165 (51%), Gaps = 12/165 (7%) Query: 81 DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYN---MDRVRTYTISAAEQ 137 +V + +K ++L +++ + E+G I+P++TR++ + R+R + AA+Q Sbjct: 5 EVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEXGEGKLRRLRAVALEAAKQ 64 Query: 138 CDILTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPE 197 + +P + PP L+ + + Q + A + + +A+ +GPE Sbjct: 65 SGRVVVPEVLPPIPLKAVPQVA----QGLVAHVGATARV----REVLDPEKPLALAVGPE 116 Query: 198 GGYHSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICG 242 GG+ EE L + F TP+SLG RILR++TAA+A +AL A G Sbjct: 117 GGFAEEEVALLEARGF-TPVSLGRRILRAETAALALLALCTAGEG 160 >1z85_A Hypothetical protein TM1380; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.12A {Thermotoga maritima MSB8} (A:83-234) Length = 152 Score = 128 bits (324), Expect = 5e-31 Identities = 35/163 (21%), Positives = 69/163 (42%), Gaps = 15/163 (9%) Query: 81 DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDI 140 + + + R ++I+K VE+G+ I +Q ++D+ + AA+QC Sbjct: 4 KLSVVVPIGRWERTRFLIEKCVELGVDEIFFHKFERSQ-HEISLDKAKIVVREAAKQCKR 62 Query: 141 LTLPFIYPPTTLEFLLKNWDHNCQIVFADETCGSENSLEKLHAIAHIPNVAILIGPEGGY 200 P + + + ++ D + L ++ +++GPEGG+ Sbjct: 63 YLFPKVSFLE-------KLEFSGNVITLDLDAS-----QNLLDANLEGSITVVVGPEGGF 110 Query: 201 HSEEKETLHSLPFVTPLSLGPRILRSDTAAVAAMALVQAICGD 243 +E+E L S T +SLG +ILR +TAA+ + + Sbjct: 111 SEKERELLRS--STTIVSLGKKILRFETAAILTVGYIALKKQK 151 >1vhy_A Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae} (A:1-77) Length = 77 Score = 67.5 bits (165), Expect = 1e-12 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%) Query: 1 MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60 ++I R++ L +TQ S D +++A VLR EG+ + LF+G + + +KI Sbjct: 3 LRIP----RIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIE 58 Query: 61 VGK-SIRFKVEYQSRSQT 77 K S++ ++ + + Sbjct: 59 SNKKSVKVEILGRELADK 76 >3kw2_A Probable R-RNA methyltransferase; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE ADN; 2.00A {Porphyromonas gingivalis atcc 33277} (A:1-74) Length = 74 Score = 61.3 bits (149), Expect = 1e-10 Identities = 13/77 (16%), Positives = 27/77 (35%), Gaps = 8/77 (10%) Query: 1 MKIHSHLKRLFVDFPLCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISY 60 + + + + D+ ++ VLR + GD + L +G+ + + I Sbjct: 3 LSLP----LFYAPDIE---QSDRLPDDEAGHILRVLRXQAGDRLRLTDGRGSFFDAVIET 55 Query: 61 VGK-SIRFKVEYQSRSQ 76 + S V Q Q Sbjct: 56 ADRKSCYVSVCGQESWQ 72 >1vhk_A Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis} (A:1-77) Length = 77 Score = 60.2 bits (146), Expect = 3e-10 Identities = 14/72 (19%), Positives = 29/72 (40%), Gaps = 4/72 (5%) Query: 9 RLFVDFPLCIKTQGKA---SGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGK-S 64 R F++ + +G++ H++ +V R EGD I+ + E ++ V K Sbjct: 5 RYFIELTKQQIEEAPTFSITGEEVHHIVNVXRXNEGDQIICCSQDGFEAKCELQSVSKDK 64 Query: 65 IRFKVEYQSRSQ 76 + V + Sbjct: 65 VSCLVIEWTNEN 76 >1z85_A Hypothetical protein TM1380; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.12A {Thermotoga maritima MSB8} (A:1-82) Length = 82 Score = 58.7 bits (142), Expect = 6e-10 Identities = 15/83 (18%), Positives = 27/83 (32%), Gaps = 11/83 (13%) Query: 1 MKIHSHLKRLFVDFP-----LCIKTQGKASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL 55 KIH P + + H+ V+R+KEGD I +G + Sbjct: 4 DKIH----HHHHHXPHLFYGTAQNGEVIFDEREAHHX-RVVRLKEGDVIEATDGNGFSYT 58 Query: 56 SKISYVGK-SIRFKVEYQSRSQT 77 + + K + K+ + Sbjct: 59 CILKSLKKKTAAAKIVKVEEKEK 81 >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} (A:) Length = 97 Score = 30.2 bits (68), Expect = 0.30 Identities = 14/81 (17%), Positives = 27/81 (33%), Gaps = 15/81 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 PL I G ++ + + GD IL N + + Sbjct: 17 PLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQ 76 Query: 60 YVGKSIRFKVEYQSRSQTKQS 80 G+++ K++ Q+ +Q S Sbjct: 77 MAGETVTLKIKKQTDAQPASS 97 >1v6z_A Hypothetical protein TTHA0657; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.00A {Thermus thermophilus HB8} (A:1-67) Length = 67 Score = 29.6 bits (66), Expect = 0.43 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query: 30 HYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQSRSQ 76 +L VLR + GD +F+G+ E L+++ +G +R++V + R + Sbjct: 21 RHLVEVLRARVGDRFTVFDGER-EALAEVVDLGPPLRYRVLEERRPE 66 >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 96 Score = 29.0 bits (65), Expect = 0.58 Identities = 13/69 (18%), Positives = 20/69 (28%), Gaps = 13/69 (18%) Query: 25 SGDQYHYLAHVL-------RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEY 71 S + V ++ GD IL N + E LS + S+ V Sbjct: 28 SESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVR 87 Query: 72 QSRSQTKQS 80 + S Sbjct: 88 CTSSGPSSG 96 >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 119 Score = 29.2 bits (65), Expect = 0.60 Identities = 13/85 (15%), Positives = 25/85 (29%), Gaps = 16/85 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL----------RMKEGDNILLFNGKDGEWLS------KI 58 +G ++ V R+ EGD ++L NG+D + I Sbjct: 28 RFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFI 87 Query: 59 SYVGKSIRFKVEYQSRSQTKQSDVQ 83 + ++ R V+ Sbjct: 88 KASCERHSGELMLLVRPNAVYDVVE 112 >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A (A:) Length = 93 Score = 29.0 bits (65), Expect = 0.65 Identities = 12/50 (24%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS-----KISYVGKSIRFKVEYQSRSQT 77 A +KEGD I+ NG S K+ G + + S + Sbjct: 42 AMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSSGPS 91 >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A (A:) Length = 99 Score = 28.7 bits (64), Expect = 0.68 Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQTK 78 A ++ GD I NG+ L + G I + ++T Sbjct: 47 AQEAGLRAGDLITHINGESVLGLVHMDVVELLLKSGNKISLRTTALENTETS 98 >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 104 Score = 28.7 bits (64), Expect = 0.73 Identities = 16/86 (18%), Positives = 30/86 (34%), Gaps = 15/86 (17%) Query: 6 HLKRLFVDFPLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS 56 L R + F L + +GD + +L R++ GD +L NG+ + L+ Sbjct: 16 ELVRGYAGFGLTLGGGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDLVLHINGESTQGLT 75 Query: 57 ------KISYVGKSIRFKVEYQSRSQ 76 +I G + + Sbjct: 76 HAQAVERIRAGGPQLHLVIRRPLSGP 101 >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} (D:) Length = 132 Score = 28.6 bits (63), Expect = 0.91 Identities = 10/51 (19%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ GD ++ NG++ + I G ++ KV +R Sbjct: 78 AWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPD 128 >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} (A:) Length = 118 Score = 28.4 bits (63), Expect = 1.00 Identities = 11/74 (14%), Positives = 21/74 (28%), Gaps = 16/74 (21%) Query: 20 TQGKASGDQYHYLAHVL----------RMKEGDNILLFNGKDGEWLS------KISYVGK 63 ++ + V + GD IL NG L I + Sbjct: 36 ESASSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIKQTSQ 95 Query: 64 SIRFKVEYQSRSQT 77 +++ +E+ Q Sbjct: 96 TLQLLIEHDPVPQR 109 >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} (A:) Length = 102 Score = 28.3 bits (63), Expect = 1.0 Identities = 11/51 (21%), Positives = 15/51 (29%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A +K D ++ NGK E L I G V + Sbjct: 43 AEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKEAESI 93 >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consortium, SGC, unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* (A:) Length = 91 Score = 27.9 bits (62), Expect = 1.2 Identities = 10/77 (12%), Positives = 23/77 (29%), Gaps = 14/77 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVLR--------MKEGDNILLFNGKDGEWLS------KISY 60 P + G +Q ++ V + GD I +G++ ++ +I Sbjct: 14 PWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKG 73 Query: 61 VGKSIRFKVEYQSRSQT 77 ++ V Sbjct: 74 CTDNLTLTVARSEHESD 90 >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} (A:61-182) Length = 122 Score = 28.1 bits (62), Expect = 1.2 Identities = 14/78 (17%), Positives = 25/78 (32%), Gaps = 15/78 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 L I +G ++ + + GD IL NG+D + + Sbjct: 30 GLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALK 89 Query: 60 YVGKSIRFKVEYQSRSQT 77 GK + +V+Y Sbjct: 90 KTGKEVVLEVKYMKEVSP 107 >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} (A:) Length = 100 Score = 27.9 bits (62), Expect = 1.2 Identities = 9/51 (17%), Positives = 16/51 (31%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A +++ D +L N + E +I I V S + Sbjct: 49 AERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVSGPSS 99 >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} (A:) Length = 88 Score = 27.9 bits (62), Expect = 1.3 Identities = 11/47 (23%), Positives = 15/47 (31%), Gaps = 6/47 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 + EGD IL NG E +S I ++ V Sbjct: 39 NLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDLEHHH 85 >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} (A:) Length = 117 Score = 28.0 bits (62), Expect = 1.3 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 13/70 (18%) Query: 21 QGKASGDQYHYLAHVL-------RMKEGDNILLFNGKDGEWLS------KISYVGKSIRF 67 +G+ ++ VL ++E D +++ NG E + ++ GK Sbjct: 39 PHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAI 98 Query: 68 KVEYQSRSQT 77 V+ + Q Sbjct: 99 VVKRPRKVQV 108 >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} (A:) Length = 97 Score = 28.0 bits (62), Expect = 1.3 Identities = 8/51 (15%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ GD +L NG + + G +++ +V + + Sbjct: 47 AARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERETSV 97 >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 110 Score = 28.0 bits (62), Expect = 1.3 Identities = 9/51 (17%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ GD +L NG + + G +++ +V +S + Sbjct: 59 AARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRESGPSS 109 >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A (A:1-102) Length = 102 Score = 27.6 bits (61), Expect = 1.4 Identities = 11/69 (15%), Positives = 24/69 (34%), Gaps = 13/69 (18%) Query: 24 ASGDQYHYLAHVL-------RMKEGDNILLFNGKD------GEWLSKISYVGKSIRFKVE 70 D ++ V ++ GD I+ NG G+ +S + ++ + Sbjct: 20 RPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIV 79 Query: 71 YQSRSQTKQ 79 + + KQ Sbjct: 80 REVGNGAKQ 88 >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A (A:) Length = 91 Score = 27.9 bits (62), Expect = 1.4 Identities = 10/51 (19%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A + +++ D I+ NG + +I GK++ V + T Sbjct: 40 ADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAQDT 90 >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} (A:) Length = 117 Score = 27.6 bits (61), Expect = 1.5 Identities = 15/78 (19%), Positives = 23/78 (29%), Gaps = 15/78 (19%) Query: 18 IKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KISYVG 62 K SG+ Y+A +L ++ EG +L +NG + IS Sbjct: 39 GKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQS 98 Query: 63 KSIRFKVEYQSRSQTKQS 80 V S Sbjct: 99 GEAEICVRLDLNMSGPSS 116 >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} (A:) Length = 101 Score = 27.5 bits (61), Expect = 1.8 Identities = 15/79 (18%), Positives = 24/79 (30%), Gaps = 13/79 (16%) Query: 15 PLCIKTQGKASGDQYHYLAHVLR--------MKEGDNILLFNGKDGEWLSKISYV----- 61 L +G + Y++ V ++ GD IL N K ++ V Sbjct: 22 GLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALKG 81 Query: 62 GKSIRFKVEYQSRSQTKQS 80 K + V R S Sbjct: 82 SKKLVLSVYSAGRISGPSS 100 >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} (A:) Length = 103 Score = 27.6 bits (61), Expect = 1.9 Identities = 11/77 (14%), Positives = 23/77 (29%), Gaps = 14/77 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL--------RMKEGDNILLFNGKDGEWLS------KISY 60 P + G +Q + + + GD IL +G E ++ +I Sbjct: 16 PWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKA 75 Query: 61 VGKSIRFKVEYQSRSQT 77 + K++ Sbjct: 76 ASYQLCLKIDRAETRLW 92 >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} (A:) Length = 94 Score = 27.5 bits (61), Expect = 1.9 Identities = 13/76 (17%), Positives = 24/76 (31%), Gaps = 14/76 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL--------RMKEGDNILLFNGKDGEWLS------KISY 60 P + G + V ++ GD I+ NG+ E + KI Sbjct: 17 PWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQ 76 Query: 61 VGKSIRFKVEYQSRSQ 76 +R +++ S Sbjct: 77 SASPLRLQLDRSSGPS 92 >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} (A:) Length = 109 Score = 27.2 bits (60), Expect = 2.0 Identities = 13/90 (14%), Positives = 22/90 (24%), Gaps = 15/90 (16%) Query: 6 HLKRLFVDFPLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS 56 L I + Y+ V+ R+K GD ++ N + +S Sbjct: 19 ITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGDCYKDGRLKPGDQLVSINKESMIGVS 78 Query: 57 ------KISYVGKSIRFKVEYQSRSQTKQS 80 I+ E S Sbjct: 79 FEEAKSIITRAKLRSESPWEIAFIRSGPSS 108 >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} (A:) Length = 216 Score = 27.3 bits (59), Expect = 2.0 Identities = 10/51 (19%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKD------GEWLSKISYVGKSIRFKVEYQSRSQT 77 A ++ D I+ NG G+ +S I G + V + + Sbjct: 46 AEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEF 96 >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} (A:) Length = 96 Score = 27.1 bits (60), Expect = 2.0 Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 8/53 (15%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS--------KISYVGKSIRFKVEYQSRSQT 77 + EGD I+ N ++ + LS K +G + S + Sbjct: 43 QGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGSGPSS 95 >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} (A:) Length = 91 Score = 27.1 bits (60), Expect = 2.2 Identities = 9/55 (16%), Positives = 15/55 (27%), Gaps = 6/55 (10%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQTKQSD 81 A +++ D +L N + E +I I V D Sbjct: 37 AERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPD 91 >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} (A:) Length = 104 Score = 27.1 bits (60), Expect = 2.4 Identities = 13/76 (17%), Positives = 28/76 (36%), Gaps = 13/76 (17%) Query: 15 PLCIKTQGKASGDQYHYLAHVLR--------MKEGDNILLFNGKDGEWLSKISYV----- 61 L +G + +++ V+ ++EGD +L N D + + V Sbjct: 28 QLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKT 87 Query: 62 GKSIRFKVEYQSRSQT 77 + I +V + S + Sbjct: 88 AREISMRVRFFSGPSS 103 >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} (A:) Length = 114 Score = 27.1 bits (60), Expect = 2.4 Identities = 9/51 (17%), Positives = 16/51 (31%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A + +GD +L NG + + G S+ V + Sbjct: 51 AEKAGLLDGDRVLRINGVFVDKEEHAQVVELVRKSGNSVTLLVLDGDSYEK 101 >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} (A:) Length = 117 Score = 26.8 bits (59), Expect = 2.5 Identities = 10/71 (14%), Positives = 23/71 (32%), Gaps = 15/71 (21%) Query: 22 GKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KISYVGKSIR 66 + + + GD+IL +G E S ++ + + +R Sbjct: 36 TSLRNKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLASISEKVR 95 Query: 67 FKVEYQSRSQT 77 ++ +SQ Sbjct: 96 LEILPVPQSQR 106 >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 126 Score = 27.0 bits (59), Expect = 2.6 Identities = 8/51 (15%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGK------DGEWLSKISYVGKSIRFKVEYQSRSQT 77 A + GD I+ NG+ + ++ I ++ V + + Sbjct: 74 AFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDSGPS 124 >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} (A:) Length = 225 Score = 26.8 bits (58), Expect = 2.6 Identities = 15/153 (9%), Positives = 36/153 (23%), Gaps = 8/153 (5%) Query: 95 DYMIQKSVEMGMGAIRPVITRYTQNTHYNMDRVRTYTISAAEQCDILTLPFIYPPTTLEF 154 + E A + + + I AE+ ++T+ P Sbjct: 74 SHTGHVLPEAVKEAGAVGTL-LNHSENRMILADLEAAIRRAEEVGLMTMVCSNNPAVSAA 132 Query: 155 LLKNWDHNCQIVFAD-----ETCGSENSLEKLHAIAHIPNVA--ILIGPEGGYHSEEKET 207 + + + + + + V + + G + E Sbjct: 133 VAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVLCGAGISTGEDVK 192 Query: 208 LHSLPFVTPLSLGPRILRSDTAAVAAMALVQAI 240 + L + ++ A LV I Sbjct: 193 KAIELGTVGVLLASGVTKAKDPEKAIWDLVSGI 225 >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 106 Score = 26.8 bits (59), Expect = 2.6 Identities = 9/51 (17%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A + D+++ NG++ E S K+ G + F + + + Sbjct: 45 AMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKR 95 >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} (A:) Length = 98 Score = 26.8 bits (59), Expect = 2.7 Identities = 9/51 (17%), Positives = 15/51 (29%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ D I+ NG E I G + V + + Sbjct: 46 AEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEF 96 >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} (A:) Length = 103 Score = 26.8 bits (59), Expect = 2.8 Identities = 14/78 (17%), Positives = 22/78 (28%), Gaps = 15/78 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 L I G ++ + + GD IL NG + +S Sbjct: 22 GLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILS 81 Query: 60 YVGKSIRFKVEYQSRSQT 77 I F+V Y + Sbjct: 82 QQRGEIEFEVVYVALEHH 99 >2vph_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, ptpmeg, hydrolase, cytoplasm, cytoskeleton, megakaryocyte, dephosphorylation; 1.90A {Homo sapiens} (A:) Length = 100 Score = 26.8 bits (59), Expect = 2.9 Identities = 14/84 (16%), Positives = 26/84 (30%), Gaps = 16/84 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL----------RMKEGDNILLFNGKDGEWLS------KI 58 +G ++ V R+ EGD ++L NG+D + I Sbjct: 17 RFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFI 76 Query: 59 SYVGKSIRFKVEYQSRSQTKQSDV 82 + ++ R +S V Sbjct: 77 KASCERHSGELMLLVRPNAVESTV 100 >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} (A:) Length = 116 Score = 26.8 bits (59), Expect = 3.0 Identities = 14/71 (19%), Positives = 20/71 (28%), Gaps = 15/71 (21%) Query: 22 GKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KISYVGKSIR 66 GK + + V R+ GD IL NG D S + + +R Sbjct: 37 GKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVR 96 Query: 67 FKVEYQSRSQT 77 V Sbjct: 97 LVVYRDEAHYR 107 >2v90_A PDZ domain-containing protein 3; alternative splicing, membrane, cytoplasm, protein-binding; 2.00A {Homo sapiens} (A:) Length = 96 Score = 26.4 bits (58), Expect = 3.4 Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A M+ GD ++ G+ E L +I G + V + Sbjct: 43 AKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRE 93 >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} (A:) Length = 103 Score = 26.3 bits (58), Expect = 3.7 Identities = 13/78 (16%), Positives = 26/78 (33%), Gaps = 15/78 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 +G Y+ + RM+ GD I+ NG+ ++ I Sbjct: 23 GFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIK 82 Query: 60 YVGKSIRFKVEYQSRSQT 77 G+ +R ++ + S Sbjct: 83 SGGRRVRLLLKRGTGSGP 100 >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} (A:1-102) Length = 102 Score = 26.4 bits (58), Expect = 3.9 Identities = 10/47 (21%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 +++GD IL NG D S + G+++ +Y+ + Sbjct: 56 ELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYS 102 >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} (A:) Length = 91 Score = 26.4 bits (58), Expect = 3.9 Identities = 9/51 (17%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A + GD ++ NG++ E + +I ++R V + Sbjct: 40 AEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ 90 >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 100 Score = 26.3 bits (58), Expect = 4.0 Identities = 11/76 (14%), Positives = 25/76 (32%), Gaps = 14/76 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKD-----GEWLSKISY 60 P +G + ++ + +M+ GD ++ NG E L I Sbjct: 22 PWGFTLKGGLEHCEPLTVSKIEDGGKAALSQKMRTGDELVNINGTPLYGSRQEALILIKG 81 Query: 61 VGKSIRFKVEYQSRSQ 76 + ++ V ++ Sbjct: 82 SFRILKLIVRRRNSGP 97 >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} (A:) Length = 108 Score = 26.5 bits (58), Expect = 4.0 Identities = 10/49 (20%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQTKQ 79 R+ +GD +L NG E + + G+ + +E +K+ Sbjct: 60 RIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPTSKE 108 >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} (A:) Length = 109 Score = 26.1 bits (57), Expect = 4.2 Identities = 10/51 (19%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ GD ++ NG++ + I G ++ KV +R Sbjct: 58 AWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPD 108 >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesion; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A (A:) Length = 107 Score = 26.0 bits (57), Expect = 4.3 Identities = 10/75 (13%), Positives = 28/75 (37%), Gaps = 13/75 (17%) Query: 18 IKTQGKASGDQYHYLAHVL-------RMKEGDNILLFNGKDGEWLS------KISYVGKS 64 SG+ ++ VL +++E D + + NG + + ++ GK+ Sbjct: 29 RDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKN 88 Query: 65 IRFKVEYQSRSQTKQ 79 + + + ++ Sbjct: 89 AKITIRRKKGGGWRR 103 >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} (A:) Length = 91 Score = 26.0 bits (57), Expect = 4.3 Identities = 6/44 (13%), Positives = 12/44 (27%), Gaps = 6/44 (13%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVE 70 + +K D +L N I+ G + + Sbjct: 45 GDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVIS 88 >1u3b_A Amyloid beta A4 precursor protein-binding, family A, member 1; X11S/mints, PDZ domain, scaffold protein, protein trafficking, protein transport; NMR {Homo sapiens} (A:91-185) Length = 95 Score = 26.3 bits (58), Expect = 4.3 Identities = 8/51 (15%), Positives = 15/51 (29%), Gaps = 6/51 (11%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 A ++ G I+ NG+ +S I K + + Sbjct: 35 AERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRL 85 >3i1n_U 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ... (U:1-25,U:67-104) Length = 63 Score = 26.0 bits (58), Expect = 4.5 Identities = 11/45 (24%), Positives = 23/45 (51%), Gaps = 10/45 (22%) Query: 36 LRMKEGDNILLFNGKD----GEWLSKISYV----GKSIR--FKVE 70 +++ D +++ GKD G+ +S ++ GK+ R F+ E Sbjct: 3 AKIRRDDEVIVLTGKDKGKRGKVVSNVAIFNAATGKADRVGFRFE 47 >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 120 Score = 26.0 bits (57), Expect = 4.7 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 R++EGD IL NG+D + L G ++ +V+++ + Q Sbjct: 65 RLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQN 111 >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein/oxidoreductase complex; 1.90A {Mus musculus} (A:) Length = 90 Score = 25.9 bits (57), Expect = 4.7 Identities = 14/72 (19%), Positives = 25/72 (34%), Gaps = 15/72 (20%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 L I +G ++ + + GD IL NG+D + + Sbjct: 17 GLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALK 76 Query: 60 YVGKSIRFKVEY 71 GK + +V+Y Sbjct: 77 KTGKEVVLEVKY 88 >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} (A:1-97) Length = 97 Score = 26.0 bits (57), Expect = 5.6 Identities = 13/78 (16%), Positives = 27/78 (34%), Gaps = 15/78 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 L + G D ++++ ++ GD I NG + + Sbjct: 20 TLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLK 79 Query: 60 YVGKSIRFKVEYQSRSQT 77 VG+ + +VEY+ + Sbjct: 80 NVGERVVLEVEYELPPVS 97 >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein binding; 1.70A {Homo sapiens} (A:) Length = 112 Score = 25.7 bits (56), Expect = 5.6 Identities = 8/48 (16%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Query: 33 AHVLRMKEGDNILLFNGK---DGEWLSKISYVGKSIRFKVEYQSRSQT 77 + +++GD I+ NG+ D L + + +V + Sbjct: 48 SQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLL 95 >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} (A:) Length = 111 Score = 25.7 bits (56), Expect = 5.7 Identities = 9/47 (19%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 R++ G +L N + L+ + VG ++ V S Sbjct: 62 RLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFESGP 108 >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 94 Score = 25.9 bits (57), Expect = 5.8 Identities = 12/75 (16%), Positives = 21/75 (28%), Gaps = 14/75 (18%) Query: 15 PLCIKTQGKASGDQYHYLAHVL--------RMKEGDNILLFNGKDGEWLS------KISY 60 P + G ++ V + GD I NG+ E ++ +I Sbjct: 19 PWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIKG 78 Query: 61 VGKSIRFKVEYQSRS 75 + V S Sbjct: 79 CHDHLTLSVSSGPSS 93 >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} (A:) Length = 127 Score = 25.8 bits (56), Expect = 6.0 Identities = 7/52 (13%), Positives = 17/52 (32%), Gaps = 9/52 (17%) Query: 14 FPLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS 56 L + D ++ ++ R++ D ++ NG+ S Sbjct: 41 VSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKS 92 >3bp6_A Programmed cell death protein 1; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglobulin domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_A 1npu_A (A:) Length = 117 Score = 25.6 bits (57), Expect = 6.3 Identities = 5/57 (8%), Positives = 12/57 (21%), Gaps = 9/57 (15%) Query: 23 KASGDQYHYLAHVLRMKEGDNILLFNGKDGEWLSKISYVGKSIRFKVEYQ-SRSQTK 78 S + + R+ E + S +Q + + Sbjct: 22 SLSNWSEDLMLNWNRLSPS--------NQTEKQAAFSNGLSQPVQDARFQIIQLPNR 70 >3cyy_A Tight junction protein ZO-1; protein-ligand complex, alternative splicing, cell junction, membrane, phosphoprotein, polymorphism; 2.40A {Homo sapiens} (A:) Length = 92 Score = 25.6 bits (56), Expect = 6.6 Identities = 11/47 (23%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Query: 37 RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVEYQSRSQT 77 ++EGD +L NG E +S I ++ V+ R+ Sbjct: 41 NIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATL 87 >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} (A:) Length = 117 Score = 25.6 bits (56), Expect = 6.9 Identities = 12/69 (17%), Positives = 25/69 (36%), Gaps = 16/69 (23%) Query: 25 SGDQYHYLAHVL---------RMKEGDNILLFNGKD-------GEWLSKISYVGKSIRFK 68 G+ ++ + R+KE D IL NG+ + +S + +++ Sbjct: 46 RGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLV 105 Query: 69 VEYQSRSQT 77 + S Q Sbjct: 106 IARGSLPQY 114 >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} (A:) Length = 114 Score = 25.7 bits (56), Expect = 7.0 Identities = 11/76 (14%), Positives = 23/76 (30%), Gaps = 13/76 (17%) Query: 15 PLCIKTQGKASGDQYHYLAHVLR--------MKEGDNILLFNGKDGEWLS-----KISYV 61 L +++HV ++ GD I+ NG D L + Sbjct: 28 GLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKS 87 Query: 62 GKSIRFKVEYQSRSQT 77 +S+ + + + Sbjct: 88 SRSLTISIVAAAGREL 103 >3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} (A:1-217) Length = 217 Score = 25.4 bits (55), Expect = 7.1 Identities = 5/32 (15%), Positives = 9/32 (28%) Query: 24 ASGDQYHYLAHVLRMKEGDNILLFNGKDGEWL 55 A D + + N+ G +W Sbjct: 169 AINDIQRVTQVXRAVPKSSNVAFICGTAEKWA 200 >2joa_A Serine protease HTRA1; PDZ, beta-sandwich, cyclically-permuted, protein binding; NMR {Homo sapiens} (A:) Length = 105 Score = 25.3 bits (55), Expect = 7.6 Identities = 9/48 (18%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Query: 33 AHVLRMKEGDNILLFNGK---DGEWLSKISYVGKSIRFKVEYQSRSQT 77 A +KE D I+ NG+ +S + ++ V + Sbjct: 48 AEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIM 95 >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A (A:) Length = 90 Score = 25.2 bits (55), Expect = 7.7 Identities = 9/44 (20%), Positives = 15/44 (34%), Gaps = 6/44 (13%) Query: 33 AHVLRMKEGDNILLFNGKDGEWLS------KISYVGKSIRFKVE 70 A ++ D ++ NG++ E L I R V Sbjct: 41 AARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVV 84 >2r4h_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; transferase, structural genomics, structural genomics consortium, SGC; HET: HIS; 2.05A {Homo sapiens} (A:) Length = 92 Score = 25.2 bits (55), Expect = 8.1 Identities = 13/77 (16%), Positives = 26/77 (33%), Gaps = 15/77 (19%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KIS 59 +G + Y+ + +M+ GD IL NG+ + + I Sbjct: 14 GFGFSLRGGREYNMDLYVLRLAEDGPAERSGKMRIGDEILEINGETTKNMKHSRAIELIK 73 Query: 60 YVGKSIRFKVEYQSRSQ 76 G+ +R ++ S Sbjct: 74 NGGRRVRLFLKRGETSV 90 >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.70A {Homo sapiens} (A:) Length = 87 Score = 25.2 bits (55), Expect = 8.2 Identities = 12/70 (17%), Positives = 23/70 (32%), Gaps = 14/70 (20%) Query: 15 PLCIKTQGKASGDQYHYLAHVLR--------MKEGDNILLFNGKDGEWLS------KISY 60 P + G + V ++ GD I+ NG+ E + KI Sbjct: 13 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQ 72 Query: 61 VGKSIRFKVE 70 +R +++ Sbjct: 73 SPSPLRLQLD 82 >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} (A:) Length = 113 Score = 25.3 bits (55), Expect = 8.2 Identities = 9/68 (13%), Positives = 22/68 (32%), Gaps = 15/68 (22%) Query: 24 ASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS------KISYVGKSIRFK 68 + ++ ++ + EGD +L NG + +S + ++ F Sbjct: 44 RNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFV 103 Query: 69 VEYQSRSQ 76 + S Sbjct: 104 LIPSSGPS 111 >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} (A:) Length = 85 Score = 25.1 bits (55), Expect = 8.4 Identities = 9/73 (12%), Positives = 23/73 (31%), Gaps = 17/73 (23%) Query: 15 PLCIKTQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS--------K 57 G D++ + ++ +M+ GD I+ N + + Sbjct: 12 GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ 71 Query: 58 ISYVGKSIRFKVE 70 +G S+ ++ Sbjct: 72 SIPIGASVDLELC 84 >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, structural genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} (A:) Length = 103 Score = 25.3 bits (55), Expect = 8.5 Identities = 10/45 (22%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Query: 38 MKEGDNILLFNGKD------GEWLSKISYVGKSIRFKVEYQSRSQ 76 +K GD I+ +G D + + I G + F V+ ++ Sbjct: 58 LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR 102 >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} (A:) Length = 118 Score = 25.3 bits (55), Expect = 8.5 Identities = 9/46 (19%), Positives = 15/46 (32%), Gaps = 9/46 (19%) Query: 20 TQGKASGDQYHYLAHVL---------RMKEGDNILLFNGKDGEWLS 56 G S ++ V + +GD I+ NGK + Sbjct: 35 EGGVDSPVGKVVVSAVYEGGAAERHGGVVKGDEIMAINGKIVTDYT 80 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.136 0.414 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,873,622 Number of extensions: 80822 Number of successful extensions: 407 Number of sequences better than 10.0: 1 Number of HSP's gapped: 390 Number of HSP's successfully gapped: 81 Length of query: 245 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 159 Effective length of database: 2,048,819 Effective search space: 325762221 Effective search space used: 325762221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.7 bits)