>TIGR01686 FkbH FkbH domain; InterPro: IPR010037 This entry describes a domain of unknown function. One of proteins with this domain is a modular polyketide synthase, which is 4800 amino acids in length from Streptomyces avermilitis, where the domain is the C-terminal segment. By contrast, the FkbH protein from Streptomyces hygroscopicus (Q84G18 from SWISSPROT) apparently contains only this domain. The remaining members of the family all contain an additional N-terminal domain of between 200 and 275 amino acids, which show less than 20 0dentity to one another. It seems likely then that these proteins are involved in disparate functions, probably the biosynthesis of different natural products. For instance, the FkbH gene is found in a gene cluster believed to be responsible for the biosynthesis of unusual 'PKS extender units' in the ascomycin pathway . This domain is composed of two parts, the first of which is a member of subfamily IIIC of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. All of the characterised enzymes within subfamily III are phosphatases, and all of the active site residues characteristic of HAD-superfamily phosphatases are present in this domain. The C-terminal portion of this domain is unique to this family (by BLAST)..

Probab=90.81 E-value=0.65 Score=25.24 Aligned_cols=124 Identities=15% Similarity=0.222 Sum_probs=83.8 Q ss_pred CHHHHCCEEEEEECCHHHHHHHHHHHCCCCCCC-------CEEEE-EECCCCCCCCEEEEEEE---CCEEEEEEEEEEEE Q ss_conf 033201203442079899999999853898721-------00131-10388887607899998---89899999987761 Q gi|254781162|r 26 RWQKIGAFFLERLEHDSSICAMHADSFGPGRFV-------RAAVL-LREQGMHDLSLSFLCAE---GKRIVGSVRMTPIS 94 (192) Q Consensus 26 ~~~~~~~~~~~R~e~~~di~ai~~~~fgpgr~~-------~~~~~-lR~~~~~~~~lslVA~~---~~~IVG~i~~~pv~ 94 (192) T Consensus 190 yL~~Lel~l~~~~~~~~~v~Rv~~L~~rTnQf~~~~~~~~~~dl~~~~~~~s~~~v~~~~~~DrfgD~G~vG~~~~~~-- 267 (337) T TIGR01686 190 YLKKLELSLDISKLKEEEVQRVEELVRRTNQFNLTAERLDEEDLKQTMEEESAEEVLTVAMSDRFGDSGLVGILLLEK-- 267 (337) T ss_pred HHHHHCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEEEEC-- T ss_conf 874010054210136213604888731133231210136777899984489853899998641458876089999852-- Q ss_pred ECCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHH---HCCCCEEEEEEC--------HHHHHHCCCEE Q ss_conf 188223899767885111389958999999999996---138847998408--------65787429487 Q gi|254781162|r 95 IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE---KKGSQVIVLVGD--------IAYYSKLGFQA 153 (192) Q Consensus 95 ~~~~~~~~LgplaV~P~~rg~GiG~~Li~~~l~~a~---~~g~~~v~l~g~--------~~yY~rfGF~~ 153 (192) T Consensus 268 --~e~~l~i~~l~~SCR~l~r~~e~~~L~~l~d~A~hff~~g~~~~~~~y~~T~rN~~~~~~~~~~g~~~ 335 (337) T TIGR01686 268 --KEGQLVIKDLVMSCRVLGRGVEERLLRWLVDQAKHFFELGAHKVRLIYRRTERNVPVESFYEELGFED 335 (337) T ss_pred --CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECCCCCCHHHHHHHHHHCCCC T ss_conf --87515287676640141011679999999998899998413540310068987768999999853123

HHsearch alignment for GI: 254781162 and conserved domain: TIGR01686