HHsearch results for GI: 254781162 and protein with PDBid: 2fe7_A

>2fe7_A Probable N-acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1
Probab=99.65  E-value=3.8e-15  Score=107.30  Aligned_cols=126  Identities=14%  Similarity=0.094  Sum_probs=93.4

Q ss_pred             CCEEEEEECCHHHHHHHHHHH-----CC--CCCC--CCEEEEEECCCCCCCCEEEEEEECCEEEEEEEEEEEEEC--CCC
Q ss_conf             120344207989999999985-----38--9872--100131103888876078999988989999998776118--822
Q gi|254781162|r   31 GAFFLERLEHDSSICAMHADS-----FG--PGRF--VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE--KIT   99 (192)
Q Consensus        31 ~~~~~~R~e~~~di~ai~~~~-----fg--pgr~--~~~~~~lR~~~~~~~~lslVA~~~~~IVG~i~~~pv~~~--~~~   99 (192)
                      .|.+.||+-+.+|+++|.++.     |.  +...  +...+.-..-.......++||+++++|||++.+++....  ...
T Consensus         8 ~M~i~IR~a~~~D~~~i~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~~~~~ivG~~~~~~~~~~~~~~~   87 (166)
T 2fe7_A            8 HMTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLFAEGSPTRALMCLSEGRPIGYAVFFYSYSTWLGRN   87 (166)
T ss_dssp             ---CEEEECCGGGHHHHHHHHHHHHHHTTCGGGCCCCHHHHHHHHTSTTCSEEEEEEEETTEEEEEEEEEEEEETTTTEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCCC
T ss_conf             73079668999999999999999998735766433899999986436688619999999999999998412355334687


Q ss_pred             EEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEC------HHHHHHCCCEECCC
Q ss_conf             3899767885111389958999999999996138847998408------65787429487463
Q gi|254781162|r  100 GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD------IAYYSKLGFQAVPW  156 (192)
Q Consensus       100 ~~~LgplaV~P~~rg~GiG~~Li~~~l~~a~~~g~~~v~l~g~------~~yY~rfGF~~~~~  156 (192)
                      ...+..++|+|+|||+|||++|++++++.|++.|+..+.|...      ..||+|+||++...
T Consensus        88 ~~~i~~l~V~~~~rg~GiG~~L~~~~~~~a~~~g~~~i~l~v~~~N~~A~~fY~k~GF~~~~~  150 (166)
T 2fe7_A           88 GIYLEDLYVTPEYRGVGAGRRLLRELAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDE  150 (166)
T ss_dssp             EEEEEEEEECGGGCC--HHHHHHHHHHHHHHHTTCSEEEEEEETTCHHHHHHHHHTTCEECTT
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCCEEECC
T ss_conf             278735741400016699999999999999966898799999598899999999879989367