HHsearch results for GI: 254781162 and protein with PDBid: 3d2m_A

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*
Probab=99.68  E-value=1.3e-16  Score=115.80  Aligned_cols=124  Identities=19%  Similarity=0.228  Sum_probs=91.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHH---CCCCCCCCEEEEEECCCCCCCCEEEEEEECCEEEEEEEEEEEEECCCCEEEEEEEE
Q ss_conf             120344207989999999985---38987210013110388887607899998898999999877611882238997678
Q gi|254781162|r   31 GAFFLERLEHDSSICAMHADS---FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIV  107 (192)
Q Consensus        31 ~~~~~~R~e~~~di~ai~~~~---fgpgr~~~~~~~lR~~~~~~~~lslVA~~~~~IVG~i~~~pv~~~~~~~~~Lgpla  107 (192)
                      +..+.||+-+..|+.+|.++.   +..+..   .-+-++.........+||+.+|+|||++.+.+..  ......+..++
T Consensus       304 ~~~~~iR~A~~~D~~~i~~l~~~~~~~~~l---~~~~~e~l~~~~~~~~V~e~dg~ivG~~~l~~~~--~~~~~ei~~l~  378 (456)
T 3d2m_A          304 EAFVSIRQAHSGDIPHIAALIRPLEEQGIL---LHRSREYLENHISEFSILEHDGNLYGCAALKTFA--EADCGEIACLA  378 (456)
T ss_dssp             CCCCEEEECCGGGHHHHHHHHHHHHHHTSS---CCCCHHHHHHHGGGEEEEEETTEEEEEEEEEECS--STTEEEEEEEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCC---CCCCHHHHHCCCCEEEEEEECCCEEEEEEEEECC--CCCEEEEEEEE
T ss_conf             653212446644578899998887642365---4478999731313699999899279999999728--89979999999


Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE--CHHHHHHCCCEECCCCCE
Q ss_conf             8511138995899999999999613884799840--865787429487463653
Q gi|254781162|r  108 VHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG--DIAYYSKLGFQAVPWKSL  159 (192)
Q Consensus       108 V~P~~rg~GiG~~Li~~~l~~a~~~g~~~v~l~g--~~~yY~rfGF~~~~~~~l  159 (192)
                      |+|+|||+|+|++|++++++.|+++|+..+++..  ...||+|+||+.+....+
T Consensus       379 V~~~~rg~GiG~~Ll~~~~~~a~~~g~~~l~~~t~~a~~~y~~~GF~~~~~~~l  432 (456)
T 3d2m_A          379 VSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDEL  432 (456)
T ss_dssp             ECGGGTTSSHHHHHHHHHHHHHHHTTCCEEEEEESSCHHHHHTTTCEEECGGGS
T ss_pred             ECHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHCCCEECCHHHC
T ss_conf             998885999899999999999998799899995132689999779998573559