BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781162|ref|YP_003065575.1| GCN5-related
N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (192 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040839|gb|ACT57635.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 192

 Score =  234 bits (596), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 192/192 (100%), Positives = 192/192 (100%)

Query: 1   MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA 60
           MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA
Sbjct: 1   MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA 60

Query: 61  AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK 120
           AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK
Sbjct: 61  AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK 120

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA
Sbjct: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180

Query: 181 QNIKGIVRCREV 192
           QNIKGIVRCREV
Sbjct: 181 QNIKGIVRCREV 192


>gi|261219686|ref|ZP_05933967.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261322575|ref|ZP_05961772.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260924775|gb|EEX91343.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261295265|gb|EEX98761.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 186

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 105/172 (61%)

Query: 17  FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF 76
             F+       Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF
Sbjct: 10  STFLVMISPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSF 69

Query: 77  LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
           +   G  +VGSVR+TPI + +    LLGP+ V P ++  GIG +L+ M+++AA K G ++
Sbjct: 70  VALMGGIVVGSVRLTPIIVGQTPALLLGPLAVRPEWKKHGIGGRLMRMALEAAAKAGHKL 129

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           ++LVGD  YY   GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 130 VILVGDEPYYGPFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 181


>gi|319408921|emb|CBI82578.1| Acetyltransferase, GNAT family protein [Bartonella schoenbuchensis
           R1]
          Length = 183

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/155 (44%), Positives = 99/155 (63%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
           E ++HD  I  ++   FGPGRFVRA+ LLRE G HD  LSF+      ++GSVRMTPI I
Sbjct: 26  EIIDHDDQIKQINQTVFGPGRFVRASYLLREDGKHDRQLSFVACLEDHVIGSVRMTPIYI 85

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
            + T +LLGP+VV P ++N G+G KL+ M++ AAE     +++L+GD  YY +  F+ V 
Sbjct: 86  GEQTAYLLGPLVVLPDHKNIGVGSKLVRMALQAAENCNVPLVILIGDKDYYGRFNFKNVQ 145

Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              + +PAPV+P R+L L L ++  +   G VR R
Sbjct: 146 HGQIQMPAPVNPQRLLVLELQEDALKTAHGKVRYR 180


>gi|220925014|ref|YP_002500316.1| GCN5-related N-acetyltransferase [Methylobacterium nodulans ORS
           2060]
 gi|219949621|gb|ACL60013.1| GCN5-related N-acetyltransferase [Methylobacterium nodulans ORS
           2060]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/152 (41%), Positives = 90/152 (59%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
           ER+    +I  +H  +FGPGRF R A  LRE   H   LSF    G  +VGSVR++P+ I
Sbjct: 11  ERVGDSDAIDRLHERAFGPGRFARTAYRLREGVAHLPDLSFTALVGTLLVGSVRVSPVRI 70

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
                 +LGP+ V P + ++GIG  L++ S+DAA   G  +++LVGD  YY++ GF+ VP
Sbjct: 71  GGTPALMLGPLTVDPAFGSRGIGAALMTASLDAARDGGHGLVLLVGDAPYYARFGFRPVP 130

Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            + L LP PVDP R L L L +   + + G +
Sbjct: 131 PRRLTLPGPVDPARFLVLELREGALEGVTGAI 162


>gi|225628000|ref|ZP_03786036.1| acetyltransferase [Brucella ceti str. Cudo]
 gi|260755277|ref|ZP_05867625.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|261315730|ref|ZP_05954927.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318168|ref|ZP_05957365.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261755506|ref|ZP_05999215.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265984601|ref|ZP_06097336.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|225617163|gb|EEH14209.1| acetyltransferase [Brucella ceti str. Cudo]
 gi|260675385|gb|EEX62206.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|261297391|gb|EEY00888.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304756|gb|EEY08253.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261745259|gb|EEY33185.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|264663193|gb|EEZ33454.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 186

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 106/172 (61%)

Query: 17  FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF 76
             F+       Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF
Sbjct: 10  STFLVMISPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSF 69

Query: 77  LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
           +   G  +VGSVR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++
Sbjct: 70  VALMGGIVVGSVRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKL 129

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           ++LVGD  YY   GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 130 VILVGDEPYYGPFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 181


>gi|261752848|ref|ZP_05996557.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261742601|gb|EEY30527.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 186

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 106/172 (61%)

Query: 17  FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF 76
             F+       Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF
Sbjct: 10  STFLVMISPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSF 69

Query: 77  LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
           +   G  +VGSVR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++
Sbjct: 70  VALMGGIVVGSVRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKL 129

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           ++LVGD  YY   GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 130 VILVGDEPYYGPFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 181


>gi|237815952|ref|ZP_04594949.1| acetyltransferase [Brucella abortus str. 2308 A]
 gi|260758498|ref|ZP_05870846.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762322|ref|ZP_05874665.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|237789250|gb|EEP63461.1| acetyltransferase [Brucella abortus str. 2308 A]
 gi|260668816|gb|EEX55756.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672754|gb|EEX59575.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 186

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 106/172 (61%)

Query: 17  FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF 76
             F+       Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF
Sbjct: 10  STFLVMISPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSF 69

Query: 77  LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
           +   G  +VGSVR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++
Sbjct: 70  VALMGGIVVGSVRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKL 129

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           ++LVGD  YY   GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 130 VMLVGDEPYYGPFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 181


>gi|254714780|ref|ZP_05176591.1| acetyltransferase [Brucella ceti M644/93/1]
 gi|254717841|ref|ZP_05179652.1| acetyltransferase [Brucella ceti M13/05/1]
          Length = 168

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 103/161 (63%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++  GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKHGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|17986739|ref|NP_539373.1| acetyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260884292|ref|ZP_05895906.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261222698|ref|ZP_05936979.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265989199|ref|ZP_06101756.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991613|ref|ZP_06104170.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265998662|ref|ZP_06111219.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|265999371|ref|ZP_05466012.2| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|17982365|gb|AAL51637.1| acetyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260873820|gb|EEX80889.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260921282|gb|EEX87935.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262553286|gb|EEZ09120.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263002397|gb|EEZ14972.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093504|gb|EEZ17538.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661396|gb|EEZ31657.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 172

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 7   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 66

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 67  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 126

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 127 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 167


>gi|188579692|ref|YP_001923137.1| GCN5-related N-acetyltransferase [Methylobacterium populi BJ001]
 gi|179343190|gb|ACB78602.1| GCN5-related N-acetyltransferase [Methylobacterium populi BJ001]
          Length = 174

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/158 (41%), Positives = 86/158 (54%), Gaps = 3/158 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R EH      I  +HA +FGPGRF R A  LRE       L      G  +VGSVR+
Sbjct: 6   LVIRPEHPDDAPAIERLHARAFGPGRFARTAYRLREGAAPLPDLCLTALVGTYLVGSVRI 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P   E  +  +LGP+ V P++ ++GIG  L+  S+DAA   G  ++VLVGD  YY + G
Sbjct: 66  GPAEAEGGSLLVLGPLTVDPIFSDRGIGTSLMQASLDAARAAGHGLVVLVGDAPYYRRFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           FQ VP   L +P PVDP R L+L L    +  + G VR
Sbjct: 126 FQPVPAGRLAMPGPVDPARFLWLELTDGASTGLSGTVR 163


>gi|23502424|ref|NP_698551.1| acetyltransferase [Brucella suis 1330]
 gi|161619503|ref|YP_001593390.1| GCN5-related N-acetyltransferase [Brucella canis ATCC 23365]
 gi|163843813|ref|YP_001628217.1| GCN5-related N-acetyltransferase [Brucella suis ATCC 23445]
 gi|225853038|ref|YP_002733271.1| GCN5-related N-acetyltransferase [Brucella melitensis ATCC 23457]
 gi|254689746|ref|ZP_05153000.1| acetyltransferase [Brucella abortus bv. 6 str. 870]
 gi|254694235|ref|ZP_05156063.1| acetyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|254704813|ref|ZP_05166641.1| acetyltransferase [Brucella suis bv. 3 str. 686]
 gi|254708228|ref|ZP_05170056.1| acetyltransferase [Brucella pinnipedialis M163/99/10]
 gi|254710597|ref|ZP_05172408.1| acetyltransferase [Brucella pinnipedialis B2/94]
 gi|254719593|ref|ZP_05181404.1| acetyltransferase [Brucella sp. 83/13]
 gi|256032091|ref|ZP_05445705.1| acetyltransferase [Brucella pinnipedialis M292/94/1]
 gi|256045183|ref|ZP_05448082.1| acetyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256160287|ref|ZP_05457981.1| acetyltransferase [Brucella ceti M490/95/1]
 gi|256255492|ref|ZP_05461028.1| acetyltransferase [Brucella ceti B1/94]
 gi|256257999|ref|ZP_05463535.1| acetyltransferase [Brucella abortus bv. 9 str. C68]
 gi|256369976|ref|YP_003107487.1| acetyltransferase, GNAT family [Brucella microti CCM 4915]
 gi|260169226|ref|ZP_05756037.1| acetyltransferase [Brucella sp. F5/99]
 gi|260565219|ref|ZP_05835703.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|261214541|ref|ZP_05928822.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261758737|ref|ZP_06002446.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|294852878|ref|ZP_06793551.1| acetyltransferase [Brucella sp. NVSL 07-0026]
 gi|297248829|ref|ZP_06932547.1| acetyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306837918|ref|ZP_07470778.1| acetyltransferase [Brucella sp. NF 2653]
 gi|23348412|gb|AAN30466.1| acetyltransferase, GNAT family [Brucella suis 1330]
 gi|161336314|gb|ABX62619.1| GCN5-related N-acetyltransferase [Brucella canis ATCC 23365]
 gi|163674536|gb|ABY38647.1| GCN5-related N-acetyltransferase [Brucella suis ATCC 23445]
 gi|225641403|gb|ACO01317.1| GCN5-related N-acetyltransferase [Brucella melitensis ATCC 23457]
 gi|256000139|gb|ACU48538.1| acetyltransferase, GNAT family [Brucella microti CCM 4915]
 gi|260151287|gb|EEW86381.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260916148|gb|EEX83009.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261738721|gb|EEY26717.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|294821467|gb|EFG38466.1| acetyltransferase [Brucella sp. NVSL 07-0026]
 gi|297175998|gb|EFH35345.1| acetyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306407006|gb|EFM63225.1| acetyltransferase [Brucella sp. NF 2653]
 gi|326409580|gb|ADZ66645.1| GCN5-related N-acetyltransferase [Brucella melitensis M28]
 gi|326539284|gb|ADZ87499.1| GCN5-related N-acetyltransferase [Brucella melitensis M5-90]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|148559552|ref|YP_001259434.1| acetyltransferase [Brucella ovis ATCC 25840]
 gi|148370809|gb|ABQ60788.1| acetyltransferase, GNAT family [Brucella ovis ATCC 25840]
          Length = 186

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 106/172 (61%)

Query: 17  FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF 76
             F+       Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF
Sbjct: 10  STFLVMISPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSF 69

Query: 77  LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
           +   G  +VGSVR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++
Sbjct: 70  VALMGGIVVGSVRLTPIIVGQTPALLLGPLDVRPEWKKRGIGGRLMRMALEAAAKAGHKL 129

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           ++LVGD  YY   GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 130 VILVGDEPYYGPFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 181


>gi|254702281|ref|ZP_05164109.1| acetyltransferase [Brucella suis bv. 5 str. 513]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|62290444|ref|YP_222237.1| acetyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|82700367|ref|YP_414941.1| GCN5-related N-acetyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024674|ref|YP_001935442.1| GCN5-related N-acetyltransferase [Brucella abortus S19]
 gi|254697891|ref|ZP_05159719.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730781|ref|ZP_05189359.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260546979|ref|ZP_05822718.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|62196576|gb|AAX74876.1| acetyltransferase, GNAT family [Brucella abortus bv. 1 str. 9-941]
 gi|82616468|emb|CAJ11533.1| GCN5-related N-acetyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|189020246|gb|ACD72968.1| GCN5-related N-acetyltransferase [Brucella abortus S19]
 gi|260096029|gb|EEW79906.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVMLVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|315122547|ref|YP_004063036.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495949|gb|ADR52548.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 167

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/160 (68%), Positives = 139/160 (86%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           FF E  +HDS+ICAMHA++FGPGRFVRAA+LLREQG HDLSLSFLCA+G++IVGSVRM P
Sbjct: 7   FFPETADHDSTICAMHAEAFGPGRFVRAAMLLREQGTHDLSLSFLCADGEKIVGSVRMMP 66

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           ISIEKI G++LGPIVVHPLY+NKGIG+KLI M++  A  KGS+V+VLVGD  YY+K+GFQ
Sbjct: 67  ISIEKIKGYMLGPIVVHPLYRNKGIGKKLIQMAIKGARTKGSEVVVLVGDADYYTKIGFQ 126

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
            VP+KSL+ P PV+P RV+F P+  N+ +N+KG++RCR+V
Sbjct: 127 KVPFKSLLFPVPVNPQRVMFYPIENNIVENLKGVIRCRKV 166


>gi|265995451|ref|ZP_06108008.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766564|gb|EEZ12353.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 172

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/161 (44%), Positives = 103/161 (63%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 7   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 66

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVG   YY 
Sbjct: 67  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGYEPYYG 126

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 127 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 167


>gi|306843094|ref|ZP_07475716.1| acetyltransferase [Brucella sp. BO2]
 gi|306844559|ref|ZP_07477148.1| acetyltransferase [Brucella sp. BO1]
 gi|306275170|gb|EFM56926.1| acetyltransferase [Brucella sp. BO1]
 gi|306286699|gb|EFM58252.1| acetyltransferase [Brucella sp. BO2]
          Length = 168

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 72/161 (44%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       ++GIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVRGIVR 163


>gi|256114134|ref|ZP_05454888.1| acetyltransferase [Brucella melitensis bv. 3 str. Ether]
          Length = 168

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 72/161 (44%), Positives = 103/161 (63%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVG   YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGYEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|261325619|ref|ZP_05964816.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301599|gb|EEY05096.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 172

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 7   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 66

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 67  VRLTPIIVGQTLALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 126

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 127 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 167


>gi|323137669|ref|ZP_08072745.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
 gi|322396966|gb|EFX99491.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
          Length = 176

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 62/156 (39%), Positives = 93/156 (59%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           FF      ++ I  +   +FGPGR+ R A  LRE    DLSLSF+   G  +VG+ RMTP
Sbjct: 19  FFPATAADEAHIEKLDERAFGPGRYARTAYRLREGVAPDLSLSFVARVGTLLVGANRMTP 78

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           + +      LLGP+ V P ++++G+G KL+  S+DAA + G  +++LVGD  YYS++GF 
Sbjct: 79  VLVGSSPALLLGPLTVEPAFRSQGVGEKLVKHSLDAAREAGHGLVLLVGDEDYYSRMGFA 138

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
            VP   +++P PVDP+R+L+  L         G +R
Sbjct: 139 RVPRGKIVMPGPVDPDRLLYCELRPGALDAASGKMR 174


>gi|240137008|ref|YP_002961477.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens AM1]
 gi|240006974|gb|ACS38200.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens AM1]
          Length = 167

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 66/162 (40%), Positives = 87/162 (53%), Gaps = 3/162 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R EH      I  +HA +FGPGRF R A  LRE       L      G  +VGSVR+
Sbjct: 6   LVIRPEHPDDAAAIERLHARAFGPGRFARTAYRLREGVAPLPDLCLTALVGTYLVGSVRI 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P   +  +  +LGP+ V P + ++GIG  L+  S+DAA   G  ++VLVGD  YY + G
Sbjct: 66  GPAEAQGGSLLVLGPLTVDPSFSDRGIGTSLMQASLDAARAAGHGLVVLVGDAPYYRRFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           F  VP   LILP PVDP R L+L L    +  + G +R R V
Sbjct: 126 FVPVPAGRLILPGPVDPARFLWLELRDGASAGLSGAIRPRRV 167


>gi|254558861|ref|YP_003065956.1| acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens DM4]
 gi|254266139|emb|CAX21891.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens DM4]
          Length = 167

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 64/162 (39%), Positives = 87/162 (53%), Gaps = 3/162 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R EH      I  +HA +FGPGRF R A  LRE       L      G  +VGSVR+
Sbjct: 6   LVIRPEHPDDAAAIERLHARAFGPGRFARTAYRLREGVAPLPDLCLTALVGTYLVGSVRI 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P   +  +  +LGP+ V P + ++GIG  L+  S+DAA   G  ++VLVGD  YY + G
Sbjct: 66  GPAEAQGGSLLVLGPLTVDPSFSDRGIGTSLMQASLDAARAAGHGLVVLVGDAPYYRRFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           F  VP   LILP PVDP R L+L L    +  + G ++ R +
Sbjct: 126 FVPVPAGRLILPGPVDPARFLWLELRDGASAGLSGAIQPRRI 167


>gi|256061613|ref|ZP_05451754.1| GCN5-related N-acetyltransferase [Brucella neotomae 5K33]
          Length = 168

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 104/161 (64%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTLALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVDP R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDPRRMLACELSAGALNGVKGIVR 163


>gi|218528438|ref|YP_002419254.1| GCN5-related N-acetyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|218520741|gb|ACK81326.1| GCN5-related N-acetyltransferase [Methylobacterium chloromethanicum
           CM4]
          Length = 167

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 63/162 (38%), Positives = 86/162 (53%), Gaps = 3/162 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R EH      I  +HA +FGPGRF R A  LRE       L      G  +VGSVR+
Sbjct: 6   LVIRPEHPDDAAAIERLHARAFGPGRFARTAYRLREGVAPLPDLCLTALVGTYLVGSVRI 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P   +  +  +LGP+ V P + ++GIG  L+  S+DAA   G  ++VLVGD  YY + G
Sbjct: 66  GPAEAQGGSLLVLGPLTVDPSFSDRGIGTSLMHASLDAARAAGHGLVVLVGDAPYYRRFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           F  VP   L LP PVDP R L+L L    +  + G ++ R +
Sbjct: 126 FVPVPAGRLTLPGPVDPARFLWLELRDGASAGLSGAIQPRRI 167


>gi|163849797|ref|YP_001637840.1| GCN5-related N-acetyltransferase [Methylobacterium extorquens PA1]
 gi|163661402|gb|ABY28769.1| GCN5-related N-acetyltransferase [Methylobacterium extorquens PA1]
          Length = 183

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 63/162 (38%), Positives = 86/162 (53%), Gaps = 3/162 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R EH      I  +HA +FGPGRF R A  LRE       L      G  +VGSVR+
Sbjct: 22  LVIRPEHPDDAAAIERLHARAFGPGRFARTAYRLREGVAPLPDLCLTALVGTYLVGSVRI 81

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P   +  +  +LGP+ V P + ++GIG  L+  S+DAA   G  ++VLVGD  YY + G
Sbjct: 82  GPAEAQGGSLLVLGPLTVDPSFSDRGIGTSLMQASLDAARAAGHGLVVLVGDAPYYRRFG 141

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           F  VP   L LP PVDP R L+L L    +  + G ++ R +
Sbjct: 142 FVPVPAGRLTLPGPVDPARFLWLELRDGASAGLSGAIQPRRI 183


>gi|158423955|ref|YP_001525247.1| GCN5-related N-acetyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158330844|dbj|BAF88329.1| GCN5-related N-acetyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 167

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 67/154 (43%), Positives = 90/154 (58%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
            E  E +++I  +H  +FGPGRF R A  LRE   HDL+LSF    G  +VGSVR TPI 
Sbjct: 10  TESPESNAAIERLHQRTFGPGRFARTAFRLRENVPHDLTLSFTAYVGTMMVGSVRQTPIL 69

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I      LLGP+ V P ++  GIG +L+ + +DAA  +G  +I+LVGD  YY + GF+ V
Sbjct: 70  IGSQPALLLGPLTVEPPFRAVGIGGRLMRVCMDAARDQGHGLILLVGDEPYYRRFGFKVV 129

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           P   + +P PVDP R+L   L     + I G  R
Sbjct: 130 PHGRIAMPGPVDPGRLLIAELKDGAFEGITGPAR 163


>gi|254509572|ref|ZP_05121639.1| acetyltransferase, gnat family [Rhodobacteraceae bacterium KLH11]
 gi|221533283|gb|EEE36271.1| acetyltransferase, gnat family [Rhodobacteraceae bacterium KLH11]
          Length = 164

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 79/158 (50%), Gaps = 6/158 (3%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F  R E       + A++   F PGR   ++  LR+       LS +  +G   + G++R
Sbjct: 4   FDIRPEEPDDWWEVEALYDLCFAPGREALSSYRLRDDVPPVAELSLVARDGQGILAGAIR 63

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             P+ +      LLGP+ VHP +Q +G+G  LI   V+A    G   ++LVGD  YY++ 
Sbjct: 64  FWPVHVGAHDALLLGPVAVHPTHQGEGLGGYLIQQGVEAGRDIGWDRVMLVGDAPYYARF 123

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           GF   P   + +P P +P+RVL L L   V   I+G V
Sbjct: 124 GFN--PLTGVEMPPPTNPDRVLGLELTPGVWSGIQGFV 159


>gi|260565945|ref|ZP_05836415.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260155463|gb|EEW90543.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 168

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 72/161 (44%), Positives = 103/161 (63%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G HDL+LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHDLNLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR+TPI + +    LLGP+ V P ++ +GIG +L+ M+++AA K G ++++LVGD  YY 
Sbjct: 63  VRLTPIIVGQTPALLLGPLAVRPEWKKRGIGGRLMRMALEAAAKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ V   S+++PAPVD  R+L   L       +KGIVR
Sbjct: 123 PFGFKPVQPGSMVMPAPVDLRRMLACELSAGALNGVKGIVR 163


>gi|239832443|ref|ZP_04680772.1| acetyltransferase [Ochrobactrum intermedium LMG 3301]
 gi|239824710|gb|EEQ96278.1| acetyltransferase [Ochrobactrum intermedium LMG 3301]
          Length = 187

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 78/188 (41%), Positives = 110/188 (58%), Gaps = 7/188 (3%)

Query: 1   MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA 60
           MH  ++ +  F         C  +   Q    +  E   HD  I A++A++FGPGRF RA
Sbjct: 1   MHSIDLTVPDF-------SYCDLKPMQQLELTYAQECPAHDIEIEAINAEAFGPGRFTRA 53

Query: 61  AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK 120
           A  +RE G H L LSF+   G  +VGSVR TP+ + K    LLGP+ V P ++ +GIG +
Sbjct: 54  AHFIREGGPHALDLSFVALMGGIVVGSVRQTPVVVGKTPALLLGPLAVRPEWKKRGIGGR 113

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           L+ MS++AAEK+G ++++LVGD  YY   GF+ V   S+I+PAPVDP R+L   L     
Sbjct: 114 LMRMSLEAAEKEGHKLVILVGDEPYYGPFGFKMVAPGSMIMPAPVDPRRMLACELAPGAV 173

Query: 181 QNIKGIVR 188
             + GIVR
Sbjct: 174 NGVGGIVR 181


>gi|59711727|ref|YP_204503.1| acetyltransferase [Vibrio fischeri ES114]
 gi|59479828|gb|AAW85615.1| acetyltransferase [Vibrio fischeri ES114]
          Length = 200

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 95/194 (48%), Gaps = 18/194 (9%)

Query: 9   RKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSF---------GPG-RFV 58
           R+F+S   FE +C ++ R++ +      R+E +S   A+   ++          PG +  
Sbjct: 8   RRFISNDLFEVVCLQK-RFKTLEIDMKFRIEKESDHKAIENITYKAFENHPHHAPGAKPT 66

Query: 59  RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKG 116
              ++ R +  + L+LS +  +G  I+G +  +P+ I       + LGP+ V P +Q++G
Sbjct: 67  EHKIIERLRENNALTLSLVAEKGDTIIGHIAFSPVLINGKDSKWYGLGPVSVLPEHQSEG 126

Query: 117 IGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           IG +LI + ++   ++G++  VL+G+  YY + GF++     L     V     L LPL 
Sbjct: 127 IGSRLIRLGLEQLIEQGAEGAVLLGEPEYYQRFGFKSDEKLILE---GVPAEYFLSLPLT 183

Query: 177 QNVAQNIKGIVRCR 190
           +   +  +G V   
Sbjct: 184 E--IEMPQGEVNYH 195


>gi|99082158|ref|YP_614312.1| GCN5-related N-acetyltransferase [Ruegeria sp. TM1040]
 gi|99038438|gb|ABF65050.1| GCN5-related N-acetyltransferase [Ruegeria sp. TM1040]
          Length = 166

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           E  E    + A++   F PGR   ++  LR+       LS +  +    + G++R  P+ 
Sbjct: 7   ETPEDSWEVEALYDLCFAPGRTALSSYRLRDGVAPVQRLSQVARDSDGILAGAIRFWPVH 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ VHP  Q +GIG  LI  S+  AE    Q ++LVGD  YY + GF+ +
Sbjct: 67  VGTQDALLLGPVAVHPTRQGEGIGAALIRDSLWKAEDSHWQRVILVGDAPYYQRFGFERL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               + +P P +P RVL L L       ++G V
Sbjct: 127 --DGVEMPPPTNPERVLGLALNPGAWGGVRGQV 157


>gi|153008935|ref|YP_001370150.1| GCN5-like N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560823|gb|ABS14321.1| GCN5-related N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 168

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/161 (45%), Positives = 101/161 (62%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           Q    +  E   HD  I A++A++FGPGRF RAA  +RE G H L LSF+   G  +VGS
Sbjct: 3   QLELTYAQECPAHDIEIEAINAEAFGPGRFTRAAHFIREGGPHALDLSFVALMGGIVVGS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VR TP+ + K    LLGP+ V P ++ +GIG KL+ MS++AAEK G ++++LVGD  YY 
Sbjct: 63  VRQTPVIVGKTPALLLGPLAVRPEWKKRGIGGKLMRMSLEAAEKAGHKLVILVGDEPYYG 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             GF+ VP  S+++PA VDP R+L   L       + GIVR
Sbjct: 123 PFGFKMVPAGSMVMPASVDPRRMLACELATGALNGVSGIVR 163


>gi|254461624|ref|ZP_05075040.1| acetyltransferase, gnat family [Rhodobacterales bacterium HTCC2083]
 gi|206678213|gb|EDZ42700.1| acetyltransferase, gnat family [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 186

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 90/177 (50%), Gaps = 3/177 (1%)

Query: 12  LSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHD 71
           ++I     +  ++   + +     E+ E    + A++   F PGR   ++  LR+     
Sbjct: 8   IAIDMLPAMPVKKRESRDVYTLRPEKTEDWWEVEALYDLCFAPGREALSSYRLRDGVPTV 67

Query: 72  LSLSFLCAEGKRIV-GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE 130
             LS +  +   I+ G++R  P+ I   +  LLGPI VHP  Q +G+G  LI  S+  A+
Sbjct: 68  AGLSSVARDADDILSGAIRYWPVRIGDHSALLLGPIAVHPTRQGEGLGGALIRNSLSRAQ 127

Query: 131 KKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            +G   ++LVGD  YY+K GF  +    +++P P +P RVL L +     +++KG V
Sbjct: 128 DQGWARVMLVGDAPYYAKFGFSQLS--GVVMPPPTNPERVLGLHVDGPDWKDVKGYV 182


>gi|84683784|ref|ZP_01011687.1| acetyltransferase, GNAT family protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668527|gb|EAQ14994.1| acetyltransferase, GNAT family protein [Rhodobacterales bacterium
           HTCC2654]
          Length = 199

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 3/165 (1%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
           R +   +     E       + A++   F PGR   ++  LR+       LS    + + 
Sbjct: 31  RRKESALFTLARETPADWWEVEALYDLCFAPGREALSSYRLRDDVSPVDGLSLTARDPEG 90

Query: 84  IVG-SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           I+G ++R  P+ + +    LLGP+ VHP  Q +G+G  LI  S++ A  +G   ++LVGD
Sbjct: 91  ILGGAIRFWPVHVGRHDALLLGPVAVHPTRQGEGLGGLLIQHSLELARDQGWSRVMLVGD 150

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             YYS+ GF+ +    + +P P +P RVL   LV N  + I G V
Sbjct: 151 APYYSRFGFEKL--DGVEMPPPTNPERVLGYDLVPNAWEGISGKV 193


>gi|92118723|ref|YP_578452.1| GCN5-related N-acetyltransferase [Nitrobacter hamburgensis X14]
 gi|91801617|gb|ABE63992.1| GCN5-related N-acetyltransferase [Nitrobacter hamburgensis X14]
          Length = 190

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 62/155 (40%), Positives = 90/155 (58%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E      +I  +H  +FGPGRFV +A  LRE   H L LS     G  +VGSVR+ P+
Sbjct: 22  LTETANDAQAIERLHERTFGPGRFVLSAYRLREHVDHLLDLSLTARIGTLLVGSVRLLPV 81

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I      LLGP+ V P ++ +GIGR ++  ++  A  KG +++VLVGD  YYS++GF+A
Sbjct: 82  CIGDTPALLLGPLTVEPPFRGRGIGRAMLDRALSDARAKGHRLVVLVGDEPYYSRVGFKA 141

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +P   + +P PVD  R+L   LV    + + G+VR
Sbjct: 142 IPKGQVDMPGPVDRARLLVCELVPGAFEGVSGMVR 176


>gi|56697888|ref|YP_168259.1| acetyltransferase [Ruegeria pomeroyi DSS-3]
 gi|56679625|gb|AAV96291.1| acetyltransferase, GNAT family [Ruegeria pomeroyi DSS-3]
          Length = 162

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 78/153 (50%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           E  +    + A++   F PGR   ++  LR+       LS +  +    + G++R  P+ 
Sbjct: 7   ETPDDWWEVEALYDLCFAPGRTALSSYRLRDDVPPVAGLSLVARDSDGTLAGAIRFWPVH 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +  +   LLGP+ VHP +Q +G+G  LI   ++A  + G   ++LVGD  YYS+ GF   
Sbjct: 67  VGDLDALLLGPVAVHPTHQGEGLGGFLIQEGLEAGREGGWARVMLVGDAPYYSRFGF--A 124

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             + + +P P +P+RVL L L+      + G V
Sbjct: 125 RLEGVEMPPPTNPDRVLGLELIPGAWTGVSGRV 157


>gi|260431052|ref|ZP_05785023.1| acetyltransferase, gnat family [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414880|gb|EEX08139.1| acetyltransferase, gnat family [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 164

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 50/153 (32%), Positives = 81/153 (52%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPIS 94
           E  E    + A++   F PGR   ++  LR+       LS +  +G   + G++R  P+ 
Sbjct: 9   EEPEDWWEVEALYDLCFAPGREALSSYRLRDGISPVSGLSMVARDGQGILAGAIRFWPVH 68

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I      LLGP+ VHP +Q +G+G  LI   ++A   +G + ++LVGD  YYS+ GF  +
Sbjct: 69  IGAHDALLLGPVAVHPTHQGEGLGGFLIHEGIEAGRSRGWERVMLVGDAPYYSRFGFSRL 128

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             + + +P P +P+RVL L L     + I+G V
Sbjct: 129 --EGVEMPPPTNPDRVLGLELRPGAWEGIRGQV 159


>gi|218509421|ref|ZP_03507299.1| probable acetyltransferase protein [Rhizobium etli Brasil 5]
          Length = 225

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 112/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+CA+    + 
Sbjct: 59  YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICADDGETIA 118

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 119 SVRMTPVLAGTVKGHLLGPLAVRPSHKNMGIGRELVRIAVEAARRKGSEAVILVGDPPYY 178

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ + V + +KG++   
Sbjct: 179 GPLGFEKVAYNALTFPGPVDPARVLVVPIAEGVHERLKGVIAWH 222


>gi|218514065|ref|ZP_03510905.1| probable acetyltransferase protein [Rhizobium etli 8C-3]
          Length = 223

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 112/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+CA+    + 
Sbjct: 57  YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICADDGETIA 116

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 117 SVRMTPVLAGTVKGHLLGPLAVRPSHKNMGIGRELVRIAVEAARRKGSEAVILVGDPPYY 176

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ + V + +KG++   
Sbjct: 177 GPLGFEKVAYNALTFPGPVDPARVLVVPIAEGVHERLKGVIAWH 220


>gi|299134631|ref|ZP_07027823.1| GCN5-related N-acetyltransferase [Afipia sp. 1NLS2]
 gi|298590441|gb|EFI50644.1| GCN5-related N-acetyltransferase [Afipia sp. 1NLS2]
          Length = 177

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 61/155 (39%), Positives = 88/155 (56%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E      +I  +H  +FGPGRFV +A  LRE   H L LSF    G  +VGSVR  PI
Sbjct: 15  LSETPNDAQAIERLHQRTFGPGRFVLSAYRLREHVDHLLDLSFTARIGTLLVGSVRQLPI 74

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            + +    LLGP+ V P ++ +GIGR L+  +++ A+ KG +++VLVGD  YY ++GF+ 
Sbjct: 75  CVGETPALLLGPLTVEPPFRGRGIGRALMDHALNQAKAKGHRLVVLVGDEPYYGRMGFKR 134

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +P     +P PVDP R+L   L       + G +R
Sbjct: 135 IPNGVTAMPGPVDPARLLVRELADGAFDGVSGAIR 169


>gi|84501701|ref|ZP_00999873.1| acetyltransferase, GNAT family protein [Oceanicola batsensis
           HTCC2597]
 gi|84390322|gb|EAQ02881.1| acetyltransferase, GNAT family protein [Oceanicola batsensis
           HTCC2597]
          Length = 178

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 6/169 (3%)

Query: 24  RSRWQKIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
               +++G  F  R E       + A++   F PGR   ++  LR+       L  +  +
Sbjct: 5   PESDKEVGCVFALREETADDWWEVEALYDLCFAPGREALSSYRLRDGAAKVAPLCLVARD 64

Query: 81  GKRIVG-SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
               VG ++R  P+ I      LLGP+ VHP +Q +G+G  LI+ S++ A+  G   ++L
Sbjct: 65  DTASVGGAIRYWPVRIGGQRALLLGPVAVHPTHQGEGLGALLIAESLNKAQMTGWARVML 124

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           VGD  YY + GF       + +P P +P RVL   LV      ++G+VR
Sbjct: 125 VGDPPYYGRFGF--ARLDGVEMPPPTNPERVLGRDLVPGAWAGVRGVVR 171


>gi|121602912|ref|YP_989289.1| acetyltransferase, GNAT family protein [Bartonella bacilliformis
           KC583]
 gi|120615089|gb|ABM45690.1| acetyltransferase, GNAT family protein [Bartonella bacilliformis
           KC583]
          Length = 185

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 70/153 (45%), Positives = 101/153 (66%), Gaps = 1/153 (0%)

Query: 39  EHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI 98
           +HD+ I  ++   FGPGRF RA+ LLRE+G HD   SF+   G  ++GSVRMTPI++ + 
Sbjct: 30  DHDAQIEQINKVVFGPGRFTRASYLLREEGRHDCQFSFVACLGGDVIGSVRMTPITVGEQ 89

Query: 99  TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWK- 157
             +LLGP+VV P Y+N G+GRKL+ M++ AAE     +++L+GD  YY +  F+ V  + 
Sbjct: 90  AAYLLGPLVVRPEYKNAGVGRKLMYMALHAAENHNVVLVILIGDKEYYGRFWFKNVEHRQ 149

Query: 158 SLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + +PAPVDPNR+L L L +   +  KG VR R
Sbjct: 150 QIHMPAPVDPNRLLILELQKGALKVAKGKVRYR 182


>gi|259416973|ref|ZP_05740893.1| acetyltransferase, gnat family [Silicibacter sp. TrichCH4B]
 gi|259348412|gb|EEW60189.1| acetyltransferase, gnat family [Silicibacter sp. TrichCH4B]
          Length = 166

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 50/151 (33%), Positives = 77/151 (50%), Gaps = 3/151 (1%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPISIE 96
            E    + A++   F PGR   ++  LR+      +LS +  +    + G++R  P+ + 
Sbjct: 9   PEDSWEVEALYDLCFAPGRTALSSYRLRDNVAPVRALSQVARDSDGILAGAIRFWPVHVG 68

Query: 97  KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                LLGP+ VHP  Q +GIG  LI  S+  AE    Q ++LVGD  YY + GF  V  
Sbjct: 69  DSDALLLGPVAVHPTRQGEGIGASLIRDSLWKAEHSHWQRVILVGDAPYYQRFGF--VRL 126

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           + + +P P +P R+L L L  N  Q ++G V
Sbjct: 127 EGVEMPPPTNPERILGLNLSPNAWQGVQGRV 157


>gi|218671410|ref|ZP_03521080.1| probable acetyltransferase protein [Rhizobium etli GR56]
          Length = 223

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 77/164 (46%), Positives = 113/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+CA+    + 
Sbjct: 59  YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICADDGETIA 118

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 119 SVRMTPVLAGTVKGHLLGPLAVRPSHKNIGIGRELVRIAVEAARRKGSEAVILVGDPPYY 178

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ +NV + +KGI+   
Sbjct: 179 GPLGFEKVAYNALTFPGPVDPGRVLVVPIAENVHERLKGIIAWH 222


>gi|149916206|ref|ZP_01904727.1| acetyltransferase, GNAT family protein [Roseobacter sp. AzwK-3b]
 gi|149809866|gb|EDM69717.1| acetyltransferase, GNAT family protein [Roseobacter sp. AzwK-3b]
          Length = 161

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 50/153 (32%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPIS 94
           E  E    I A++   F PGR   ++  LR+       LS +  +   I+ G++R  P+ 
Sbjct: 7   ETDEDWWEIEALYDLCFAPGREALSSYRLRDGVPPVRGLSLVARDDDGILAGAIRYWPVQ 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ VHP  Q +G+G  LI  S+  A  +G   ++LVGD  YY + GF+ +
Sbjct: 67  VAGRRALLLGPVAVHPTRQGEGLGGWLIRESLVLAAAQGWDRVLLVGDEPYYGRFGFRRL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               + +P P +P RVL L L       I G V
Sbjct: 127 T--GIEMPPPTNPARVLGLELKPGAWDKITGKV 157


>gi|170742604|ref|YP_001771259.1| GCN5-related N-acetyltransferase [Methylobacterium sp. 4-46]
 gi|168196878|gb|ACA18825.1| GCN5-related N-acetyltransferase [Methylobacterium sp. 4-46]
          Length = 166

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 86/157 (54%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R E       I  +H  +FGPGRF R A  LRE   H  +LSF    G  +VGSVR+
Sbjct: 6   LVIRPERAGDSDAIGRLHERAFGPGRFARTAYRLREGVAHLPALSFTALVGTLLVGSVRV 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           TP         +LGP+ V P +  +GIG  L+  S+DAA   G  +++LVGD  YY++ G
Sbjct: 66  TPARAGGAPALVLGPLTVDPAFGGRGIGGGLMDASLDAARAGGHGLVLLVGDAPYYARFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F+ VP + L+LP PVDP R L L L +     + G +
Sbjct: 126 FRPVPPRRLVLPGPVDPARFLVLELREGALDGVSGAI 162


>gi|241205761|ref|YP_002976857.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859651|gb|ACS57318.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 180

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 112/165 (67%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+C +    + 
Sbjct: 16  YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICTDNGETIA 75

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++NKGIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 76  SVRMTPVLAGTVKGHLLGPLAVRPSHKNKGIGRELVRIAVEAARRKGSEAVILVGDPPYY 135

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             LGF+ V + +L  P PVDP RVL +P+ + V   +KG +  RE
Sbjct: 136 GPLGFEKVAYNALSFPGPVDPGRVLVVPIAEGVHALLKGTIAWRE 180


>gi|255263845|ref|ZP_05343187.1| acetyltransferase, gnat family [Thalassiobium sp. R2A62]
 gi|255106180|gb|EET48854.1| acetyltransferase, gnat family [Thalassiobium sp. R2A62]
          Length = 162

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 53/158 (33%), Positives = 82/158 (51%), Gaps = 3/158 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPI 93
            E  +    + A++   F PGR   ++  LR+       LS +  +   I+ G++R  P+
Sbjct: 6   QETAQDWWEVEALYDLCFAPGREALSSYRLRDDVPAVAELSTIVRDPDVILAGAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           SI  +T  LLGPI VHP  Q +G+G  L+  S+  A   G + ++LVGD  YY K GF+ 
Sbjct: 66  SIGAVTALLLGPIAVHPTRQGEGLGGALMRDSLARAADLGWERVMLVGDAPYYGKFGFKK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +    + +P P +P+RVL L L       I G+V+  E
Sbjct: 126 L--NDVAMPPPTNPDRVLGLALQTGAWDGISGVVKPSE 161


>gi|209550376|ref|YP_002282293.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536132|gb|ACI56067.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 166

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 112/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+C +    + 
Sbjct: 2   YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICTDNGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N+GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 62  SVRMTPVLAGTVKGHLLGPLAVRPSHKNQGIGRELVRIAVEAARRKGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGFQ V + +L  P PVDP RVL +P+ ++  + +KGI+   
Sbjct: 122 GPLGFQKVAYNALSFPGPVDPGRVLVVPIAEDAHERLKGIIAWH 165


>gi|296445945|ref|ZP_06887896.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
 gi|296256613|gb|EFH03689.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
          Length = 165

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 59/151 (39%), Positives = 88/151 (58%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEK 97
                +I  +   +FGPGR+ R A  LRE    DL+LSF+   G  +VG+ RMT I I+ 
Sbjct: 13  PADAPAIEKLEERAFGPGRYARTAYRLREGSPPDLALSFVAHVGTLLVGANRMTEILIDS 72

Query: 98  ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWK 157
               LLGP+ V P ++++G+G  L+  S+DAA + G  +++LVGD+ YY++LGF  VP  
Sbjct: 73  APALLLGPLTVEPAFRSQGLGEALVKKSLDAAREAGHGLVLLVGDLDYYARLGFARVPRG 132

Query: 158 SLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
            +++P PVDP R+L   L         G +R
Sbjct: 133 QIMMPGPVDPERLLCCELRAGALATASGRMR 163


>gi|300023906|ref|YP_003756517.1| GCN5-related N-acetyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525727|gb|ADJ24196.1| GCN5-related N-acetyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 172

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 54/151 (35%), Positives = 85/151 (56%), Gaps = 1/151 (0%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEK 97
            +    I  +HA  FGPGRF R+A  +RE   H      +   G +++ S+RMT I+I  
Sbjct: 12  PKDVPEISRLHARVFGPGRFARSAYRVREGKGHLSRYCLVAHLGGQLIASLRMTEITIGG 71

Query: 98  IT-GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                LLGP+ V P ++N G+G KL++ +++AA   G+ ++VLVGD  YY + GF+ VP 
Sbjct: 72  RPGAALLGPVAVDPDHRNIGLGTKLMNEAIEAARVGGTSLVVLVGDDPYYGRFGFKVVPA 131

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             ++ P PV+P R+L   L        +G++
Sbjct: 132 GQIVFPGPVNPARLLVRELKDGALAEFRGLI 162


>gi|149202296|ref|ZP_01879269.1| acetyltransferase, GNAT family protein [Roseovarius sp. TM1035]
 gi|149144394|gb|EDM32425.1| acetyltransferase, GNAT family protein [Roseovarius sp. TM1035]
          Length = 161

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 79/154 (51%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPI 93
            E+      + A++   F PGR   ++  LR+       L  +  +  RI+ G++R  P+
Sbjct: 6   TEKPVDYWEVEALYDLCFAPGREALSSYRLRDDVPPVRDLCLVVRDHDRILAGAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I      LLGP+ VHP +Q +G+G  L+  S++ A   G + ++LVGD  YYS+ GF  
Sbjct: 66  RIGTARALLLGPVAVHPTHQGEGLGALLMRDSLERAAALGWERVILVGDAPYYSRFGFTK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +    + +P P +P RVL L L     +++ G V
Sbjct: 126 LTA--VEMPPPTNPERVLGLELRPGAWEDVAGKV 157


>gi|209886133|ref|YP_002289990.1| acetyltransferase [Oligotropha carboxidovorans OM5]
 gi|209874329|gb|ACI94125.1| acetyltransferase [Oligotropha carboxidovorans OM5]
          Length = 176

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 3/163 (1%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                     E  +    I  +H  +FGPGRFV +A  LRE   H L LSF    G  +V
Sbjct: 7   MTDLSITILAETPNDAQAIERLHQRTFGPGRFVLSAYRLREHVDHLLDLSFTAHIGTLLV 66

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR  PI I      LLGP+ V P ++ +GIGR L+  ++  A+ KG +++VLVGD  Y
Sbjct: 67  GSVRQLPICIGDTPALLLGPLTVEPPFRGRGIGRALMDHALAEAKAKGHRLVVLVGDEPY 126

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           Y ++GF+ +      +P PVDP R+L   L +   + + G +R
Sbjct: 127 YGRMGFKRIASGVTTMPGPVDPARLLVHELEEGAFEGVSGAIR 169


>gi|154247158|ref|YP_001418116.1| GCN5-related N-acetyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161243|gb|ABS68459.1| GCN5-related N-acetyltransferase [Xanthobacter autotrophicus Py2]
          Length = 164

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 95/153 (62%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
           +E    D  I  +H  +FGPGRF R A  +REQ  H+ +LSF    G  +VGSVR+T + 
Sbjct: 10  VETAADDHDIDKLHERTFGPGRFARTAFRIREQAPHERALSFTARVGNMLVGSVRLTRVR 69

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ V P +Q+ GIG +L+ +++ AA++ G +++VLVGD  YY++ GF+ V
Sbjct: 70  VGTTPALLLGPLTVEPPFQSVGIGARLMEVALKAAQEGGHRLVVLVGDEPYYARFGFKRV 129

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           P   + LP PVDP R+L   LV+    ++ G+V
Sbjct: 130 PPGRVTLPGPVDPARLLVAELVEGAFTDVAGMV 162


>gi|294678603|ref|YP_003579218.1| GNAT family acetyltransferase [Rhodobacter capsulatus SB 1003]
 gi|294477423|gb|ADE86811.1| acetyltransferase, GNAT family [Rhodobacter capsulatus SB 1003]
          Length = 161

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 77/152 (50%), Gaps = 2/152 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
           E       + A++   F PGR   ++  LR+       L  +  E   +   +R  P+ +
Sbjct: 7   ETEADWWEVEALYDLCFAPGRTALSSYRLRDGVEKVAPLCLVLREDGVLAAVIRYWPVRV 66

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
                 LLGP+ VHP  Q +G+G  L+  S+  A + G + ++LVGD  YY++ GF+ + 
Sbjct: 67  GGQRVLLLGPVAVHPTRQGEGLGGLLMHESLAEARRLGWERVLLVGDAPYYNRFGFEKI- 125

Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            + + +P P +P+RVL L L+    + ++G V
Sbjct: 126 -EGVEMPPPTNPDRVLALELIPGAWEGVRGPV 156


>gi|190892801|ref|YP_001979343.1| acetyltransferase [Rhizobium etli CIAT 652]
 gi|190698080|gb|ACE92165.1| probable acetyltransferase protein [Rhizobium etli CIAT 652]
          Length = 168

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 112/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+CA+    + 
Sbjct: 2   YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICADDGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 62  SVRMTPVLAGTVKGHLLGPLAVRPSHKNMGIGRELVRIAVEAARRKGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ + V + +KG++   
Sbjct: 122 GPLGFEKVAYNALTFPGPVDPARVLVVPIAEGVHERLKGVIAWH 165


>gi|260428632|ref|ZP_05782611.1| acetyltransferase, gnat family [Citreicella sp. SE45]
 gi|260423124|gb|EEX16375.1| acetyltransferase, gnat family [Citreicella sp. SE45]
          Length = 178

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG-SVRMTPI 93
            ER      + A++   F PGR + ++  LRE       L  +  +   I+G ++R  P+
Sbjct: 23  QERPGDWWEVEALYDHCFAPGRTLLSSYRLREDVPPVPELCRVARDETGIIGGAIRYWPV 82

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I +    LLGP+ VHP  Q +G+G  LI  +V+ A       ++LVGD  YY + GF  
Sbjct: 83  RIGRWQALLLGPVAVHPTAQGEGLGAALIRDTVERARALEWSRVLLVGDEPYYRRFGF-- 140

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           V    +++P P +P RVL L LV      + G V
Sbjct: 141 VKLDEVVMPPPTNPERVLGLELVPGAWDGVAGEV 174


>gi|85714288|ref|ZP_01045276.1| GCN5-related N-acetyltransferase [Nitrobacter sp. Nb-311A]
 gi|85698735|gb|EAQ36604.1| GCN5-related N-acetyltransferase [Nitrobacter sp. Nb-311A]
          Length = 177

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/157 (37%), Positives = 88/157 (56%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
               E      +I  +H  +FGPGRFV +A  LRE   H L LS     G  +VGSVR+ 
Sbjct: 7   TLLTETANDAQAIERLHERTFGPGRFVLSAYRLREHVDHLLDLSLTARIGTLLVGSVRLL 66

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           P+ I      LLGP+ V P ++ +GIG  L+  +++ A+ KG +++VLVGD +YY  +GF
Sbjct: 67  PVCIGDTPALLLGPLTVEPPFRGRGIGHALLERALEDAKAKGHRLVVLVGDESYYGGVGF 126

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + +P   + +P PVD  R+L   LV      + G++R
Sbjct: 127 RMIPKGQVDMPGPVDRARLLVCELVPGAFDGVSGMIR 163


>gi|91978508|ref|YP_571167.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91684964|gb|ABE41266.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 172

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 90/163 (55%), Gaps = 3/163 (1%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                     E  +    I  +H  +FGPGRFV +A  LRE   H  +LSF    G  +V
Sbjct: 1   MNDLSLTILPETPNDAQLIERLHERTFGPGRFVLSAYRLREHVDHINALSFTAWIGTLLV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR  PI+I +    LLGP+ V P ++ +G+GR L+  ++  A  +G ++ VLVGD  Y
Sbjct: 61  GSVRQLPIAIGETPALLLGPLTVEPPFRARGVGRALLDRALADARAQGHKLTVLVGDEPY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           YS++GF+ +P   + +P PVD NR+L + L     + + G +R
Sbjct: 121 YSRVGFKKIPKGRVTMPGPVDANRLLVIELADGAFEGVSGPIR 163


>gi|116253246|ref|YP_769084.1| acetyltransferase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257894|emb|CAK08992.1| putative acetyltransferase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 166

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 111/164 (67%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+C +    + 
Sbjct: 2   YKHDLVYLTEDASHDAAIEHINEEAFGPGRFTRAAARIREQGPHDLSLSFICTDNGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++NKGIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 62  SVRMTPVLAGTVKGHLLGPLAVRPSHKNKGIGRELVRIAVEAARRKGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ + V + +KG +   
Sbjct: 122 GPLGFEKVAYNALSFPGPVDPGRVLVVPIAEGVHERLKGTIHWH 165


>gi|90418310|ref|ZP_01226222.1| putative acetyltransferase, GNAT family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337982|gb|EAS51633.1| putative acetyltransferase, GNAT family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 185

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 66/158 (41%), Positives = 98/158 (62%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           +  E  +H +SI A+ A++FGPGRF RAA  +RE   H   LSF+   G  I+GSVR+TP
Sbjct: 26  YLPEHPDHHASIDAIAAEAFGPGRFTRAAERVREMARHAPGLSFVAEHGGAIIGSVRLTP 85

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           I+I      +LGP+ V P ++N+G+G+ L+  +  AA + G   I+LVGD  YY+ LG++
Sbjct: 86  IAIGDAPSLMLGPLAVRPAFKNRGVGKALMQRAATAAREAGENSIILVGDPPYYAPLGYR 145

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            +P  S+I+P PVD  R+L L L+      ++G V  R
Sbjct: 146 PLPRGSVIMPGPVDLARLLGLELIAGALAEVRGTVGAR 183


>gi|115523422|ref|YP_780333.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115517369|gb|ABJ05353.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 182

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 3/163 (1%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                     E  +    I  +H  +FGPGRF  +A  LRE   H   LSF    G  +V
Sbjct: 11  MTDLSITILTEAANDAQSIERLHERTFGPGRFALSAYRLREHVDHLFELSFTARIGTLLV 70

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR  PI I +    LLGP+ V P ++  G+G+ L+  ++  A+ +G ++++LVGD  Y
Sbjct: 71  GSVRQLPIQIGETPALLLGPLTVEPPFRGCGVGKMLLKRALSDAKAQGHRLVLLVGDEPY 130

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           YS+ GF+A+P   + +P PVDP R+L + LV+  A +I G VR
Sbjct: 131 YSRSGFRAIPKGRVTMPGPVDPKRLLVVELVEGAAADIAGPVR 173


>gi|86751300|ref|YP_487796.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86574328|gb|ABD08885.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 172

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 89/155 (57%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E   H   I  +H  +FGPGRFV +A  LRE   H  +LSF    G  +VGSVR  PI
Sbjct: 9   LPESPNHAQLIERLHERTFGPGRFVLSAYRLREHIDHINALSFTAWIGTLLVGSVRQLPI 68

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +      LLGP+ V P ++ +G+GR L+  ++  A ++G ++I+LVGD  YYS++GF+ 
Sbjct: 69  LVGDTPALLLGPLTVEPPFRARGVGRALLDRALADAREQGHKLILLVGDEPYYSRVGFKK 128

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +P   + +P PVD +R+L + L       + G +R
Sbjct: 129 IPKGRVTMPGPVDAHRLLVMELADGAFDGVSGPIR 163


>gi|254464874|ref|ZP_05078285.1| acetyltransferase, gnat family [Rhodobacterales bacterium Y4I]
 gi|206685782|gb|EDZ46264.1| acetyltransferase, gnat family [Rhodobacterales bacterium Y4I]
          Length = 162

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            ER +    + A++   F PGR   ++  LRE       LS +  +    +  ++R  P+
Sbjct: 6   AERPDDRWEVEALYDLCFAPGREALSSYRLREGVPPVAGLSQVARDSDGILAAAIRFWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I      LLGP+ VHP  Q +G+G  LI  S+  A++ G   ++LVGD  YY + GF  
Sbjct: 66  LIGDAPALLLGPVAVHPTRQGEGLGGSLIRDSLAKAQESGWARVMLVGDAPYYRRFGFTR 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +  + + +P P +P+RVL L L       ++G V
Sbjct: 126 L--EGVEMPPPTNPDRVLGLALQDGAWGGVRGQV 157


>gi|89071283|ref|ZP_01158451.1| acetyltransferase, GNAT family protein [Oceanicola granulosus
           HTCC2516]
 gi|89043188|gb|EAR49422.1| acetyltransferase, GNAT family protein [Oceanicola granulosus
           HTCC2516]
          Length = 162

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG-SVRMTPI 93
            E  E    + A++   F PGR   ++  LR+      +L  +  +G  ++G +VR+ P+
Sbjct: 6   RETPEDWWEVEALYDLCFAPGRTALSSYRLRDGVAPIGALCLVWRDGGGVLGGAVRVWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +  +   LLGP+ VHP  Q +G+G  LI   ++ A  +G + ++LVGD  YYS+ GFQA
Sbjct: 66  RVGGVAALLLGPVAVHPTRQGEGLGAFLIESVLERAAAEGHERVMLVGDAPYYSRFGFQA 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +P   + +P P +P RVL + L       + G V
Sbjct: 126 LP--GVEMPPPTNPERVLGVALTPGAWDGVAGAV 157


>gi|85707234|ref|ZP_01038320.1| acetyltransferase, GNAT family protein [Roseovarius sp. 217]
 gi|85668288|gb|EAQ23163.1| acetyltransferase, GNAT family protein [Roseovarius sp. 217]
          Length = 161

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPI 93
            E+      + A++   F PGR   ++  LR+       L  +  +G+ I+ G++R  P+
Sbjct: 6   TEKAVDYWEVEALYDLCFAPGREALSSYRLRDNVPAVADLCLVVRDGEGILAGAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I      LLGP+ VHP +Q +G+G  LI  S++ AE  G + ++LVGD  YYS+ GF  
Sbjct: 66  RIGAARALLLGPVAVHPTHQGEGLGALLIRDSLERAEALGWERVILVGDAPYYSRFGF-- 123

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               S+ +P P +P RVL L L       + G V
Sbjct: 124 AKLASVEMPPPTNPERVLGLELRPGAWDTVAGKV 157


>gi|126733533|ref|ZP_01749280.1| GCN5-related N-acetyltransferase [Roseobacter sp. CCS2]
 gi|126716399|gb|EBA13263.1| GCN5-related N-acetyltransferase [Roseobacter sp. CCS2]
          Length = 166

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 71/154 (46%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            E       + A++   F PGR   ++  LRE       L     +    + G+VR  P+
Sbjct: 10  TETPNDWWEVEALYDLCFAPGRSALSSYRLREGVDPIAPLCLTARDAEGILAGAVRNWPV 69

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +      LLGPI VHP  Q +G+   L+   +  A   G   ++LVGD  YY + GF+ 
Sbjct: 70  LVGGQQTVLLGPIAVHPTRQGEGVASLLMQRCLADARDLGWSRLMLVGDAPYYRRFGFEQ 129

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           V    +I+P P +P+RVL + L     Q + G V
Sbjct: 130 VS--GVIMPPPTNPDRVLGVALEAGAWQGVGGQV 161


>gi|154252673|ref|YP_001413497.1| GCN5-like N-acetyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154156623|gb|ABS63840.1| GCN5-related N-acetyltransferase [Parvibaculum lavamentivorans
           DS-1]
          Length = 175

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 4/157 (2%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC--AEGKR--IVGSVRM 90
            ER EH  +I A+   SFGPGR+ +AA  LRE       L ++    E     +VG++  
Sbjct: 6   AERPEHGPAIEALLDLSFGPGRYAKAAQRLREGNHPVPELCYVAFSEEDGERHMVGALSF 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            P+ I  + G +LGP+ V P  + KG G KL+   +  A+K G ++++LVGD  YY+++G
Sbjct: 66  WPVVIGGVPGLMLGPLAVEPRLRGKGCGIKLMEKGLADAKKLGYRLVILVGDAPYYARVG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F  VP   L +P PVDP+R+L+  L        +G +
Sbjct: 126 FGPVPPGRLTMPGPVDPSRLLYRELDIGAFGRARGAI 162


>gi|159044608|ref|YP_001533402.1| hypothetical protein Dshi_2064 [Dinoroseobacter shibae DFL 12]
 gi|157912368|gb|ABV93801.1| hypothetical protein Dshi_2064 [Dinoroseobacter shibae DFL 12]
          Length = 166

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 73/161 (45%), Gaps = 9/161 (5%)

Query: 34  FLERLEHD---SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG---- 86
              R E       + A+    F PGR   ++  LR+      +L  +       +G    
Sbjct: 1   MQLRQEEPGDWWEVEALFDLCFAPGREALSSYRLRDGVPPVGALCLVAPNEDNALGGVGG 60

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++R  PI +      LLGP+ VHP  Q +G+G  LI   ++ A   G   ++LVGD  YY
Sbjct: 61  AIRFWPIRVGGAEALLLGPVAVHPTRQGEGLGALLIQAGLEKAAALGWTRVLLVGDAPYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            + GF  V  + + +P P +P+RVL   L      +++G V
Sbjct: 121 GRFGF--VRAEGIEMPPPTNPDRVLVQALSAGAWDDVRGEV 159


>gi|163738399|ref|ZP_02145814.1| acetyltransferase, GNAT family protein [Phaeobacter gallaeciensis
           BS107]
 gi|161388320|gb|EDQ12674.1| acetyltransferase, GNAT family protein [Phaeobacter gallaeciensis
           BS107]
          Length = 169

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 79/156 (50%), Gaps = 5/156 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            E+ E    + A++   F PGR   ++  LRE       LS +  +    + G++R  P+
Sbjct: 6   AEQPEDRWEVEALYDLCFAPGREALSSYRLREDVPPVSGLSQVARDTDGLLAGAIRFWPV 65

Query: 94  SIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
            I        LLGP+ VHP +Q +G+G  LI  S+  A ++G    +LVGD  YY + GF
Sbjct: 66  RIGEAGWPALLLGPVAVHPTHQGEGLGGALIRDSLAKAAERGWSRALLVGDAPYYVRFGF 125

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             +    + +P P +P+RVL L LV     +++G V
Sbjct: 126 TPLC--GVEMPPPTNPDRVLGLDLVSEGWTDVRGQV 159


>gi|222149373|ref|YP_002550330.1| acetyltransferase [Agrobacterium vitis S4]
 gi|221736357|gb|ACM37320.1| acetyltransferase [Agrobacterium vitis S4]
          Length = 191

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/164 (42%), Positives = 110/164 (67%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           +    +  E   HD+ I  +++++FGPGRF RAA  +REQG HD +LSF+CA+    + S
Sbjct: 3   KHDLVYLTEDASHDAIIELINSEAFGPGRFTRAAARIREQGPHDRTLSFVCADQGETIAS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VRMTP+    + GH+LGP+ V P ++  GIGR+L+ ++++AA + GS+ ++L+GD  YY 
Sbjct: 63  VRMTPVLAGTVKGHMLGPLAVRPSHKCLGIGRELVRIAIEAARRSGSEAVILIGDPPYYM 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            LGF+ + + +L  P PVDP RVL +PL ++V   +KG++  R+
Sbjct: 123 PLGFEKIAYNALAFPGPVDPGRVLVVPLAEDVHARLKGVIGWRD 166


>gi|15966122|ref|NP_386475.1| hypothetical protein SMc02707 [Sinorhizobium meliloti 1021]
 gi|307305677|ref|ZP_07585424.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
 gi|307317680|ref|ZP_07597119.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|15075392|emb|CAC46948.1| Acetyltransferase [Sinorhizobium meliloti 1021]
 gi|306896838|gb|EFN27585.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|306902380|gb|EFN32976.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
          Length = 183

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 112/165 (67%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
            +    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HD +LSF+CA+    + 
Sbjct: 2   KKHDLVYLTEDASHDAAIEIINEEAFGPGRFTRAAARIREQGPHDRALSFICADNGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP++   + GHLLGP+ V P ++N+GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 62  SVRMTPVTAGSVKGHLLGPLAVRPSHKNQGIGRELVRIAVEAARRKGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             LGF+ V   +L  P PVDP RVL +P+  +V   ++G++  R+
Sbjct: 122 QPLGFEKVRHGALQFPGPVDPARVLVVPVALDVHARLEGMIAWRD 166


>gi|217978418|ref|YP_002362565.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2]
 gi|217503794|gb|ACK51203.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2]
          Length = 168

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/150 (39%), Positives = 87/150 (58%)

Query: 39  EHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI 98
           +  ++I  +   +FGPGRF R+A  LRE    D SLSF+   G  +VG+ R+T I   + 
Sbjct: 14  DDLAAIERLDEHAFGPGRFARSAYRLREGVEPDYSLSFVARVGTLLVGANRITAIRCGEA 73

Query: 99  TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKS 158
              LLGP+ V P +++ GIG  L+  S+DAA   G  +++LVGD+ YY K+GF+ VP   
Sbjct: 74  PALLLGPLTVDPAFRSGGIGEALVQKSLDAARAAGHALVLLVGDLPYYEKMGFRRVPPGK 133

Query: 159 LILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +    PVDP R+L+  LV+    +    VR
Sbjct: 134 ITFIGPVDPERLLYCELVEGALDSAGAKVR 163


>gi|75676816|ref|YP_319237.1| GCN5-related N-acetyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74421686|gb|ABA05885.1| GCN5-related N-acetyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 181

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/157 (36%), Positives = 86/157 (54%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
               E      +I  +H  +FGPGRFV +A  LRE   H L LS     G  +VGSVR+ 
Sbjct: 13  TLLTETAGDAQAIERLHERTFGPGRFVLSAYRLREHVDHLLELSLTARIGTLLVGSVRLL 72

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           P+ I      LLGP+ V P ++ +GIG  L+  ++  A+ KG +++VLVGD +YY + GF
Sbjct: 73  PVCIGDTPALLLGPLTVEPPFRGRGIGHALLERALGDAKAKGHRLVVLVGDESYYGRAGF 132

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + +P     +P PVD  R+L   L     + + G++R
Sbjct: 133 RMIPKGQADMPGPVDRARLLVCELAAGAFEGVSGMIR 169


>gi|114765070|ref|ZP_01444215.1| acetyltransferase, GNAT family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114542474|gb|EAU45500.1| acetyltransferase, GNAT family protein [Roseovarius sp. HTCC2601]
          Length = 178

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 76/154 (49%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG-SVRMTPI 93
            E+      + A++  SF PGR + ++  LR+       L  +  +   I+G ++R  P+
Sbjct: 23  QEKPGDWWEVEALYDLSFAPGRTLLSSYRLRDDVPPVAELCRVARDESGILGGAIRYWPV 82

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            I      LLGP+ VHP  Q +G+G  LI  +V+ A       ++LVGD  YY + GF  
Sbjct: 83  RIGHWHALLLGPVAVHPTAQGEGLGAALIRDTVERARALEWSRVLLVGDEPYYRRFGFGH 142

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +    + +P P +P R+L L LV    Q + G V
Sbjct: 143 LS--GVEMPPPTNPERILGLELVPGAWQGVAGEV 174


>gi|325293620|ref|YP_004279484.1| acetyltransferase [Agrobacterium sp. H13-3]
 gi|325061473|gb|ADY65164.1| acetyltransferase [Agrobacterium sp. H13-3]
          Length = 189

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/164 (44%), Positives = 109/164 (66%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           +    +  E   HD+ I  ++ ++FGPGR  RAA  +REQG HD SLSF+CA+    + S
Sbjct: 3   KHDLVYLTEDASHDAIIEIINEEAFGPGRHTRAAARIREQGPHDRSLSFVCADDGETIAS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VRMTP+    + GH+LGP+ V P ++N GIGR+L+ +++ AA +KGS+ ++L+GD  YY 
Sbjct: 63  VRMTPVLAGGVKGHMLGPLAVRPSHKNMGIGRELVRIAIAAARRKGSEAVILIGDPPYYM 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            LGF+ V + +L  P PVDPNRVL +P+  +V Q +KG +  R+
Sbjct: 123 PLGFEKVAYAALDFPGPVDPNRVLVVPVGDDVHQRLKGKIGWRK 166


>gi|192293231|ref|YP_001993836.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|192286980|gb|ACF03361.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 180

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/155 (38%), Positives = 90/155 (58%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E      +I  +H  +FGPGRFV +A  LRE   H   LSF    G  +VGSVR  PI
Sbjct: 19  LPESPNDAQAIERLHERTFGPGRFVLSAYRLREHVDHLPELSFTAWIGTLLVGSVRQLPI 78

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +   +  LLGP+ V P ++++G+GR L+  ++  A  +G ++IVLVGD  YYS++GF+ 
Sbjct: 79  LVGDTSALLLGPLTVEPPFRSRGVGRLLLDRAISDARAQGHKLIVLVGDEPYYSRVGFKR 138

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +P   + +P PVD  R+L L L +   + + G +R
Sbjct: 139 IPKGRVTMPGPVDAARLLVLELAEGAFEGVGGAIR 173


>gi|316935904|ref|YP_004110886.1| GCN5-like N-acetyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315603618|gb|ADU46153.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 184

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/155 (38%), Positives = 88/155 (56%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E      +I  +H  +FGPGRFV +A  LRE   H   LSF    G  +VGSVR  P+
Sbjct: 22  LPEAPNDAHAIERLHERTFGPGRFVLSAYRLREHVDHIAELSFTAWIGTLLVGSVRQLPV 81

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           +I      LLGP+ V P ++++G+GR L+  ++  A  +G ++IVLVGD  YYS+ GF+ 
Sbjct: 82  TIGDTPALLLGPLTVEPPFRSRGVGRLLLERALADARAQGHKLIVLVGDEPYYSRAGFKK 141

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +P   + +P PVD  R+L   LV+     + G +R
Sbjct: 142 IPKGRVTMPGPVDYGRLLVAELVEGAFDGVSGPIR 176


>gi|163745873|ref|ZP_02153232.1| acetyltransferase, putative [Oceanibulbus indolifex HEL-45]
 gi|161380618|gb|EDQ05028.1| acetyltransferase, putative [Oceanibulbus indolifex HEL-45]
          Length = 166

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/152 (30%), Positives = 76/152 (50%), Gaps = 3/152 (1%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPISIE 96
                 + A++   F PGR   ++  LR+       LS +  + G  + G++R  P+ I 
Sbjct: 13  PADHWEVEALYDTCFAPGREALSSYRLRDGVPPVAGLSHVARDSGGILAGAIRYWPVRIG 72

Query: 97  KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                LLGP+ VHP  Q +G+G  LI  S+  A   G + ++LVGD  YY++ GF  +  
Sbjct: 73  ATEALLLGPVAVHPTRQGEGLGAALIETSLAHAGPLGWERVMLVGDAPYYNRFGFTLL-- 130

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + + +P P +P RVL   L ++    + G VR
Sbjct: 131 QDVEMPPPTNPARVLGRSLAEDAWAGVIGKVR 162


>gi|27377570|ref|NP_769099.1| acetyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|27350714|dbj|BAC47724.1| acetyltransferase [Bradyrhizobium japonicum USDA 110]
          Length = 171

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 90/148 (60%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT 99
              +I  +H  +FGPGRFV +A  +RE   H L LSF    G  +VGSVR  P+ + +  
Sbjct: 15  DAQAIERLHERTFGPGRFVLSAYRIREHVDHLLELSFTARIGTLLVGSVRQLPVLVGETP 74

Query: 100 GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSL 159
             LLGP+ V P ++++GIGR L+  ++  A+++G ++++LVGD  YYS++GF+ VP   +
Sbjct: 75  ALLLGPLTVEPPFRDRGIGRLLMERALKDAKERGHRLVLLVGDEPYYSRVGFKPVPKGRV 134

Query: 160 ILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            +P PVD  R+L   LV    + + G V
Sbjct: 135 TMPGPVDAARILVFELVDGAFEGVSGAV 162


>gi|148253764|ref|YP_001238349.1| putative acetyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146405937|gb|ABQ34443.1| Putative acetyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 170

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 88/163 (53%), Gaps = 3/163 (1%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                     E       I  +H  +FGPGRFV +A  LRE   H L LSF    G  +V
Sbjct: 1   MSDLSITISAEKPGDAQAIERLHERTFGPGRFVLSAYRLREHVDHLLELSFTAHIGTLLV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR  PI +      +LGP+ V P ++  GIGR L+  S+  A  +G ++I+LVGD AY
Sbjct: 61  GSVRQLPICVGDTKALMLGPLTVEPPFRKHGIGRMLMERSIADARVQGHRLILLVGDAAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           Y+++GF+ VP     +P PVD NR+L   LV+   + + G +R
Sbjct: 121 YARVGFKPVPKGRATMPGPVDYNRLLVNELVEGAFEGVAGEIR 163


>gi|260577265|ref|ZP_05845239.1| GCN5-related N-acetyltransferase [Rhodobacter sp. SW2]
 gi|259020509|gb|EEW23831.1| GCN5-related N-acetyltransferase [Rhodobacter sp. SW2]
          Length = 162

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           E       + A++   F PGR   ++  LR+       L  +  +    +   +R  P+ 
Sbjct: 7   ETEADWWEVEALYDLCFAPGRTALSSYRLRDGVATVAPLCLVLRDEDGVLAAVIRYWPVE 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ VHP  Q +G+G  LI+ S+  A + G Q ++LVGD  YY + GF+ +
Sbjct: 67  VAGQDVLLLGPVAVHPTRQGEGLGGLLITESLAEARRLGWQRVMLVGDAPYYGRFGFRKL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               +++P P +P+RVL L LVQ   Q + G V
Sbjct: 127 A--GVVMPPPTNPDRVLGLELVQGAWQGVTGDV 157


>gi|254474838|ref|ZP_05088224.1| acetyltransferase, gnat family [Ruegeria sp. R11]
 gi|214029081|gb|EEB69916.1| acetyltransferase, gnat family [Ruegeria sp. R11]
          Length = 176

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 13/167 (7%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPI 93
            E+ +    + A++   F PGR   ++  LR+     L LS +  +    + G++R  P+
Sbjct: 6   AEQPQDRWEVEALYDLCFAPGREALSSYRLRDGVPAVLGLSQVARDEAGILAGAIRFWPV 65

Query: 94  SI---------EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
            I          +    LLGP+ VHP +Q +G+G  LI  S+  A + G   ++LVGD  
Sbjct: 66  HIAADPDDPDSSRQPALLLGPVAVHPTHQGEGLGGALIRDSLAKASESGWSRVLLVGDAP 125

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCR 190
           YY + GF       + +P P +P+RVL L L++     + G ++R  
Sbjct: 126 YYVRFGF--AGLTGVHMPPPTNPDRVLGLELIEGAWDGVAGHVIRWS 170


>gi|170750045|ref|YP_001756305.1| GCN5-related N-acetyltransferase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656567|gb|ACB25622.1| GCN5-related N-acetyltransferase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 169

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 83/152 (54%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
           ER E   +I  +HA +FGPGRF R A  LRE     + L    + G  +VGSVRM P+  
Sbjct: 11  ERPEDAPAIERLHARAFGPGRFARTAYRLREGAAERIDLGITASVGSFLVGSVRMGPVRT 70

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
                 +LGP+ V P ++ +GIG  L   ++D A + G  +++LVGD  YY++ GF  VP
Sbjct: 71  GATPFVMLGPLAVDPSFEGRGIGGTLTRAAIDGARRAGEGLVILVGDAPYYARFGFTPVP 130

Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
              L LP PVDP R+L+L L         G V
Sbjct: 131 PGRLTLPGPVDPARLLWLELADGFGAGASGAV 162


>gi|254486007|ref|ZP_05099212.1| acetyltransferase, gnat family [Roseobacter sp. GAI101]
 gi|214042876|gb|EEB83514.1| acetyltransferase, gnat family [Roseobacter sp. GAI101]
          Length = 159

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/153 (32%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           ER E    + A++   F PGR   ++  LR+       LS +  +    + G++R  P+ 
Sbjct: 4   ERAEDHWEVEALYDTCFAPGREALSSYRLRDGVPPVAGLSHVARDADGILAGAIRYWPVR 63

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I      LLGP+ VHP  Q +G+G  LI  S+  A   G   ++LVGD  YY + GF  +
Sbjct: 64  IGTAEALLLGPVAVHPTRQGEGLGGLLIEDSLVHAAPLGWARVMLVGDAPYYERFGFSLL 123

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               +++P P +P RVL   LV +    I G V
Sbjct: 124 S--DVVMPPPTNPARVLGRDLVPDAWLGIAGDV 154


>gi|119386330|ref|YP_917385.1| GCN5-related N-acetyltransferase [Paracoccus denitrificans PD1222]
 gi|119376925|gb|ABL71689.1| GCN5-related N-acetyltransferase [Paracoccus denitrificans PD1222]
          Length = 186

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/153 (30%), Positives = 76/153 (49%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPIS 94
           E       + A+    F PGR   ++  LRE       L  +  +    ++G++R  P+ 
Sbjct: 7   ETPADTPEVEALLDLCFAPGRTALSSYRLREGVAPVRPLCLMLRDDFGALMGAIRYWPVR 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ VHP  Q +G+G  L+  S+  A + G Q  +LVGD+ YY + GF  +
Sbjct: 67  VGGRPVLLLGPVAVHPTAQGEGLGGLLMRESLTRAAEMGWQRAMLVGDLPYYQRFGFWKL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             + + +P P +P+R+L L LV +    I G V
Sbjct: 127 --EDVEMPPPTNPDRILGLELVPDAWSGIAGPV 157


>gi|182680322|ref|YP_001834468.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636205|gb|ACB96979.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 166

 Score =  151 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/155 (36%), Positives = 89/155 (57%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             +      +I  +   +FGPGRF R+A  LRE    D +LSF+   G  +VG+ R+T I
Sbjct: 10  MPQTQADQGAIEKLDERTFGPGRFARSAYRLREGQEPDYALSFVARVGTLLVGANRITRI 69

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
                   LLGP+ V P +++ GIG  L+  S++AA+ +G ++++LVGD  YY+++GF+ 
Sbjct: 70  RCGDTQALLLGPLTVEPAFRSGGIGEALVLKSLEAAQSQGHELVLLVGDEPYYARMGFRP 129

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           VP   L    PVDP R+L+  L +   +  +G V+
Sbjct: 130 VPPGHLTFIGPVDPARLLYCELREGALERARGRVK 164


>gi|299132172|ref|ZP_07025367.1| GCN5-related N-acetyltransferase [Afipia sp. 1NLS2]
 gi|298592309|gb|EFI52509.1| GCN5-related N-acetyltransferase [Afipia sp. 1NLS2]
          Length = 196

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/155 (29%), Positives = 77/155 (49%), Gaps = 3/155 (1%)

Query: 36  ERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
            R E  + +    A+   SFG GR  R    LR+       L+F   +  R++G+VR+  
Sbjct: 19  IRAERAADVAAREALLDASFGEGRHTRTCQRLRDGRAPAEGLAFSATQHGRLIGTVRLWH 78

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           +S   I   +LGP+ V    ++ G+G  L++ ++ AA+ +G   ++L GD AYY + GF 
Sbjct: 79  VSAGGIPALVLGPLAVDASCRSLGVGAALMNHALAAAKARGHTAVILRGDPAYYERFGFS 138

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           A     L LP P +  R+L + L +       G++
Sbjct: 139 ADKTGELALPGPFERERLLAIELREGALMGAWGMI 173


>gi|39937448|ref|NP_949724.1| GCN5-like N-acetyltransferase [Rhodopseudomonas palustris CGA009]
 gi|39651307|emb|CAE29829.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           CGA009]
          Length = 183

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 89/155 (57%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             E      +I  +H  +FGPGRFV +A  LRE   H   LSF    G  +VGSVR  PI
Sbjct: 22  LPESPNDAQAIERLHERTFGPGRFVLSAYRLREHVDHLPELSFTAWIGTLLVGSVRQLPI 81

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +   +  LLGP+ V P ++++G+GR L+  ++  A  +G ++IVLVGD  YYS++GF+ 
Sbjct: 82  LVGDTSALLLGPLTVEPPFRSRGVGRLLLDRAISDARAQGHKLIVLVGDEPYYSRVGFKR 141

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +    + +P PVD  R+L L L +   + + G +R
Sbjct: 142 IAKGRVTMPGPVDAARLLVLELAEGAFEGVGGAIR 176


>gi|126737286|ref|ZP_01753021.1| acetyltransferase, GNAT family protein [Roseobacter sp. SK209-2-6]
 gi|126721871|gb|EBA18574.1| acetyltransferase, GNAT family protein [Roseobacter sp. SK209-2-6]
          Length = 181

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 79/167 (47%), Gaps = 15/167 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTP 92
             E  E    + A++   F PGR   ++  LR+       LS +  +    + G++R  P
Sbjct: 5   IAETAEDRWEVEALYDLCFAPGREALSSYRLRDDVPPVPGLSQVARDELGILAGAIRFWP 64

Query: 93  ISIEKI--------TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           + I           +  LLGP+ VHP +Q +G+G  LI  S+  A++ G +  +LVGD  
Sbjct: 65  VHIAPEGAEASEWSSALLLGPVAVHPTHQGEGLGGSLIRDSLAKAQESGWERCMLVGDAP 124

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPL----VQNVAQNIKGIV 187
           YY + GFQ +P   + +P P +P RVL L L         + I G V
Sbjct: 125 YYRRFGFQQLP--GVEMPPPTNPERVLGLCLGGKDWPGAWEGIAGKV 169


>gi|83941230|ref|ZP_00953692.1| putative acetyltransferase, GNAT family protein [Sulfitobacter sp.
           EE-36]
 gi|83847050|gb|EAP84925.1| putative acetyltransferase, GNAT family protein [Sulfitobacter sp.
           EE-36]
          Length = 162

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           E       + A++   F PGR   ++  LR+       L+ +  + G  + G++R  PI 
Sbjct: 7   ETAADHWEVEALYDTCFAPGREALSSYRLRDGVPPVAGLNHVARDAGGILAGAIRYWPIC 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I   +  LLGP+ VHP  Q +G+G  LI  S+  A   G   ++LVGD  YY++ GF  +
Sbjct: 67  IGAHSALLLGPVAVHPTRQGEGLGALLIEGSLAQAAPLGWSRVMLVGDAPYYNRFGFTLL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
               +++P P +P RVL   LV      I G V
Sbjct: 127 T--DVVMPPPTNPERVLGRALVDGAWDGIAGDV 157


>gi|192289365|ref|YP_001989970.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|192283114|gb|ACE99494.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 195

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S I A   +    FG GR  R    LR+       L+F      R+VG+VR+
Sbjct: 18  FAIRAEKSSDIAARERLLDACFGEGRHARTCQRLRDGRAPAEGLAFSAVRQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V    +  G+G  L+ +++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVDAGGRAALVLGPLAVDSSCREFGVGGALMRVALAEASARGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A    +L LP P + +R+L L L +       G++
Sbjct: 138 FSADKTGALALPGPFERDRLLGLELREGALDGAAGLI 174


>gi|188581258|ref|YP_001924703.1| GCN5-related N-acetyltransferase [Methylobacterium populi BJ001]
 gi|179344756|gb|ACB80168.1| GCN5-related N-acetyltransferase [Methylobacterium populi BJ001]
          Length = 185

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S + A   +    FGPGRF++ +  LRE       L+      + +VG+VR+
Sbjct: 2   IQIRDEIASDVAAREHLLDACFGPGRFLKTSQRLREGRRPARGLALSAVRDETLVGTVRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q  G+G  L+  ++  A+ +G   ++LVGD  YY++ 
Sbjct: 62  WDVETGCGRPALLLGPLAVDPALQGAGLGGMLMRTALAEAKDRGHGAVLLVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF+     +L +P P +  R L L L        +G++R
Sbjct: 122 GFERAKADALYMPGPFERERFLGLELKAGALTEAEGVLR 160


>gi|163742184|ref|ZP_02149572.1| acetyltransferase, GNAT family protein [Phaeobacter gallaeciensis
           2.10]
 gi|161384514|gb|EDQ08895.1| acetyltransferase, GNAT family protein [Phaeobacter gallaeciensis
           2.10]
          Length = 169

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 49/156 (31%), Positives = 79/156 (50%), Gaps = 5/156 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            E+ +    + A++   F PGR   ++  LRE       LS +  +    + G++R  P+
Sbjct: 6   AEQHDDRWEVEALYDLCFAPGREALSSYRLREDVPPVSGLSQVARDTDGILAGAIRFWPV 65

Query: 94  SIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
            I        LLGP+ VHP +Q +G+G  LI  S+  A ++G    +LVGD  YY + GF
Sbjct: 66  RIGEAGWPALLLGPVAVHPTHQGEGLGGALIRDSLAKAAERGWSRALLVGDAPYYVRFGF 125

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             +    + +P P +P+RVL L LV     +++G V
Sbjct: 126 TPLC--GVEMPPPTNPDRVLGLDLVSEGWTDVRGQV 159


>gi|146339009|ref|YP_001204057.1| putative acetyltransferase [Bradyrhizobium sp. ORS278]
 gi|146191815|emb|CAL75820.1| Putative acetyltransferase [Bradyrhizobium sp. ORS278]
          Length = 170

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/163 (39%), Positives = 88/163 (53%), Gaps = 3/163 (1%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                     E       I  +H  +FGPGRFV +A  LRE   H L LSF    G  +V
Sbjct: 1   MSDLSITISAEKLGDAQAIERLHERTFGPGRFVLSAYRLREHVDHLLELSFTAHIGTLLV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR  PI +      +LGP+ V P ++  GIGR L+  S+  A  +G + I+LVGD AY
Sbjct: 61  GSVRQLPICVGDAKALMLGPLTVEPPFRKHGIGRMLMERSIADARTQGHRFILLVGDAAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           Y+++GF+ VP    I+P PVD NR+L   LV+     ++G +R
Sbjct: 121 YTRVGFKPVPKGRAIMPGPVDYNRLLVNELVEGAFDGVEGAIR 163


>gi|159185126|ref|NP_355216.2| acetyltransferase [Agrobacterium tumefaciens str. C58]
 gi|159140397|gb|AAK88001.2| acetyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 189

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 73/164 (44%), Positives = 109/164 (66%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
           +    +  E   HD+ I  ++ ++FGPGR  RAA  +REQG HD SLSF+CA+    + S
Sbjct: 3   KHDLVYLTEDASHDAIIDLINEEAFGPGRHTRAAARIREQGPHDRSLSFVCADDGETIAS 62

Query: 88  VRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           VRMTP+    + GH+LGP+ V P ++N GIGR+L+ +++ AA +KGS+ ++L+GD  YY 
Sbjct: 63  VRMTPVLAGAVKGHMLGPLAVRPSHKNMGIGRELVRIAIAAARRKGSEAVILIGDPPYYM 122

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            LGF+ V + +L  P PVDPNRVL +P+  +V Q +KG +  R+
Sbjct: 123 PLGFEKVAYAALDFPGPVDPNRVLVVPVGDDVHQRLKGKIGWRK 166


>gi|83854707|ref|ZP_00948237.1| putative acetyltransferase, GNAT family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83842550|gb|EAP81717.1| putative acetyltransferase, GNAT family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 177

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 77/165 (46%), Gaps = 3/165 (1%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GK 82
           R     +     E       + A++   F PGR   ++  LR+       L+ +  + G 
Sbjct: 10  RPEGHALYHITPETAADHWEVEALYDTCFAPGREALSSYRLRDGVPPVAGLNHVARDAGG 69

Query: 83  RIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            + G++R  PI I      LLGP+ VHP  Q +G+G  LI  S+  A   G   ++LVGD
Sbjct: 70  ILAGAIRYWPICIGAHAALLLGPVAVHPTRQGEGLGALLIEGSLAQAAPLGWSRVMLVGD 129

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             YY++ GF  +    +++P P +P RVL   LV    + I G V
Sbjct: 130 APYYNRFGFTLLT--DVVMPPPTNPERVLGRALVDGAWEGIAGDV 172


>gi|110634533|ref|YP_674741.1| GCN5-related N-acetyltransferase [Mesorhizobium sp. BNC1]
 gi|110285517|gb|ABG63576.1| GCN5-related N-acetyltransferase [Chelativorans sp. BNC1]
          Length = 190

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 66/156 (42%), Positives = 98/156 (62%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F  E   H   I  ++A++FGPGRF +AA  +RE G H+ +LSF+     R++ SVR++
Sbjct: 7   VFLPEAPAHYPEIEDINAEAFGPGRFAKAAYKIREGGPHERALSFVALHKGRVIASVRLS 66

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
            I   + +G LLGP+ V P Y+N+GIGRKL+ +++ AA + G+ V+VLVGD  YY   GF
Sbjct: 67  RIIAGEGSGLLLGPLAVRPAYKNQGIGRKLLRIALQAAREVGAGVVVLVGDEPYYGPFGF 126

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           + VP   L +P PVDP R+L   L +     ++G+V
Sbjct: 127 KPVPSGQLAMPRPVDPGRLLAAELKKGALAELQGMV 162


>gi|126729139|ref|ZP_01744953.1| acetyltransferase, GNAT family protein [Sagittula stellata E-37]
 gi|126710129|gb|EBA09181.1| acetyltransferase, GNAT family protein [Sagittula stellata E-37]
          Length = 163

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/153 (32%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPIS 94
           ER E    + A+   +F PGR   ++  LR+       L  L  +G   +VG++R  P+ 
Sbjct: 7   ERPEDWWDVEALFDLAFAPGRTALSSYRLRDDVPPVAPLCRLVRDGSGTVVGAIRYWPVR 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I      LLGP+ VHP+ Q  G+   LI  ++  A + G + I+LVGD  YY + GF  +
Sbjct: 67  IGDADVLLLGPVAVHPVAQGAGLAALLIRETLSKAAELGFERILLVGDRPYYGRFGFDRL 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             + + +P P +P R+L L LV      + G V
Sbjct: 127 --EGVEMPPPTNPARILGLELVDGAWSGVTGEV 157


>gi|295687824|ref|YP_003591517.1| GCN5-related N-acetyltransferase [Caulobacter segnis ATCC 21756]
 gi|295429727|gb|ADG08899.1| GCN5-related N-acetyltransferase [Caulobacter segnis ATCC 21756]
          Length = 181

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 81/154 (52%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
            LE    ++S+ A+    FGPGRF +++  LRE        SF+     R VG  RM P+
Sbjct: 18  VLETPAMEASVTALIDRVFGPGRFAKSSERLREGNALLPDCSFVALRDGRPVGCCRMWPV 77

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           +I       LGP+ V P  ++ G+G+ L+  + +AA   G + ++LVGD  Y+ ++GF  
Sbjct: 78  TIGGEPVAFLGPLAVDPDERSAGLGQALVESACEAARAAGWRAVLLVGDGPYFGRIGFTN 137

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
                + +P PVD  RVL LPL Q   + + G V
Sbjct: 138 AHTADVAMPGPVDQRRVLLLPLRQGGDEGLSGPV 171


>gi|182678065|ref|YP_001832211.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633948|gb|ACB94722.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 229

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 51/162 (31%), Positives = 80/162 (49%), Gaps = 9/162 (5%)

Query: 35  LERLEHD-----SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC----AEGKRIV 85
             R+E +      +  A+   +FGP RF + +  LRE     + LS +       G+ +V
Sbjct: 44  TIRIEEEGLSDVPAREALLDRAFGPARFEKTSERLREGRYPAIGLSLVAKEIDERGETLV 103

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G+VR+  +    +   LLGP+ V P +++ G+G +L+  ++  A  +    I+LVGD  Y
Sbjct: 104 GTVRLWHVLAGLVPCLLLGPLAVSPEHRSLGLGGRLMREAIARARSRDHAAILLVGDAPY 163

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           Y K GF +   K   LP PVD  R L L L      N +G+V
Sbjct: 164 YEKFGFSSELTKRFELPGPVDRARFLALELSSGALANAEGLV 205


>gi|254505003|ref|ZP_05117154.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
 gi|222441074|gb|EEE47753.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
          Length = 165

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/163 (39%), Positives = 96/163 (58%), Gaps = 5/163 (3%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                ++ RLE       I A+ A++FGPGRFVR A  +RE   H   L+F+   G RI 
Sbjct: 1   MKQTSWVIRLEDAIDDTAIEALQAEAFGPGRFVRTAFRIRENVPHRQDLAFVGLSGSRIA 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GSVR++PI+I +    LLGP+ V P ++N+G+G+ L+  +++AA+  G + ++LVGD  Y
Sbjct: 61  GSVRLSPITIGETDALLLGPLTVSPDFKNRGLGKALMWTALEAAKAAGDEYVLLVGDAPY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           YS  GF+ V + S+ LP PVDP R+L   L         G V+
Sbjct: 121 YSPFGFEQVHFGSITLPGPVDPERLLIARLHDGAL--PTGSVQ 161


>gi|39933946|ref|NP_946222.1| GCN5-like N-acetyltransferase [Rhodopseudomonas palustris CGA009]
 gi|39647793|emb|CAE26313.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           CGA009]
          Length = 195

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S I A   +    FG GR  R    LR+       L+F      R+VG+VR+
Sbjct: 18  FAIRAEKSSDIAARERLLDACFGEGRHARTCQRLRDGRAPAEGLAFSAVRQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V    +  G+G  L+ +++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVDAGGRAALVLGPLAVDSSCREFGVGGALMRVALAEASARGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A    +L LP P + +R+L L L +       G++
Sbjct: 138 FSADKTGALALPGPFERDRLLGLELREGALDGGAGLI 174


>gi|114770424|ref|ZP_01447962.1| acetyltransferase, GNAT family protein [alpha proteobacterium
           HTCC2255]
 gi|114549261|gb|EAU52144.1| acetyltransferase, GNAT family protein [alpha proteobacterium
           HTCC2255]
          Length = 163

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 5/160 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            E+ E    + ++   SF PGR   ++  LR+  +    L  +  +    I GS+R  P+
Sbjct: 6   QEKKEDWWDVESLLDLSFAPGREALSSYRLRDGVLPVAKLCLVARDFDGIIGGSIRFWPV 65

Query: 94  S--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
                K    LLGPI VHP  Q +G+G +LI  ++  A+K G   IVL+GD  YY+K GF
Sbjct: 66  QIGCNKARALLLGPIAVHPTRQGEGVGGELIRSALTLAKKDGWTRIVLIGDEIYYNKFGF 125

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +      L  P P +PNR+L+L L  +  +++ G ++  E
Sbjct: 126 K--KSNFLRFPPPTNPNRLLYLELKPDAFKDVNGEIQRSE 163


>gi|269836259|ref|YP_003318487.1| GCN5-like N-acetyltransferase [Sphaerobacter thermophilus DSM
           20745]
 gi|269785522|gb|ACZ37665.1| GCN5-related N-acetyltransferase [Sphaerobacter thermophilus DSM
           20745]
          Length = 172

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 8/165 (4%)

Query: 35  LERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
             R E  +   A+   +  +FG     R    +R+       LS +     R+VG +  +
Sbjct: 3   TIRAETPADAEAISEVNRLAFGRENEARLVEAIRDTPGFIPGLSLVAERDGRVVGHILFS 62

Query: 92  PI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            I       +++    L P+ V P YQ +GIG  LI   +D A   G +++V+VG   YY
Sbjct: 63  RIAIRTDKGQEVPALALAPVAVLPEYQGQGIGSTLIRAGLDRARALGHRIVVVVGHPDYY 122

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            + GF +   + L  P PV     + L L       + G+V   E
Sbjct: 123 PRFGFTSARAQGLEAPFPVSDPAFMALALTPGALDGVHGLVVYPE 167


>gi|77462385|ref|YP_351889.1| GNAT family acetyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77386803|gb|ABA77988.1| putative acetyltransferase, GNAT family [Rhodobacter sphaeroides
           2.4.1]
          Length = 161

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 82/154 (53%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLS-FLCAEGKRIVGSVRMTPI 93
            ER      + A++   F PGR   ++  LR+       L   L  E   +  ++R  P+
Sbjct: 6   QEREADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADLCALLRDEDGTLAAAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           ++      LLGP+ VHP  Q +G+G  LI+ ++  A + G + ++LVGD  YY + GF+ 
Sbjct: 66  TVGGKPVLLLGPVAVHPTRQGEGLGALLIAETLAEARRIGWERVMLVGDAPYYRRFGFRK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +  + +++P P +P RVL +PLV    + ++G+V
Sbjct: 126 L--EKVVMPPPTNPERVLGMPLVIGAWEGVEGLV 157


>gi|146276680|ref|YP_001166839.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554921|gb|ABP69534.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 161

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 78/154 (50%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
            ER      + A++   F PGR   ++  LR+       L  L  +    +  ++R  P+
Sbjct: 6   QERDADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADLCALLRDADGTLAAAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +      LLGP+ VHP  Q +G+G  LI+ ++  A K G + ++LVGD  YY + GF+ 
Sbjct: 66  KVADKPVLLLGPVAVHPTRQGEGLGALLITETLAEARKLGWERVMLVGDAPYYRRFGFRK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +    + +P P +P RVL +PLV    + ++G V
Sbjct: 126 LER--VEMPPPTNPERVLGMPLVTGAWEGVEGPV 157


>gi|85715887|ref|ZP_01046865.1| GCN5-related N-acetyltransferase [Nitrobacter sp. Nb-311A]
 gi|85697294|gb|EAQ35174.1| GCN5-related N-acetyltransferase [Nitrobacter sp. Nb-311A]
          Length = 199

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/169 (27%), Positives = 82/169 (48%), Gaps = 3/169 (1%)

Query: 22  WRRSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC 78
            +++  +   + F  R E  S +    A+   SFG  R  R    LR+       L+   
Sbjct: 5   LKKNAARCEVSSFAIRAERPSDVAAREALLDASFGADRHARTCQRLRDGRKPVEGLALAA 64

Query: 79  AEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
                ++G+VR+  +S   I    LGP+ V  ++++ G+G  L   ++D A+  G   ++
Sbjct: 65  VSNGELIGTVRLWHVSAGGIPALALGPLAVAAVHRSLGVGAALTKRALDLAQAHGHGAVI 124

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           L+GD  YY++ GF  V   +L+LP P D +R+L + L +N  +   G +
Sbjct: 125 LLGDAPYYARFGFSTVKTGNLLLPGPFDRDRLLAVELRKNALEAAAGRI 173


>gi|163733571|ref|ZP_02141014.1| acetyltransferase, putative [Roseobacter litoralis Och 149]
 gi|161393359|gb|EDQ17685.1| acetyltransferase, putative [Roseobacter litoralis Och 149]
          Length = 182

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 4/170 (2%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
           + R+  +     E  +    + A++   F PGR   ++  LR+      +LS +  +   
Sbjct: 14  KRRFIPVYTLTHETEQDHHEVEALYDLCFAPGREALSSYRLRDDVPPVENLSHVARDRDG 73

Query: 84  IVG-SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           I+G ++R  P+ I +++  LLGP+ VHP  Q +G+   LI  ++D A + G Q ++LVGD
Sbjct: 74  ILGGAIRYWPVRIGEVSALLLGPVAVHPTRQGEGLASLLIRSTLDLAAEAGWQRVMLVGD 133

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV-RCRE 191
             YY +  F  +    + +P P +P+RVL   LV      + G V R R 
Sbjct: 134 APYYQRYQFTRLS--DVNMPPPTNPDRVLGRALVPGAWDGVVGEVTRWRA 181


>gi|209884062|ref|YP_002287919.1| acetyltransferase [Oligotropha carboxidovorans OM5]
 gi|209872258|gb|ACI92054.1| acetyltransferase [Oligotropha carboxidovorans OM5]
          Length = 198

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 79/157 (50%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S + A   +   SFG  R  R    LR+  +    L+F   +  R++G+VR+
Sbjct: 18  FAIRTERGSDVAARERLLDASFGTDRHTRTCQRLRDGRVPARGLAFAALQHGRLIGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S   +   +LGP+ V    ++ G+G  L+  ++ AA+ +G   ++L GD AYY++ G
Sbjct: 78  WHVSAGGVPALVLGPLAVDAASRSLGVGAALMEHALTAAKAQGYGAVILRGDPAYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F      +L LP P +P R+L + L      N  G++
Sbjct: 138 FSTAKTGALALPGPFEPERLLAVELRSGALDNAWGMI 174


>gi|126461262|ref|YP_001042376.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638245|ref|YP_002524507.1| GCN5-like N-acetyltransferase [Rhodobacter sphaeroides KD131]
 gi|126102926|gb|ABN75604.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159026|gb|ACM00006.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides KD131]
          Length = 161

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 81/154 (52%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLS-FLCAEGKRIVGSVRMTPI 93
            ER      + A++   F PGR   ++  LR+       L   L  E   +  ++R  P+
Sbjct: 6   QEREADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADLCALLRDEDGTLAAAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +      LLGP+ VHP  Q +G+G  LI+ ++  A + G + ++LVGD  YY + GF+ 
Sbjct: 66  MVGDKPVLLLGPVAVHPTRQGEGLGALLIAETLAEARRIGWERVMLVGDAPYYRRFGFRK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +  + +++P P +P RVL +PLV    + ++G+V
Sbjct: 126 L--EKVVMPPPTNPERVLGMPLVIGAWEGVEGLV 157


>gi|209965660|ref|YP_002298575.1| acetyltransferase, GNAT family [Rhodospirillum centenum SW]
 gi|209959126|gb|ACI99762.1| acetyltransferase, GNAT family [Rhodospirillum centenum SW]
          Length = 236

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 54/154 (35%), Positives = 83/154 (53%), Gaps = 2/154 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPIS 94
           E+ +H + I ++  D+FG  R  +    LR        LSF+  +   R+VG++R  P+ 
Sbjct: 6   EQPQHAAGIESLLDDAFGAKRHAKTVYRLRAGIGPVPGLSFVATDEDGRLVGTIRYWPVL 65

Query: 95  IE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           I       LLGPI +H  +++KG+G  LI  S+D A ++G ++++LVGD  YY + GF  
Sbjct: 66  IGTSTPAILLGPIAIHADWRSKGLGGTLIRYSLDRAAEQGHRIVLLVGDAPYYVRFGFTR 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
                L LP PVD +R L L LV      + G+V
Sbjct: 126 ENTLGLSLPGPVDLDRFLGLELVPGALDGVVGLV 159


>gi|90422895|ref|YP_531265.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90104909|gb|ABD86946.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 178

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/149 (36%), Positives = 87/149 (58%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT 99
              +I  +H  +FGPGRF  +A  LRE   H   LSF    G  +VGSVR  PI + +  
Sbjct: 21  DAQAIERLHERTFGPGRFALSAYRLREHVDHLGELSFTARIGTLLVGSVRQLPILVGETP 80

Query: 100 GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSL 159
             LLGP+ V P ++++G+GR L+  ++  A+ KG ++++LVGD  YY+++GF+ +    +
Sbjct: 81  ALLLGPLTVEPPFRDRGVGRALLDRALGDAKAKGHRLVLLVGDADYYARVGFKPIARGRV 140

Query: 160 ILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
            +P PVDP R+L   L       ++G +R
Sbjct: 141 TMPGPVDPKRLLVAELADGAFAGVEGAIR 169


>gi|332560269|ref|ZP_08414591.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides WS8N]
 gi|332277981|gb|EGJ23296.1| GCN5-related N-acetyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 161

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 81/154 (52%), Gaps = 3/154 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLS-FLCAEGKRIVGSVRMTPI 93
            ER      + A++   F PGR   ++  LR+       L   L  E   +  ++R  P+
Sbjct: 6   QEREADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADLCALLRDEDGTLAAAIRYWPV 65

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            +      LLGP+ VHP  Q +G+G  LI+ ++  A + G + ++LVGD  YY + GF+ 
Sbjct: 66  MVGDKPVLLLGPVAVHPTRQGEGLGALLIAETLAEARRIGWERVMLVGDAPYYRRFGFRK 125

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +  + +++P P +P RVL +PLV    + ++G+V
Sbjct: 126 L--EKVVMPPPTNPERVLGMPLVIGAWEGVEGLV 157


>gi|288959687|ref|YP_003450028.1| GCN5-related N-acetyltransferase [Azospirillum sp. B510]
 gi|288911995|dbj|BAI73484.1| GCN5-related N-acetyltransferase [Azospirillum sp. B510]
          Length = 223

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 6/159 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-----IVGSVR 89
           +E  +H ++I A+   SFGP RF + A  LR+      +L+ +  +        +VG++R
Sbjct: 5   VEEPKHAAAIEALLDVSFGPDRFAKTAYQLRDGVDAIAALNLVAIDHDEHGREVVVGTIR 64

Query: 90  MTPISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
             PI +       LLGPI V    Q  G+G KLI MS++ A   G Q ++LVGD  YY +
Sbjct: 65  YWPILVGGTTRSILLGPIAVAAHLQGSGLGSKLIRMSLNKAVALGHQSVILVGDAPYYER 124

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            GF       + +P PVD NR L L LV+       G++
Sbjct: 125 FGFSRALTLGMEMPGPVDMNRFLALELVEGALAGASGMI 163


>gi|307944149|ref|ZP_07659490.1| acetyltransferase [Roseibium sp. TrichSKD4]
 gi|307772495|gb|EFO31715.1| acetyltransferase [Roseibium sp. TrichSKD4]
          Length = 166

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 70/156 (44%), Positives = 94/156 (60%), Gaps = 5/156 (3%)

Query: 36  ERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
            RLE       I A+   +FGPGRF R A  +RE   H   LSF+   G  + GSVR+T 
Sbjct: 8   IRLEVPHDTLEIDALQEAAFGPGRFARTAFRIREGVAHRPDLSFVGLSGATLAGSVRLTN 67

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           I I + +  LLGP+ V P ++++G+G+ L+  ++DAA   G   ++LVGD AYY   GFQ
Sbjct: 68  IRIGQTSALLLGPLTVAPEFKSRGLGKALMRTALDAAAAAGETAVLLVGDAAYYKPFGFQ 127

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
            VP  S++LP PVDP RVL  PL  N A + KGIV+
Sbjct: 128 NVPIGSIMLPGPVDPARVLIAPL--NGADSPKGIVQ 161


>gi|115526789|ref|YP_783700.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115520736|gb|ABJ08720.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 195

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  + +    A+    FG GR  R    LR+  +    L+       R+VG+VR+
Sbjct: 18  FAIRTERAADVPAREALLDACFGVGRNARTCQRLRDGRLPAEGLALSAFHQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +    +   +LGP+ V    +  GIG  L+  ++ AA  +G   ++L+GD  YY + G
Sbjct: 78  WHVDAGSVPALVLGPLAVDASCRALGIGAALMQHAIAAATARGHGAVILLGDAPYYQRFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A     L LP P +  R+L   L        +G++
Sbjct: 138 FSAAKTAELALPGPFERERLLARELRAGALDGAQGLI 174


>gi|92118881|ref|YP_578610.1| GCN5-related N-acetyltransferase [Nitrobacter hamburgensis X14]
 gi|91801775|gb|ABE64150.1| GCN5-related N-acetyltransferase [Nitrobacter hamburgensis X14]
          Length = 200

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S +    A+   SFG GR  R    LR+       L+        ++G+VR+
Sbjct: 18  FAIRAERVSDVAAREALLDASFGDGRHARTCQRLRDGRKPAEGLALAAVGNGNLIGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S   I   +LGP+ V    +  G+G  L+  ++D A+      ++L+GD  YYS+ G
Sbjct: 78  WHVSAGGIPALVLGPLAVDAPCRKLGVGAALMKRALDIAQAHRHGAVILLGDAPYYSRFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A+   SL LP P + +R+L + L     ++  G++
Sbjct: 138 FSALRTGSLSLPGPFERDRLLAVELRAGELEDASGLI 174


>gi|84516609|ref|ZP_01003968.1| acetyltransferase, GNAT family [Loktanella vestfoldensis SKA53]
 gi|84509645|gb|EAQ06103.1| acetyltransferase, GNAT family [Loktanella vestfoldensis SKA53]
          Length = 171

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/150 (34%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPISIEKI 98
                 A++   F PGR   ++  LRE       L +   +   ++ G +R  P  + + 
Sbjct: 15  DYWEAEALYDLCFSPGRSALSSYRLREDVSPIADLCWTARDPDAVLAGVIRCWPCYVGET 74

Query: 99  TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKS 158
              LLGP+ VHP  Q +GI  +LI      A K G   I+LVGD+ YYS+ GFQ +    
Sbjct: 75  PVVLLGPVAVHPTRQGEGIAGRLIYRVTQVARKAGWSRILLVGDLPYYSRFGFQQLT--G 132

Query: 159 LILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +I+P P +P RVL L L  +    I G VR
Sbjct: 133 VIMPPPTNPERVLGLSLASDSWAGIHGPVR 162


>gi|328542776|ref|YP_004302885.1| acetyltransferase, GNAT family [polymorphum gilvum SL003B-26A1]
 gi|326412522|gb|ADZ69585.1| Acetyltransferase, GNAT family [Polymorphum gilvum SL003B-26A1]
          Length = 207

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 68/168 (40%), Positives = 95/168 (56%), Gaps = 5/168 (2%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           R+        +  RLE  +   A+      +FGPGRF R A  +RE   HD +LSF+   
Sbjct: 39  RNLLAMKPINWFVRLEVPADDAAVENLQSVAFGPGRFARTAFRIREGIPHDPALSFVGLA 98

Query: 81  GKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G  +VGSVR+TPI I +    LLGP+ V P ++N+G+G+ L+  ++DAA ++G   ++LV
Sbjct: 99  GDEVVGSVRLTPIRIGETPAMLLGPLTVAPEFKNRGLGKLLLRTALDAASRQGETAVLLV 158

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GD  YY  LGF  V +  + LP PVDP R+L   L  N A    G VR
Sbjct: 159 GDPPYYGPLGFLPVSFGRITLPGPVDPARLLIATL--NGADVPSGPVR 204


>gi|197334967|ref|YP_002155917.1| acetyltransferase [Vibrio fischeri MJ11]
 gi|197316457|gb|ACH65904.1| acetyltransferase [Vibrio fischeri MJ11]
          Length = 188

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/182 (23%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 21  CWRRSRWQKIGAFFLERLEHDSSICAMHADSF---------GPG-RFVRAAVLLREQGMH 70
           C  ++  + +      R+E +S   A+   ++          PG +     ++ R +  +
Sbjct: 7   CAFKNGLKHLEIDMKFRIEKESDHKAIENVTYKAFENHPHHAPGAKPTEHKIIERLRENN 66

Query: 71  DLSLSFLCAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
            L+LS +  +G  I+G +  +P+ I       + LGP+ V P +Q++GIG +LI + ++ 
Sbjct: 67  ALTLSLVAEKGDTIIGHIAFSPVLINDKDSKWYGLGPVSVFPEHQSEGIGSRLIRLGLEQ 126

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
             ++G++  VL+G+  YY + GF++     L     V     L LPL +   +  +G V 
Sbjct: 127 LIEQGAEGAVLLGEPEYYQRFGFKSDEKLILE---GVPAEYFLSLPLTE--IEIPQGEVN 181

Query: 189 CR 190
             
Sbjct: 182 YH 183


>gi|332828012|gb|EGK00734.1| hypothetical protein HMPREF9455_03008 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 177

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 67/170 (39%), Gaps = 7/170 (4%)

Query: 28  QKIGAFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRI 84
           +        R E      A++     +F      R A  LR        LS +     +I
Sbjct: 2   EDKDMKVEIRQEEACDFPAVYDINLKAFNRKEEARLADRLRLSDGFIPELSLVAIVENKI 61

Query: 85  VGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           VG +  T ISI           L P+ V P  Q KG+G++LI   +D A + G + +V++
Sbjct: 62  VGHIMFTKISIVDEGRSQDSLALAPMAVSPGLQRKGVGQQLIRYGLDKARELGYKSVVVL 121

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           G   YY + GF       +  P  V  N  +   L+     +IKG V+  
Sbjct: 122 GHTEYYPRFGFVPTSKWGIKPPFNVPSNVFMAKELIDGGLSDIKGTVKYA 171


>gi|23012522|ref|ZP_00052586.1| COG3153: Predicted acetyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 183

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 77/158 (48%), Gaps = 6/158 (3%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S   A   +    FGPGRF++ +  LRE  +  L+LS    +   +VG+VR+
Sbjct: 2   VQIRDEIASDGAARERLLDTCFGPGRFLKTSQRLREGRLPALALS--AEQDGTLVGTVRL 59

Query: 91  TPI-SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             + +       LLGP+ V P  Q +G+G  L+  ++  A + G   ++LVGD  YY++ 
Sbjct: 60  WDVETACGRPALLLGPLAVDPALQGQGLGAALMRAAIARAAELGHGAVLLVGDAPYYARF 119

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           GF       L +P P +  R L L L  +     +G++
Sbjct: 120 GFAPEKAAGLYMPGPFERERFLGLELKADALAGAEGVL 157


>gi|163758926|ref|ZP_02166013.1| hypothetical protein HPDFL43_15922 [Hoeflea phototrophica DFL-43]
 gi|162284216|gb|EDQ34500.1| hypothetical protein HPDFL43_15922 [Hoeflea phototrophica DFL-43]
          Length = 197

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 77/158 (48%), Gaps = 4/158 (2%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F+ + E         A+   + GPGR  +++  LR   +    L+ +  +   R+VG+VR
Sbjct: 13  FVVQAEQPKDCVAREALLDRAMGPGRKRKSSEKLRRGRLPSRDLALVARDSSGRVVGTVR 72

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +  ++       LLGP+ V P +   GIG  L+  +V  A + G   IVLVGD AYY K 
Sbjct: 73  LWDVAAGGKPLQLLGPLAVDPAHAGFGIGSALMRHAVSTACRLGHGGIVLVGDSAYYKKF 132

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           GF A     L++P PV+  R L L L     +   G++
Sbjct: 133 GFSAAKTDGLMMPGPVERERFLALELRHGYLEVAAGLL 170


>gi|310814841|ref|YP_003962805.1| acetyltransferase [Ketogulonicigenium vulgare Y25]
 gi|308753576|gb|ADO41505.1| acetyltransferase [Ketogulonicigenium vulgare Y25]
          Length = 182

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 16/167 (9%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMTPI 93
            E  +    + +++   F PGR   ++  LR+       LS +       I G++R  P+
Sbjct: 6   QETPDDWWEVESLYDLCFAPGREALSSYRLRDDVPPIAGLSLVARGTDGSIAGAIRHWPV 65

Query: 94  SIEKITG-------------HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
            I    G              LLGP+ VHP +Q +G+G  LI  ++  A   G + ++LV
Sbjct: 66  RICTEDGICNRSLLLGPVAGLLLGPVAVHPTHQGEGLGGLLIYQTLGGARALGWERVMLV 125

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           GD  YY++ GFQ +  + +++P P +P+RVL + L  N    ++G V
Sbjct: 126 GDAPYYNRFGFQKL--EGVLMPPPTNPDRVLGVALKPNAWAGVRGQV 170


>gi|86137964|ref|ZP_01056540.1| acetyltransferase, GNAT family protein [Roseobacter sp. MED193]
 gi|85825556|gb|EAQ45755.1| acetyltransferase, GNAT family protein [Roseobacter sp. MED193]
          Length = 180

 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 17/169 (10%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTP 92
             E+      + A++   F PGR   ++  LR+       LS +  +    + G++R  P
Sbjct: 1   MAEQPGDRWEVEALYDLCFAPGREALSSYRLRDDVPPVPGLSQVARDELGILAGAIRFWP 60

Query: 93  ISIEK--------------ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           + I                +T  LLGP+ VHP +Q +G+G  LI  S+  A ++G   ++
Sbjct: 61  VHIVSPEGAAGGGSKDSLRVTALLLGPVAVHPTHQGEGLGGSLIRDSLAKAAEQGWHRVM 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           LVGD  YY + GF+ +  + + +P P +P RVL L   +     ++G V
Sbjct: 121 LVGDAPYYRRFGFERL--EKVEMPPPTNPERVLGLASDRGAWAGVEGRV 167


>gi|75675116|ref|YP_317537.1| GCN5-related N-acetyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74419986|gb|ABA04185.1| GCN5-related N-acetyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 199

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S +    A+   SFG GRF R    LR+       L+      ++++G+VR+
Sbjct: 17  FAIRAERASDVAAREALLDASFGTGRFARTCQRLRDGRKPAEGLALAAVAERKLIGTVRL 76

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S   +    LGP+ V    +  G+G  L+  ++  A+ +G   ++L+GD  YY++ G
Sbjct: 77  WHVSAGGVPALALGPLAVAASQRKLGVGAALMKRALQLAQARGHGAVILLGDAPYYARFG 136

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F AV   +L+LP P + +R+L + L +   +   G++
Sbjct: 137 FSAVRSANLLLPGPFERDRLLAVELREAALEGTSGLI 173


>gi|146343069|ref|YP_001208117.1| putative acetyltransferase [Bradyrhizobium sp. ORS278]
 gi|146195875|emb|CAL79902.1| Putative Acetyltransferase (GNAT) family protein [Bradyrhizobium
           sp. ORS278]
          Length = 196

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F+ R E  S + A   +    FG  R  R    LR+       L+     G  +VG++R+
Sbjct: 18  FVIRAERASDVAARETLLDACFGDNRHERTCQRLRDGRAPAAGLALSAMRGGVLVGTLRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S       +LGP+ V    ++ G+G  L++ ++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVSAGGRDALMLGPLAVAQEARSLGVGAALMNAALMIAASRGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A    +L LP   +  R+L L LV        G++
Sbjct: 138 FDAAKAAALELPGAFERARLLGLELVDGALDGASGMI 174


>gi|110679427|ref|YP_682434.1| acetyltransferase, putative [Roseobacter denitrificans OCh 114]
 gi|109455543|gb|ABG31748.1| acetyltransferase, putative [Roseobacter denitrificans OCh 114]
          Length = 163

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG-SV 88
           +     E  +    + A++   F PGR   ++  LR+      +LS +  +   I+G ++
Sbjct: 1   MYTLTHETEQDHHEVEALYDLCFAPGREALSSYRLRDDVPAVENLSHVARDRDGILGGAI 60

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           R  P+ I + +  LLGP+ VHP  Q +G+   LI  +++ A + G Q ++LVGD  YY +
Sbjct: 61  RYWPVRIGEASALLLGPVAVHPTRQGEGLASLLIRSTLELAAEAGWQRVMLVGDAPYYQR 120

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV-RCRE 191
             F  +    + +P P +P+RVL   LV      + G V R R 
Sbjct: 121 YQFARLS--DVTMPPPTNPDRVLGRALVPGAWDGVAGEVTRWRA 162


>gi|118593624|ref|ZP_01551000.1| acetyltransferase [Stappia aggregata IAM 12614]
 gi|118433735|gb|EAV40396.1| acetyltransferase [Stappia aggregata IAM 12614]
          Length = 170

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 5/162 (3%)

Query: 29  KIGAFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                ++ R E+ +   A+      +FGPGRF R A  +RE   H   +SF+   G ++ 
Sbjct: 1   MKQTTWVIRPENATDTSAIENLQAEAFGPGRFARTAFRIREGVPHRADVSFVGLAGDQVA 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           GS+R+TPI I +    LLGP+ V P ++N+G+G+ L+  +++AA   G +V++LVGD  Y
Sbjct: 61  GSIRLTPIRIGESDALLLGPLTVSPDFKNRGLGKALMRTAMEAAAAAGDKVVLLVGDAPY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           Y   GFQ VP+  + LP PVDP R+L   L         G+V
Sbjct: 121 YGPFGFQQVPFGRITLPGPVDPARLLVALLNDG--DIPSGMV 160


>gi|228998238|ref|ZP_04157835.1| GCN5-related N-acetyltransferase [Bacillus mycoides Rock3-17]
 gi|228761499|gb|EEM10448.1| GCN5-related N-acetyltransferase [Bacillus mycoides Rock3-17]
          Length = 175

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 13/172 (7%)

Query: 32  AFFLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E +            A   ++F   +       +R+       LS +    K 
Sbjct: 1   MNIKIRQELEKDYNGAEEVVKQAFLNEAFSDQKEHELVNRIRKCDTFIPELSLVAV-DKE 59

Query: 84  IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           ++G V ++ +        +    L P+ V P  Q KGIG  LIS  +  A++ G   +++
Sbjct: 60  VIGHVLLSKVKIVDGDTSVESLALAPVSVVPDCQKKGIGSLLISHVLRKAKELGYHSVIV 119

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K GF+     ++  P  V     + + L +N  QNI+GIV+  E
Sbjct: 120 LGHKDYYPKFGFKPASIWNICAPFEVPDEVFMAMELTENALQNIQGIVQYSE 171


>gi|90426307|ref|YP_534677.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90108321|gb|ABD90358.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 197

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 71/157 (45%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  + +    A+    FG  R  R    LR+       L+       R+VG+VR+
Sbjct: 17  VSIRAERAADVAAREALLDACFGASRNARTCQRLRDGRRPAEGLALSAMHLGRLVGTVRL 76

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V P  +  GIG  L+  +++AA+  G   ++L+GD  YY + G
Sbjct: 77  WHVDAGGRPALVLGPLAVDPSVRALGIGAALMQHALEAAKALGHGAVILLGDEPYYVRFG 136

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F     ++L LP P + +R+L L L         G++
Sbjct: 137 FSRAVAEALSLPGPFERHRLLGLELRAGALDGAIGLI 173


>gi|258515058|ref|YP_003191280.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778763|gb|ACV62657.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 171

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 7/163 (4%)

Query: 34  FLERLEHDSSICAMHAD-SFGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  +   A++   S   GR   A ++  +R     +  LS +  + + +VG +  
Sbjct: 2   LTIRAESIADYAAVYEMHSLAFGRPNEAKLVEDIRHSVNFNPQLSMVAVQDELVVGHLLF 61

Query: 91  TPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +P+ IE         +L P+ VHP YQ +GIG KL+   +   +  G + ++++G  +YY
Sbjct: 62  SPLVIETKTKEIPALVLSPLAVHPKYQKQGIGSKLVRHGLILCKNAGYKAVIVIGYPSYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + GF     K +  P PV     + L LV  +     G+++ 
Sbjct: 122 PRFGFLPASTKGIKAPFPVPDKAFMVLELVPGILNQTSGLIKF 164


>gi|89055701|ref|YP_511152.1| GCN5-related N-acetyltransferase [Jannaschia sp. CCS1]
 gi|88865250|gb|ABD56127.1| GCN5-related N-acetyltransferase [Jannaschia sp. CCS1]
          Length = 158

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 7/150 (4%)

Query: 39  EHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPISIEK 97
           +    + A++   F PGR   ++  LR+       L  +  +   IV G+VR  P+ + +
Sbjct: 10  DDGPEVEALYDTCFAPGREALSSYRLRDGVPPVSGLCLVARDDLNIVAGAVRFWPVRVGQ 69

Query: 98  ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWK 157
               LLGPI VHP  Q +G+G  L+   ++AA  +G + ++LVGD  YY K GF  +   
Sbjct: 70  SEALLLGPIAVHPTRQGEGLGGLLMDAGLEAARAQGWRRLLLVGDAPYYGKFGFTRI--D 127

Query: 158 SLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            + +P P +P RVL           I G V
Sbjct: 128 GVTMPPPTNPARVLGY----GNWVGIAGAV 153


>gi|163941115|ref|YP_001645999.1| GCN5-related N-acetyltransferase [Bacillus weihenstephanensis
           KBAB4]
 gi|163863312|gb|ABY44371.1| GCN5-related N-acetyltransferase [Bacillus weihenstephanensis
           KBAB4]
          Length = 174

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE+    +    L P+ V P +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTTVDSLALAPVSVAPSHQKKGIGGKLIGAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALEGVEGVVQYS 169


>gi|229061068|ref|ZP_04198419.1| GCN5-related N-acetyltransferase [Bacillus cereus AH603]
 gi|228718151|gb|EEL69789.1| GCN5-related N-acetyltransferase [Bacillus cereus AH603]
          Length = 174

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +  + +  V
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAVDKET-V 60

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE+    +    L P+ V P +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTTVDSLALAPVSVAPSHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALEGVEGIVQYS 169


>gi|229086100|ref|ZP_04218320.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-44]
 gi|228697159|gb|EEL49924.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-44]
          Length = 175

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 69/172 (40%), Gaps = 13/172 (7%)

Query: 32  AFFLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E +     +            F   +       +R+       LS +    K 
Sbjct: 1   MNIKIRQEMEKDYSKVEEVVQQAFLHEEFSDQKEHELVNRIRKCDAFIPELSLVAV-DKE 59

Query: 84  IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G V ++ I      + +    L P+ V P YQ KGIG  LIS  +  A++ G   +++
Sbjct: 60  IIGHVLLSKIKIVDGDQSVDSLALAPVSVAPGYQKKGIGSLLISNVLSKAKELGYHSVIV 119

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K GF+      +  P  V     + + L +N  QN++GIV+  E
Sbjct: 120 LGHKDYYPKFGFKPASLWHIRAPFDVPDEVFMAMELTENALQNVQGIVQYSE 171


>gi|229134305|ref|ZP_04263119.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST196]
 gi|228649148|gb|EEL05169.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST196]
          Length = 174

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE+    +    L P+ V P +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTTVDSLALAPVSVAPSHQKKGIGGKLIGAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENSLEGVEGVVQYS 169


>gi|156744140|ref|YP_001434269.1| GCN5-like N-acetyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156235468|gb|ABU60251.1| GCN5-related N-acetyltransferase [Roseiflexus castenholzii DSM
           13941]
          Length = 170

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 5/164 (3%)

Query: 32  AFFLERLEHDSSICAM-HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              L R E  + + A+ HA+    GR   A ++ + +  + + LS +  +  R+VG +  
Sbjct: 1   MTILIRPESPADLPAIFHANQLAFGRDNEARLVNKLRDANAVVLSLVAEQDGRVVGHILF 60

Query: 91  TPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +P++I           LGP+ V P  Q +G+G  LI  ++   +  G  V++++G   YY
Sbjct: 61  SPVTIRDGGTEWQAVGLGPMAVLPEVQKQGVGSALIRAALAELKTLGHDVVIVLGHAEYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GFQ      +     V     +   L     +  +G+VR  
Sbjct: 121 PRFGFQPTQPFGIRWEIDVPAEVFMLAELTPGALRGRRGVVRYH 164


>gi|229012684|ref|ZP_04169854.1| GCN5-related N-acetyltransferase [Bacillus mycoides DSM 2048]
 gi|228748519|gb|EEL98374.1| GCN5-related N-acetyltransferase [Bacillus mycoides DSM 2048]
          Length = 174

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 75/169 (44%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   R       +R+       LS +  + +RIV
Sbjct: 2   VTIRQEQQNDCSKTEEVVKQAFSNEEFSDKREHELVKRIRKCDAFIPELSLVAVD-ERIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V P +Q KGIGRKLI  +++ A++ G + +V++G
Sbjct: 61  GHILLSKITIEQDGTSVKSLALAPVSVTPSHQKKGIGRKLIVAALEKAKELGYESVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASDWNIKAPFEVPDEVFMVIELGENALQGVEGIVQYS 169


>gi|294650221|ref|ZP_06727594.1| GNAT family acetyltransferase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823878|gb|EFF82708.1| GNAT family acetyltransferase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 179

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 14/176 (7%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADS-FGPGRF-----VRAAVLLREQGMHDLSLSFL 77
           +   +K+    + R E+ + I A+   +     R          ++   +  + L+LS +
Sbjct: 4   QDTQEKMNMNLIIRDENPTDINAIFDLTRLAFEREEYSSHTEQFIVNALRDSNQLTLSLV 63

Query: 78  CAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
                +++G +  +P+ I   T   + LGPI V P +Q KGIG KLI   ++A +   + 
Sbjct: 64  AESDHQVIGHIAFSPVQISDATTGWYGLGPISVLPDFQGKGIGAKLIHAGLEALKDLDAL 123

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             VL+GD  YY + GF+A P   L     V       LP   +      G V   +
Sbjct: 124 GCVLLGDPKYYGRFGFKADPKLIL---DGVPAEYFQVLPFYDHTP---TGNVTYSD 173


>gi|52548790|gb|AAU82639.1| probable acetyltransferase [uncultured archaeon GZfos18H11]
          Length = 173

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 70/163 (42%), Gaps = 7/163 (4%)

Query: 34  FLERLEHD---SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E +     I +++  +FG     +    LR+   +   L  +     +IVG +  
Sbjct: 3   INIRKETEKDYEDIKSVNDKAFGQENEGKIVENLRKNEKYISDLYLVAEIDNKIVGHILF 62

Query: 91  TPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            PI I     +     L P+ V P YQ  GIG KLI   + AA+K G   I++VG   YY
Sbjct: 63  FPIKIRSQENEYETLSLAPMSVLPNYQKMGIGSKLIEYGIKAAKKAGYGSIIVVGHPDYY 122

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + GF       + LP  V  N  + L L+ N  +  +G V+ 
Sbjct: 123 PRFGFAPASTFGIKLPFEVPDNAFMALELLPNSLKGKQGTVKY 165


>gi|110635050|ref|YP_675258.1| GCN5-related N-acetyltransferase [Mesorhizobium sp. BNC1]
 gi|110286034|gb|ABG64093.1| GCN5-related N-acetyltransferase [Chelativorans sp. BNC1]
          Length = 193

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 6/160 (3%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E  + I    A+   + GP R  +++  LR   +    L+F+       ++G+VR
Sbjct: 23  FSVAPETPADIPAREALLDRAMGPKRRRKSSEKLRRGRLPAEGLAFVARAADGSLIGTVR 82

Query: 90  MTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           +  +          LLGP+ V P  ++ G+G+ L+  ++  A + G   I+LVGD  YY+
Sbjct: 83  LWNVRLGHGGSPALLLGPLSVEPSLKSMGVGKALMQHAIAEAGRLGHGAILLVGDAPYYA 142

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           + GF A     L +P P +  R L L LV       +G++
Sbjct: 143 RFGFSAEKTDRLAMPGPYEKERFLALELVDGALNGAQGVL 182


>gi|240138633|ref|YP_002963105.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens AM1]
 gi|240008602|gb|ACS39828.1| Putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens AM1]
          Length = 185

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S + A   +    FGPGRF++ +  LRE  +    L+     G+++VG+VR+
Sbjct: 2   IQIRNETASDVVAREHLLDACFGPGRFLKTSQRLREGRLPARGLALSAVRGEKLVGTVRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q  G+G  L+  ++  A   G   ++LVGD  YY++ 
Sbjct: 62  WDVETGCGRPALLLGPLAVDPEVQGAGLGGTLMRAALAEAAAFGHGAVLLVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF       L +P P +  R L L L  +     +G++R
Sbjct: 122 GFAPEKAAGLYMPGPFERERFLGLELAAHALAGAEGVLR 160


>gi|316932413|ref|YP_004107395.1| GCN5-like N-acetyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315600127|gb|ADU42662.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 195

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 72/157 (45%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S I A   +    FG  R  R    LR+       L+F      R+VG+VR+
Sbjct: 18  FAIRAEKSSDIAARERLLDACFGENRHARTCQRLRDGRAPAEGLAFSAVRQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V P  +  G+G  L+  ++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVDAGGRAALVLGPLAVDPSCREFGVGGALMRAALAEAAARGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F      +L LP P + +R+L L L +       G++
Sbjct: 138 FTTDKMDALALPGPFERDRLLGLELRKGALDGAAGLI 174


>gi|163758540|ref|ZP_02165627.1| putative acetyltransferase [Hoeflea phototrophica DFL-43]
 gi|162283830|gb|EDQ34114.1| putative acetyltransferase [Hoeflea phototrophica DFL-43]
          Length = 171

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/141 (46%), Positives = 94/141 (66%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F  E   HD++I  ++ ++FGPGRFVR++  +REQG HD  LSF+  +    +GSVRMT
Sbjct: 7   VFLTEDASHDAAINHINEEAFGPGRFVRSSERVREQGPHDRQLSFVATDRGETIGSVRMT 66

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           PI     TG+LLGP+ V P ++N GIGR+L+ +++ AAEK GS +++LVGD  YY+ LGF
Sbjct: 67  PILAGTTTGYLLGPLAVRPSHKNLGIGRELVRIALAAAEKSGSPMVLLVGDPPYYAPLGF 126

Query: 152 QAVPWKSLILPAPVDPNRVLF 172
                 +L +P P D +R+L 
Sbjct: 127 APTKPGALTMPGPFDAHRLLA 147


>gi|229100757|ref|ZP_04231594.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-29]
 gi|229116949|ref|ZP_04246332.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock1-3]
 gi|228666477|gb|EEL21936.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock1-3]
 gi|228682667|gb|EEL36708.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-29]
          Length = 174

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    K IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DKEIV 60

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE+    +    L P+ + P +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQGGTTVDSLALAPVSIAPSHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++GIV+  
Sbjct: 121 HPEYYPKFGFERASQWNIKAPFEVPDEVFMVMELRENTLQGVEGIVQYS 169


>gi|300773930|ref|ZP_07083799.1| GNAT family acetyltransferase [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760101|gb|EFK56928.1| GNAT family acetyltransferase [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 178

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/190 (26%), Positives = 74/190 (38%), Gaps = 25/190 (13%)

Query: 5   NIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLL 64
            I++RK     F +     R  ++          E  S                     L
Sbjct: 2   EIKIRKEEKEDFKKVFELIRLAFEN---------EELSDHKEQF-----------LVERL 41

Query: 65  REQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGR 119
           R        LS +     +I G + +T I+IE           L P+ V P YQ KGIG 
Sbjct: 42  RNSDAFVPELSLIAEVDNQIAGYILLTKINIEDKDKNTYTSLALAPVAVLPNYQGKGIGG 101

Query: 120 KLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNV 179
           KLI  + D A+K G   ++L+G   YY K G++      + LP  V     + + L QN 
Sbjct: 102 KLIQAAHDIAKKMGFGSVMLLGHENYYPKFGYKLTKEFGIKLPFEVPEENCMAIELSQNA 161

Query: 180 AQNIKGIVRC 189
            QN+ G+VR 
Sbjct: 162 LQNVSGVVRY 171


>gi|153011559|ref|YP_001372773.1| GCN5-related N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151563447|gb|ABS16944.1| GCN5-related N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 200

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/162 (30%), Positives = 73/162 (45%), Gaps = 7/162 (4%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMTPIS 94
           E LEH  +  A+   + G GR  +++  LR   +    L+F    E   + G+VR+  + 
Sbjct: 24  ETLEHVLAREALLDRAMGEGRHRKSSEKLRRGRLPADGLAFAALGEDGLLAGTVRLWNVH 83

Query: 95  IE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
                    +   LLGP+ V P     GIG  L+  ++D A+ +G   I+LVGD  YY +
Sbjct: 84  AGLDVFGFPVPALLLGPLAVDPSAAGCGIGSALMRRAIDEAKDRGHGAIILVGDPEYYER 143

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            GF A     L +P P +  R L L L         GI+R  
Sbjct: 144 FGFTAEKTGELAMPGPYEKRRFLALELKPGHLDGTHGILRAS 185


>gi|229168226|ref|ZP_04295952.1| GCN5-related N-acetyltransferase [Bacillus cereus AH621]
 gi|228615223|gb|EEK72322.1| GCN5-related N-acetyltransferase [Bacillus cereus AH621]
          Length = 174

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F           +R+       LS +    + IV
Sbjct: 2   VTIRQEQQNDYSKTEEVVKAAFLNEEFSDKTEHELVSRIRKCDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I IE     +    L P+ V P +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHILLSKIKIEQGATSVESLALAPVSVAPSHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALEGVEGIVQYS 169


>gi|154246082|ref|YP_001417040.1| GCN5-related N-acetyltransferase [Xanthobacter autotrophicus Py2]
 gi|154160167|gb|ABS67383.1| GCN5-related N-acetyltransferase [Xanthobacter autotrophicus Py2]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 2/156 (1%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTP 92
            LE +E  +   A+     G  RF +++  LRE  +    L+F       R+VG+VR+  
Sbjct: 28  VLETVEDVAPREALLDLCLGAERFSKSSERLREGRLPAQGLAFAARGPDGRLVGTVRLWN 87

Query: 93  ISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           ++     +  LLGP+ VHP +Q  G+G  L+  ++DAA  KG   ++LVGD AYY + GF
Sbjct: 88  VAAGPGKSALLLGPLAVHPWFQAHGLGASLMRAALDAARAKGHGAVILVGDAAYYERFGF 147

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            A    +L +P P   +R+L + L         G++
Sbjct: 148 SAYKTGALWMPGPHARDRLLAVELEAGALDGAHGLI 183


>gi|229104017|ref|ZP_04234693.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-28]
 gi|228679361|gb|EEL33562.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-28]
          Length = 174

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    K IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKKAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DKEIV 60

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE+    +    L P+ + P +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQGGTTVDSLALAPVSIAPSHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++GIV+  
Sbjct: 121 HPEYYPKFGFERASQWNIKAPFEVPDEVFMVMELRENTLQGVEGIVQYS 169


>gi|312116307|ref|YP_004013903.1| GCN5-related N-acetyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221436|gb|ADP72804.1| GCN5-related N-acetyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 173

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 87/158 (55%), Gaps = 4/158 (2%)

Query: 35  LERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
             RL+      A+   +  +FGPGRF R A  +RE  + D  L+        +VG++ +T
Sbjct: 7   TIRLQTPDDQPALQYLNECAFGPGRFARTAYRVRENSVRDPRLNLCMELDGVMVGAMDLT 66

Query: 92  PISIEKIT-GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           P+++  +    LLGP++V   +Q+ G G +L+   +  A+  G ++++LVGD+ YY + G
Sbjct: 67  PVTVGDVPGALLLGPLIVSGDHQSLGHGLRLMLYGLKRAKDLGYRIVILVGDLPYYLRAG 126

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           F  +P   + LP PVDP R+L+  LV    +   G++R
Sbjct: 127 FCPIPRGRIELPGPVDPARLLYAELVPGALEEYSGLIR 164


>gi|86358662|ref|YP_470554.1| acetyltransferase protein [Rhizobium etli CFN 42]
 gi|86282764|gb|ABC91827.1| probable acetyltransferase protein [Rhizobium etli CFN 42]
          Length = 166

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 112/164 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+CA+    + 
Sbjct: 2   YKHDLVYLTEDASHDAAIEHINEEAFGPGRFARAAARIREQGPHDLSLSFICADDGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGS+ ++L+GD  YY
Sbjct: 62  SVRMTPVLAGTVKGHLLGPLAVRPSHKNIGIGRELVRIAVEAARRKGSEAVILIGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             LGF+ V + +L  P PVDP RVL +P+ + V + +KGI+   
Sbjct: 122 GPLGFEKVAYNALSFPGPVDPGRVLVVPIAEGVHERLKGIIAWH 165


>gi|289550019|ref|YP_003470923.1| hypothetical protein SLGD_00648 [Staphylococcus lugdunensis
           HKU09-01]
 gi|289179551|gb|ADC86796.1| hypothetical protein SLGD_00648 [Staphylococcus lugdunensis
           HKU09-01]
          Length = 176

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 70/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
             F  R E          +  ++F    +       ++  LR        LS +  +  +
Sbjct: 1   MDFTIRTEEKEDYKFTEEVVKNAFANESYSDQSEHRLVANLRNSDAFVPDLSLVAVDKNK 60

Query: 84  IVGSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           ++G + +T I      +      L P+ V P YQNKG+GR LI  S++ A+K     +++
Sbjct: 61  MIGHILLTKIVIVNDEKNTESLALAPVSVLPDYQNKGVGRSLIQKSLEIAKKLNFGSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V    ++ + L +N      G+++  
Sbjct: 121 MGHAEYYPKFGFKQASNWGIQAPFDVPDELLMAIELKKNALDEASGVIQYS 171


>gi|315659350|ref|ZP_07912214.1| GNAT family acetyltransferase [Staphylococcus lugdunensis M23590]
 gi|315495775|gb|EFU84106.1| GNAT family acetyltransferase [Staphylococcus lugdunensis M23590]
          Length = 176

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 70/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
             F  R E          +  ++F    +       ++  LR        LS +  +  +
Sbjct: 1   MDFTIRTEEKEDYKFTEEVVKNAFANETYSDQSEHRLVANLRNSDAFVPDLSLVAVDKNK 60

Query: 84  IVGSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           ++G + +T I      +      L PI V P YQNKG+GR LI  S++ A+K     +++
Sbjct: 61  MIGHILLTKIVIVNDEKNTESLALAPISVLPDYQNKGVGRSLIQKSLEIAKKLNFGSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V    ++ + L +N      G+++  
Sbjct: 121 MGHAEYYPKFGFKQASNWGIQAPFDVPDELLMAIELKKNALDEASGVIQYS 171


>gi|300773771|ref|ZP_07083640.1| GNAT family acetyltransferase [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300759942|gb|EFK56769.1| GNAT family acetyltransferase [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 185

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/180 (23%), Positives = 74/180 (41%), Gaps = 8/180 (4%)

Query: 20  ICWRRSRWQKIGA-FFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLS 75
           +C +      I +   + R E +  I  +      +F      +    LR    +  +LS
Sbjct: 1   MCKQMEYKHIIDSKDLIIRQEEEPDIAEVFHVNVAAFDQEDEAKLVDALRLSDAYVPNLS 60

Query: 76  FLCAEGKRIVGSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
            +      I+G V  T I IE          L P+ V P +QN  IG++LI   +  A +
Sbjct: 61  LVAVYNAEIIGHVMFTKIIIENEEHAVESLALAPVAVLPEFQNMKIGQQLIDAGLSVARQ 120

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            G + ++++G  AYY++ GF      ++  P  V     + + L +   + + GIVR   
Sbjct: 121 AGFRSVIVLGHPAYYARFGFAPAIKWNIKPPFDVPSENFMAIELHKGALEQVYGIVRYSA 180


>gi|86751646|ref|YP_488142.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86574674|gb|ABD09231.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 195

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 71/157 (45%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S I A   +    FG GR  R    LR+       L+F      R+VG+VR+
Sbjct: 18  FAIRAEQSSDIAARERLLDACFGEGRHARTCQRLRDGRAPAEGLAFSAVRQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V    +  G+G  L+  ++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVDAGGRAALVLGPLAVDSSCREFGVGGALMRAALAEAAARGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F +     L LP P + +R+L L L         G++
Sbjct: 138 FTSDKMGLLALPGPFERDRLLGLELRDGALDGANGVI 174


>gi|228992174|ref|ZP_04152108.1| GCN5-related N-acetyltransferase [Bacillus pseudomycoides DSM
           12442]
 gi|228767537|gb|EEM16166.1| GCN5-related N-acetyltransferase [Bacillus pseudomycoides DSM
           12442]
          Length = 175

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 69/172 (40%), Gaps = 13/172 (7%)

Query: 32  AFFLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E +            A   ++F   +       +R+       LS +    K 
Sbjct: 1   MNIKIRQELEKDYNGAEEVVKQAFLNEAFSDQKEHELVNRIRKCDAFIPELSLVAV-DKE 59

Query: 84  IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +VG V ++ +        +    L P+ V P  Q KGIG  LIS  +  A++ G   +++
Sbjct: 60  VVGHVLLSKVKIVDGDTSVESLALAPVSVVPDCQKKGIGSLLISHVLRKAKELGYHSVIV 119

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K  F+     ++  P  V     + + L +N  QNI+GIV+  E
Sbjct: 120 LGHKDYYPKFDFKPASIWNICAPFEVPDEVFMAMELTENALQNIQGIVQYSE 171


>gi|159898875|ref|YP_001545122.1| GCN5-related N-acetyltransferase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159891914|gb|ABX04994.1| GCN5-related N-acetyltransferase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 168

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  +    I  ++  +F  GR   A ++   +     ++S +     ++VG +  
Sbjct: 2   IQIRPETSADSATITTINQAAF--GRAGEADLVTALRQAS-TTISLVAELDGQLVGHILF 58

Query: 91  TPISIEKITGHL----LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +P+  ++   HL    LGP+ V P +Q  GIG  L+   ++A  +   Q +V++G   YY
Sbjct: 59  SPVQYDQAPSHLKIWGLGPLAVLPSHQRTGIGAALVKAGIEACRQAAIQALVVLGGPEYY 118

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF       L    PVD    +   LV      + G +   
Sbjct: 119 QRFGFWPAANWHLRCHYPVDAKFFMAQELVDGALAGLDGSISYH 162


>gi|158421956|ref|YP_001523248.1| putative acetyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158328845|dbj|BAF86330.1| putative acetyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 228

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/169 (27%), Positives = 83/169 (49%), Gaps = 3/169 (1%)

Query: 21  CWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
             + +R   +     E+ E  ++  A+      P RF +A+  +RE  +    L+     
Sbjct: 37  PLKAAREMSMIEIVAEKREEAAAREALLDLCL-PERFEKASERIREDRLPAEGLALAAHG 95

Query: 81  -GKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
              R+  +VR+  +S        LLGP+ VHP ++++G+G +++  +++ AE  G   ++
Sbjct: 96  PDGRLAATVRLWHVSAGPARPALLLGPLAVHPWFRDRGLGGQMMRAALERAEALGHDAVL 155

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           LVGD  YY++ GF A     L +P P DP R+L L L        +G++
Sbjct: 156 LVGDAPYYARFGFSAQKTSGLWMPGPFDPARLLGLELKPGALDGARGLI 204


>gi|227539623|ref|ZP_03969672.1| possible acetyltransferase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240536|gb|EEI90551.1| possible acetyltransferase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 185

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 8/180 (4%)

Query: 20  ICWRRSRWQKIGA-FFLERLEHDSSICAMH---ADSFGPGRFVRAAVLLREQGMHDLSLS 75
           +C +      I +   + R E +  +  +      +F      +    LR    +  +LS
Sbjct: 1   MCKQMEYKHIIDSKDLIIRQEEEPDMAEVFHVNVVAFDQEDEAKLVDALRLSNAYVPNLS 60

Query: 76  FLCAEGKRIVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
            +      ++G V  T I+IE          L P+ V P +QN  IG++LI   +  A +
Sbjct: 61  LVAVYNAEVIGHVMFTRITIENEGHAVESLALAPVAVLPEFQNMKIGQRLIDAGLSVARQ 120

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            G + ++++G  AYY++ GF      ++  P  V     + L LV+   + + G+VR  E
Sbjct: 121 TGFRSVIVLGHPAYYARFGFAPAINWNIKPPFDVPSENFMALELVKGALEQVYGVVRYSE 180


>gi|148252904|ref|YP_001237489.1| putative acetyltransferase (GNAT) family protein [Bradyrhizobium
           sp. BTAi1]
 gi|146405077|gb|ABQ33583.1| Putative Acetyltransferase (GNAT) family protein [Bradyrhizobium
           sp. BTAi1]
          Length = 197

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F+ R E  S +    A+    FG  R  R    LR+       L+     G  +VG++R+
Sbjct: 18  FVIRSERASDVAAREALLDACFGDNRHERTCQRLRDGRAPAAGLALSAMRGGVLVGTLRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S       +LGP+ V    ++ G+G  L++ ++  A  +G   +VL+GD  YY++ G
Sbjct: 78  WHVSAGGRDALMLGPLAVAAEARSLGVGAALMNAALMIAASRGHGAVVLLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A     L LP   +  R+L L LV+       G++
Sbjct: 138 FDAAKAAELELPGAFERARLLGLELVEGALDGAVGMI 174


>gi|150397480|ref|YP_001327947.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
 gi|150028995|gb|ABR61112.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
          Length = 186

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 109/165 (66%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
            +    +  E   HD +I  ++ ++FGPGRF RAA  +REQG HD SLSF+CA+    + 
Sbjct: 2   KKHDLVYLTEDASHDPAIEVINEEAFGPGRFARAAARIREQGPHDRSLSFICADDGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMT ++   + GHLLGP+ V P ++NKGIGR+L+ ++VDAA ++GS+ ++LVGD  YY
Sbjct: 62  SVRMTAVTAGSVKGHLLGPLAVRPSHKNKGIGRELVRIAVDAARRRGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             LGF+ V   +L  P PVDP RVL +P+  +V   + G++  R+
Sbjct: 122 QPLGFEKVRHGALEFPGPVDPARVLVVPMAPDVHARLAGVIAWRD 166


>gi|126725938|ref|ZP_01741780.1| putative acetyltransferase, GNAT family protein [Rhodobacterales
           bacterium HTCC2150]
 gi|126705142|gb|EBA04233.1| putative acetyltransferase, GNAT family protein [Rhodobacterales
           bacterium HTCC2150]
          Length = 159

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS-VRMTPIS 94
           E+ E    + A++   F PGR   ++  LR+       LS +  +   ++G+ +R  P+ 
Sbjct: 7   EQKEDYWEVEALYDLCFAPGREALSSYRLRDGVPFLADLSLVMRDELGVLGAAIRYWPVL 66

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +      LLGP+ VHP  Q +G+G  LIS S   A K G + ++LVGD +YYS+ GF+ +
Sbjct: 67  VGDTPVVLLGPVAVHPTRQGEGLGGLLISESTSRAAKLGWKHVLLVGDYSYYSRFGFERM 126

Query: 155 PWKSLILPAPVDPNRVLFLPLVQ-NVAQNIKGIVR 188
           P  +L  P P + +RVL   L+  +      G V+
Sbjct: 127 P--NLQFPPPTNQSRVLGHSLIDTDFPTGQVGKVK 159


>gi|194366208|ref|YP_002028818.1| GCN5-related N-acetyltransferase [Stenotrophomonas maltophilia
           R551-3]
 gi|194349012|gb|ACF52135.1| GCN5-related N-acetyltransferase [Stenotrophomonas maltophilia
           R551-3]
          Length = 168

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 76/167 (45%), Gaps = 14/167 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  +   A+HA +    R           ++   +   +LS+S +      +V
Sbjct: 1   MNIQIRTETTADHAAIHALTEAAFRQAPHSSHTEQFIVDALRSRGELSISLVAEAQGEVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++          LGPI V P +Q +GIG  L+  +++A  ++G+   VL+G+ 
Sbjct: 61  GHIALSPVTVSDGSTGWFGLGPISVLPAWQGQGIGAALMHAALEALRQQGAYGCVLLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF+A P   L+LP  V       L L   +AQ   G V+  
Sbjct: 121 AYYGRFGFRAEP--GLVLPG-VPAEYFQALCLQPPLAQ---GEVQYS 161


>gi|296446217|ref|ZP_06888164.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
 gi|296256254|gb|EFH03334.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
          Length = 212

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 76/158 (48%), Gaps = 4/158 (2%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F    E  + +    A+  ++FGP RF++    LR        L+ +  + +R+V ++R+
Sbjct: 34  FDIVDETPADVDAREALLDEAFGPARFLKTCERLRAGRRPARGLALVAMDDERLVATLRL 93

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             I         LLGP+ V   +++ G+G  +I   +  A  +G   ++LVGD  YY + 
Sbjct: 94  WDIHAGPGRPALLLGPLAVARSHRSLGLGAAMIETGLARAAARGHGAVLLVGDAPYYERF 153

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           GF     + L++P PV+  R L L L++      +G V
Sbjct: 154 GFDVALTEGLVMPGPVERERFLGLELIEGALAGAQGRV 191


>gi|222086627|ref|YP_002545161.1| acetyltransferase protein [Agrobacterium radiobacter K84]
 gi|221724075|gb|ACM27231.1| acetyltransferase protein [Agrobacterium radiobacter K84]
          Length = 189

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 110/165 (66%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD+ I  ++ ++FGPGRF RAA  +REQG HD SLSF+CA+    + 
Sbjct: 2   YKHDLVYLTEDASHDAVIELINEEAFGPGRFARAAARIREQGPHDRSLSFICADDGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+    + GHLLGP+ V P ++N+GIGR+L+ ++++AA +KGS+ ++LVGD  YY
Sbjct: 62  SVRMTPVFAGSVKGHLLGPLAVRPSHKNRGIGRELVRIAIEAARRKGSEAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             LGF+ V + +L  P PVDP RVL +PL  +  + +KG +   +
Sbjct: 122 GPLGFEKVAYNALAFPGPVDPGRVLVVPLAADTHERLKGTIAWHD 166


>gi|47564611|ref|ZP_00235656.1| acetyltransferase, GNAT family [Bacillus cereus G9241]
 gi|47558763|gb|EAL17086.1| acetyltransferase, GNAT family [Bacillus cereus G9241]
          Length = 174

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KG+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALEGVKGVVQYS 169


>gi|254518298|ref|ZP_05130354.1| acetyltransferase [Clostridium sp. 7_2_43FAA]
 gi|226912047|gb|EEH97248.1| acetyltransferase [Clostridium sp. 7_2_43FAA]
          Length = 175

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 71/170 (41%), Gaps = 12/170 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFV---RAAVLLREQGM--HDLSLSFLCAEGKRIV 85
            + R E +     +      SF    F       ++ R +        LS L     +IV
Sbjct: 2   IIIRQEVNKDYKEVENVIEESFKSAEFTDNDEHNLVKRLRNSDEFIKELSLLAEINNKIV 61

Query: 86  GSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T   I+          L P+ V P +Q  GIG+KL++ +++ +++ G + IV++G
Sbjct: 62  GHILLTKALIKSENKDVETLALAPLAVLPNHQKNGIGKKLVNEAIEKSKELGYKSIVVLG 121

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
              YY K GF+      +  P  V     + L L+ N    + G+V   +
Sbjct: 122 HEHYYPKFGFKKASNYGIKAPFDVPDEAYMVLELIPNALNEVNGVVEYSK 171


>gi|227822879|ref|YP_002826851.1| putative acetyltransferase protein [Sinorhizobium fredii NGR234]
 gi|227341880|gb|ACP26098.1| putative acetyltransferase protein [Sinorhizobium fredii NGR234]
          Length = 184

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 111/165 (67%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
            +    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HD SLSF+C +    + 
Sbjct: 2   KKHDLVYLTEDASHDAAIEIINEEAFGPGRFARAAARIREQGPHDRSLSFICTDDGETIA 61

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP++   + GHLLGP+ V P ++N GIGR+L+ ++V+AA +KGSQ ++LVGD  YY
Sbjct: 62  SVRMTPVNAGSVKGHLLGPLAVRPSHKNMGIGRELVRIAVEAARRKGSQAVILVGDPPYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             LGF+ V + +L  P PVDP RVL +P+  ++   ++G++  R+
Sbjct: 122 QPLGFEKVRYAALEFPGPVDPARVLVVPIGADIHARLEGVIAWRD 166


>gi|300777281|ref|ZP_07087139.1| GNAT family acetyltransferase [Chryseobacterium gleum ATCC 35910]
 gi|300502791|gb|EFK33931.1| GNAT family acetyltransferase [Chryseobacterium gleum ATCC 35910]
          Length = 197

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 74/189 (39%), Gaps = 25/189 (13%)

Query: 6   IELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLR 65
           +E+RK +   F       ++ ++K         E  S             +       LR
Sbjct: 22  VEIRKEVKEDFGTVFELIKNAFEK---------EEYSDH-----------KEQYLVESLR 61

Query: 66  EQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRK 120
                   LS +     +IVG + +T I+I            + P+ V P +Q  GIG K
Sbjct: 62  SSDAFVPELSLIAEVNNQIVGYILLTKINIIDADRKINTSLAMAPVAVLPEFQGNGIGAK 121

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           LI  +   A++ G   +VL+G   YY K G++      + LP  V     + + L +N  
Sbjct: 122 LIEAAHHKAKELGFGSVVLLGHENYYPKFGYKLTKEFGIKLPFDVPDANCMAIELTENAL 181

Query: 181 QNIKGIVRC 189
            NI GIV+ 
Sbjct: 182 LNISGIVQY 190


>gi|254470591|ref|ZP_05083995.1| acetyltransferase [Pseudovibrio sp. JE062]
 gi|211960902|gb|EEA96098.1| acetyltransferase [Pseudovibrio sp. JE062]
          Length = 191

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 56/156 (35%), Positives = 84/156 (53%), Gaps = 5/156 (3%)

Query: 35  LERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
           L R E  +    I  M A++FGP RF R A  +R+       L F+  +   I GSV++T
Sbjct: 7   LVRQETPADFLEIEQMQAEAFGPARFERTAFKIRDGVQQASHLCFVGEQNGEIAGSVKLT 66

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           PI +      LLGP+ V   ++ +G+GR L++   + A+ +G Q I+LVGD  YY   G+
Sbjct: 67  PIMVGTQKSMLLGPLTVKATFKGQGLGRLLLTTVAEEAKAQGVQSILLVGDHPYYGPHGY 126

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQ--NIKG 185
           + VP   + LP PVDP+R+L L L        ++ G
Sbjct: 127 EQVPHGQITLPGPVDPDRLLVLMLQDEAMPVGHVSG 162


>gi|49475972|ref|YP_034013.1| acetyltransferase [Bartonella henselae str. Houston-1]
 gi|49238780|emb|CAF28046.1| Acetyltransferase [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/169 (28%), Positives = 77/169 (45%), Gaps = 9/169 (5%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVG 86
            AFF    E ++       +   + G GR  +++ +LR   +    LSF+       +VG
Sbjct: 9   DAFFTLASEQEADKPHREHLLDLTLGKGRKRKSSEVLRRGRLAACGLSFVVKNTLGELVG 68

Query: 87  SVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           SVR+  +   K         LLGP+ V       GIG  L+  ++  A+K G   I LVG
Sbjct: 69  SVRLWHVQFNKGHNEIQHALLLGPLAVAAECSGIGIGSALMRHAIATAKKMGYGAIFLVG 128

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           D A+Y + GF +   K+L +P P + +R   L L+ +   +  GI+   
Sbjct: 129 DCAFYQRFGFSSSLTKNLAMPGPYEKHRFQALELIPHYLTSCHGILTPS 177


>gi|330448652|ref|ZP_08312300.1| acetyltransferase family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492843|dbj|GAA06797.1| acetyltransferase family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 168

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 15/161 (9%)

Query: 34  FLERLEHDSSICAMHADSFG---------PG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
            + R E DS I A+   ++          PG       ++ R +  + L+LS +     +
Sbjct: 1   MIIRAEKDSDITAIETLTYNAFKDHPHHEPGAEPTEHLIVNRLRDANALTLSLIAEANNQ 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           ++G +  +P+ I       + L P+ V P +QNKGIG+ LI+  +   +++G++ +VL+G
Sbjct: 61  VIGHIAFSPVLINGEATNWYGLAPVSVLPEHQNKGIGKALINQGLAQLKERGAEGLVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           +  YY +  F+A P  +L     V     L LP+  ++   
Sbjct: 121 EPEYYGRFDFKAQPELTLT---GVPAEYFLALPIKDSIPAG 158


>gi|220921640|ref|YP_002496941.1| GCN5-related N-acetyltransferase [Methylobacterium nodulans ORS
           2060]
 gi|219946246|gb|ACL56638.1| GCN5-related N-acetyltransferase [Methylobacterium nodulans ORS
           2060]
          Length = 187

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  + I A   +    FG  RF +    LRE  +    L+       R+VGSVR+
Sbjct: 2   IQIRDERLADIAARERLLDTCFGEARFAKTCERLREGRLPAEGLALSAERNGRLVGSVRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             ++        +LGPI V P  Q  G+G +L+  ++  A   G + ++LVGD  YY++ 
Sbjct: 62  WNVAAGPNRPALMLGPIAVEPDLQGHGVGGRLMREALARAAALGHRAVILVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF A     L LP P    R L L LV +      G+V+
Sbjct: 122 GFAAETTGDLWLPGPYARERFLGLELVPDALAGAAGLVQ 160


>gi|218530276|ref|YP_002421092.1| GCN5-related N-acetyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|218522579|gb|ACK83164.1| GCN5-related N-acetyltransferase [Methylobacterium chloromethanicum
           CM4]
          Length = 185

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S + A   +    FGPGRF++ +  LRE  +    L+     G+++VG+VR+
Sbjct: 2   IQIRNETASDVVAREHLLDACFGPGRFLKTSQRLREGRLPARGLALSAVRGEKLVGTVRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q  G+G  L+  ++  A   G   ++LVGD  YY++ 
Sbjct: 62  WDVETGCGRPALLLGPLAVDPEVQGAGLGGALMRAALAEAAAFGHGAVLLVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF       L +P P +  R L L L  +     +G++R
Sbjct: 122 GFAPEKAAGLYMPGPFERERFLGLELAAHALAGAEGVLR 160


>gi|163848689|ref|YP_001636733.1| GCN5-like N-acetyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222526631|ref|YP_002571102.1| GCN5-related N-acetyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163669978|gb|ABY36344.1| GCN5-related N-acetyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222450510|gb|ACM54776.1| GCN5-related N-acetyltransferase [Chloroflexus sp. Y-400-fl]
          Length = 171

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 65/166 (39%), Gaps = 9/166 (5%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
              + R E      A++     +F   R   A ++   +    + LS +     RIVG +
Sbjct: 1   MKTMIRPETADDFNAIYLINQLAFN--RENEAHLVEELRSAGAIILSLVAQMEDRIVGHI 58

Query: 89  RMTPISIEKITGH----LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             +P+ I     H     LGP+ V P  Q++GIG  LI   +    K G  V+V++G   
Sbjct: 59  LFSPVVITDADAHWQAVGLGPMAVLPQLQHRGIGSALIHAGLAELNKLGHDVVVVLGHPG 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +Y + GF+      +     V     +   L        KG+VR  
Sbjct: 119 FYPRFGFKPSKPFGIAWEIDVPEEVFMVKELRSGALNGRKGVVRYH 164


>gi|228986573|ref|ZP_04146706.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228773144|gb|EEM21577.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 174

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKHIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGVSVDSLALAPVSVARSYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KG+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALEGVKGVVQYS 169


>gi|163851468|ref|YP_001639511.1| GCN5-related N-acetyltransferase [Methylobacterium extorquens PA1]
 gi|163663073|gb|ABY30440.1| GCN5-related N-acetyltransferase [Methylobacterium extorquens PA1]
          Length = 213

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
                E  S + A   +    FGPGRF++ +  LRE  +    L+     G+++VG+VR+
Sbjct: 30  IQIHNETASDVVAREHLLDACFGPGRFLKTSQRLREGRLPARGLALSAVRGEKLVGTVRL 89

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q  G+G  L+  ++  A   G   ++LVGD  YY++ 
Sbjct: 90  WDVETGCGRPALLLGPLAVDPEVQGAGLGGALMRAALAEAAAFGHGAVLLVGDAPYYARF 149

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF       L +P P +  R L L LV +     +G++R
Sbjct: 150 GFAPEKAAGLYMPGPFERERFLGLELVAHALAGAEGVLR 188


>gi|315179954|gb|ADT86868.1| acetyltransferase [Vibrio furnissii NCTC 11218]
          Length = 169

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 18/170 (10%)

Query: 34  FLERLEHDSSICAMHADSFG---------PG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
              R E  + I ++   ++          PG +     ++   +    LSLS +C +   
Sbjct: 1   MNIRPETPADITSIEQVTYRAFENHPHHEPGAKPTEHRIVATLREAGALSLSLICEDDTG 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           I+G +  +PI I+      + LGP+ V P  Q +GIG  LI  S+   + +G+Q +VL+G
Sbjct: 61  IIGHIAFSPIHIDGAACDWYGLGPVSVVPERQGEGIGGALIRESLSVLKAQGAQGVVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +  YY + GFQ+ P  +L  P  V     + L L   +     G V    
Sbjct: 121 EPQYYQRFGFQSQP--NLTYPG-VPAEYFMALSLADAIP---SGEVTYHA 164


>gi|228909281|ref|ZP_04073107.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis IBL 200]
 gi|228850370|gb|EEM95198.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis IBL 200]
          Length = 174

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLKEEFSDETEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G V ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHVMLSKITIEQGGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++G+V+  
Sbjct: 121 HPEYYPKFGFKKASKWNIKAPFEVPEEVFMVMELRENALEGVEGVVQYS 169


>gi|229197609|ref|ZP_04324332.1| GCN5-related N-acetyltransferase [Bacillus cereus m1293]
 gi|228585873|gb|EEK43968.1| GCN5-related N-acetyltransferase [Bacillus cereus m1293]
          Length = 174

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 73/169 (43%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVATGYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALESVEGVVQYS 169


>gi|16124660|ref|NP_419224.1| acetyltransferase [Caulobacter crescentus CB15]
 gi|221233349|ref|YP_002515785.1| acetyltransferase [Caulobacter crescentus NA1000]
 gi|13421566|gb|AAK22392.1| acetyltransferase, GNAT family [Caulobacter crescentus CB15]
 gi|220962521|gb|ACL93877.1| acetyltransferase [Caulobacter crescentus NA1000]
          Length = 176

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/154 (33%), Positives = 81/154 (52%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
            +E    ++++ A+    FGPGRF +++  LRE        SF+       VG VRM P+
Sbjct: 17  VIETPAMEAAVTALIDRVFGPGRFAKSSERLREGNTLLADCSFVSLRDGAPVGCVRMWPV 76

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
           +I       LGP+ V P  ++ G+G+ L+  + +AA   G + ++LVGD  Y+ ++GF  
Sbjct: 77  TIGGEPVAFLGPLAVDPDERSAGLGQALVEAACEAARAAGWRAVLLVGDGPYFGRVGFTN 136

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
                +I+P PVD  RVL LPL     Q + G V
Sbjct: 137 AHTAGVIMPGPVDQRRVLLLPLRDGGDQGLSGPV 170


>gi|150397969|ref|YP_001328436.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
 gi|150029484|gb|ABR61601.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
          Length = 196

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F+   E    + A   +   + GPGR  +++  LR   +    L+ +  +    ++G+VR
Sbjct: 17  FVIDSETPGDVVARENLLDRAMGPGRRRKSSEKLRRGRVPAEGLALVARDTDGHVIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          +   LLGP+ V P ++ KGIG  L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNVEAGVNREGQAVPALLLGPLAVDPAHEGKGIGGMLMRAAIQEAKNRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           AYY + GF A   + L++P P + NR L L L         G++
Sbjct: 137 AYYERFGFFAHRAQHLVMPGPFERNRFLALELKDGWLDGAAGML 180


>gi|89097657|ref|ZP_01170545.1| GCN5-related N-acetyltransferase [Bacillus sp. NRRL B-14911]
 gi|89087516|gb|EAR66629.1| GCN5-related N-acetyltransferase [Bacillus sp. NRRL B-14911]
          Length = 170

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 11/165 (6%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSV 88
            + R E ++       +H  +F   R   AA++  +R  G +   LS    +GK IVG +
Sbjct: 1   MIIRTEQEADYSRSEHVHRLAFS--RENEAALVRAIRSSGEYIPELSLTAEDGKDIVGHI 58

Query: 89  RMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             +         ++    L P+ V P  QN+GIG  LI   +  AE +G    V++G   
Sbjct: 59  MFSKAVIDTGEGEVPTLALAPVAVMPQRQNEGIGSLLIREGLKQAELQGFAHAVVLGHPD 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           YY + GF+      +  P PV     + +   +     I G V+ 
Sbjct: 119 YYPRFGFRPSTVFGIFSPFPVPEEVFMVMEFKEGSLTGISGTVKY 163


>gi|254450511|ref|ZP_05063948.1| acetyltransferase, gnat family [Octadecabacter antarcticus 238]
 gi|198264917|gb|EDY89187.1| acetyltransferase, gnat family [Octadecabacter antarcticus 238]
          Length = 157

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 78/159 (49%), Gaps = 10/159 (6%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG-SVR 89
              R E       +  ++  +F PGR   ++  LR+      +   +   G  ++G ++R
Sbjct: 1   MELRDETTDDWWGVETLYDLTFAPGRKALSSYRLRDDVPPIAAFCRVVRSGDGVIGGAIR 60

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             PI IE  +  LLGP+ VHP  Q +G+G  +I   ++ A   G   ++LVGD  YY++ 
Sbjct: 61  CWPIRIEDHSALLLGPVAVHPTRQGEGLGGLMIRDVLERAAPAGWPRVLLVGDAPYYARF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF+  P   +++P P +PNR+L           I+G VR
Sbjct: 121 GFR--PLNGVVMPPPTNPNRILGH----GPWAGIRGRVR 153


>gi|304393667|ref|ZP_07375595.1| acetyltransferase protein [Ahrensia sp. R2A130]
 gi|303294674|gb|EFL89046.1| acetyltransferase protein [Ahrensia sp. R2A130]
          Length = 180

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/158 (36%), Positives = 82/158 (51%), Gaps = 4/158 (2%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
           LE     + + A+    FGP    RAA +LR +       +F+      I+G+VR+TPI 
Sbjct: 21  LETAADSAEVAALIERVFGPAILTRAAHVLRGETTSVPQFTFVARRDDTIIGTVRLTPIR 80

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE----KKGSQVIVLVGDIAYYSKLG 150
             +    +LGP+ V PL +N G+GRKL+   +DAA      +    ++LVGD  YY   G
Sbjct: 81  WGEREVLMLGPLGVDPLAKNMGVGRKLMKTVMDAARADQNAERWGAVMLVGDPPYYHPFG 140

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           F+AVP      P PVDP RVL   L +  A+++ G  R
Sbjct: 141 FRAVPHGKFEAPLPVDPMRVLVAELCEGGAEDLSGNAR 178


>gi|229157071|ref|ZP_04285152.1| GCN5-related N-acetyltransferase [Bacillus cereus ATCC 4342]
 gi|228626561|gb|EEK83307.1| GCN5-related N-acetyltransferase [Bacillus cereus ATCC 4342]
          Length = 174

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFV---RAAV--LLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           +F    F      A+   +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHALVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  ++  A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGYQKKGIGGKLIVAALAKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KG+V+  
Sbjct: 121 HPEYYPKFGFKKASKWNIKAPFEVPEEVFMVMELTENALEGVKGVVQYS 169


>gi|258515731|ref|YP_003191953.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779436|gb|ACV63330.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 170

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 65/163 (39%), Gaps = 7/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R E      A++     +F           +R+   +   LS +      +VG +  
Sbjct: 2   VVIRPESLIEYPAVYNVNLKAFNQDCEPNLVEAIRKSDNYIPELSLVAVINNTVVGHIMF 61

Query: 91  TPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           + I+IE          L P+ V P YQN+ IG KLI   ++   K G  ++++VG   YY
Sbjct: 62  SIIAIETDNEHIPVLSLAPLAVLPDYQNRSIGSKLIKHGLNECRKLGYTIVIVVGHPNYY 121

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + GF     + L     V     + L L      NIKG V+ 
Sbjct: 122 PRFGFIPARSQYLEATFEVPDEAFMVLELSSGALMNIKGTVKY 164


>gi|229018687|ref|ZP_04175539.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1273]
 gi|229024929|ref|ZP_04181359.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1272]
 gi|228736401|gb|EEL86966.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1272]
 gi|228742575|gb|EEL92723.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1273]
          Length = 174

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F           +R+       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYSKTEEVVKQAFLNEEFSDKTEHELVKRIRKCDAFIPELSLVAVDEG-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ ISIE     +    L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHILLSKISIEQDGTSVESLALAPVSVARGHQKKGIGGKLIGAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++G+V+  
Sbjct: 121 HPEYYPKFGFKKTSDWNIKAPFEVPDEVFMVMELRENALQGVEGVVQYS 169


>gi|229047157|ref|ZP_04192773.1| GCN5-related N-acetyltransferase [Bacillus cereus AH676]
 gi|228724188|gb|EEL75529.1| GCN5-related N-acetyltransferase [Bacillus cereus AH676]
          Length = 174

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KGIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENALRGVKGIVQYS 169


>gi|229092455|ref|ZP_04223613.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-42]
 gi|228690918|gb|EEL44691.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock3-42]
          Length = 174

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIGRKLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGRKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKTSEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|13472488|ref|NP_104055.1| hypothetical protein mlr2800 [Mesorhizobium loti MAFF303099]
 gi|14023234|dbj|BAB49841.1| mlr2800 [Mesorhizobium loti MAFF303099]
          Length = 174

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 62/155 (40%), Positives = 95/155 (61%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           +  E   HD  I A++ ++FGPGRFV AA  +RE G H+ +LSF+  +G  +V SVRMT 
Sbjct: 8   YLPETPAHDPEIEAINDEAFGPGRFVLAAYKIREAGGHERALSFVAVDGDLVVASVRMTR 67

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           I+       +LGP+ V P ++N GIGR+L+ ++++AA K G+  ++LVGD  YY  LGF+
Sbjct: 68  IAAGAGRALMLGPLAVRPAFKNLGIGRRLVGIALEAAAKAGAPAVILVGDEPYYGPLGFK 127

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            +P   + +P PVD +R+L   +       + G V
Sbjct: 128 RIPRGQISMPRPVDLDRLLSHEITPGAVARLTGEV 162


>gi|30021582|ref|NP_833213.1| acetyltransferase [Bacillus cereus ATCC 14579]
 gi|229128755|ref|ZP_04257733.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-Cer4]
 gi|29897137|gb|AAP10414.1| Acetyltransferase [Bacillus cereus ATCC 14579]
 gi|228654948|gb|EEL10808.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-Cer4]
          Length = 174

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVIKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KGIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENALRGVKGIVQYS 169


>gi|205375331|ref|ZP_03228121.1| acetyltransferase [Bacillus coahuilensis m4-4]
          Length = 171

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 72/166 (43%), Gaps = 8/166 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSVR 89
              R   +     I A+H  +F      +  V + E   +   LS +  +  R IVG + 
Sbjct: 1   MNIRQAREQDLSQIVAVHDQAFNNKGEGKLVVGIHESDAYIPKLSLVAEDEHRDIVGHLL 60

Query: 90  MTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++         ++    L P+ V P  Q KGIG +LI++S+  A + G Q IV++G   Y
Sbjct: 61  LSKAVIVGDTGEVETLALAPVSVLPALQKKGIGSQLINVSIARARELGFQHIVVLGHSDY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y   GF+      +  P PV     + L L+    + +KG V+  +
Sbjct: 121 YPTFGFKLASKYGIQCPFPVPDEAYMVLELIPGSLKGVKGTVKYAK 166


>gi|319781804|ref|YP_004141280.1| GCN5-related N-acetyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167692|gb|ADV11230.1| GCN5-related N-acetyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 178

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 62/155 (40%), Positives = 95/155 (61%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           +  E   HD  I A++ ++FGPGRFV AA  +RE G H+ SLSF+   G  +V SVRMT 
Sbjct: 8   YLPETPAHDPEIEAINDEAFGPGRFVLAAYKIREAGGHERSLSFVAVNGDIVVASVRMTR 67

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           I+       +LGP+ V P ++N GIGR+L++++++AA + G+  ++LVGD  YY  LGF+
Sbjct: 68  IAAGAGRALMLGPLAVRPAFKNLGIGRRLVAIALEAAARAGAPAVMLVGDEPYYGPLGFK 127

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            +P   + +P PVD +R+L   +       + G V
Sbjct: 128 RIPRGQISMPRPVDLDRLLSHEIAPGAVARLLGEV 162


>gi|260462511|ref|ZP_05810718.1| GCN5-related N-acetyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259031707|gb|EEW32976.1| GCN5-related N-acetyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 194

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 63/155 (40%), Positives = 98/155 (63%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           +  E   HD+ I A++ ++FGPGRFV AA  +RE G H+ +LSF+  +G  +V SVRMT 
Sbjct: 24  YLPEIPAHDAEIEAINDEAFGPGRFVLAAYKIREAGGHERALSFVAVDGDIVVASVRMTR 83

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           I+       +LGP+ V P ++N GIGR+L++++++AA K G+  ++LVGD  YY  LGF+
Sbjct: 84  IAAGPGRALMLGPLAVRPAFKNLGIGRRLVAIALEAAAKAGAPAVILVGDEPYYGPLGFK 143

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            +P   + +P PVD +R+L   +V      + G V
Sbjct: 144 RIPRGQISMPRPVDLDRLLSHEIVPGSVAKLLGEV 178


>gi|23100312|ref|NP_693779.1| hypothetical protein OB2857 [Oceanobacillus iheyensis HTE831]
 gi|22778544|dbj|BAC14813.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 177

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 70/172 (40%), Gaps = 13/172 (7%)

Query: 32  AFFLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEG-K 82
              L R E                    F   +       +R+       LS +  +   
Sbjct: 1   MDILIREERTEEYNTTEKVVKRVFLKEEFSDKKEHLLVNRIRKSDAFIPELSLIAIDQAN 60

Query: 83  RIVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
            I+G + ++ I+     + +    L P+ V P +Q KGIG +LI  ++  A++ G   ++
Sbjct: 61  EIIGHILLSKITIVNDHKTVDSLALAPVSVIPEHQKKGIGSQLIHAALKKAKEIGYHSVI 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           ++G   YY K GF+   + ++  P  V     + L L ++  +N++G+V   
Sbjct: 121 VLGHKDYYPKFGFKQARFWNIQAPFDVPDEVFMALELTEDALENVEGVVHYS 172


>gi|311747958|ref|ZP_07721743.1| acetyltransferase, GNAT family [Algoriphagus sp. PR1]
 gi|126574932|gb|EAZ79290.1| acetyltransferase, GNAT family [Algoriphagus sp. PR1]
          Length = 174

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 68/168 (40%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E  +    + +      +               LR+       LS +     + V
Sbjct: 1   MIIRQETQNDHKEVFSVIESAFKDAEFADHTEQFLVERLRKSDAFIPELSMVAEIDGKTV 60

Query: 86  GSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T + I     +     L P+ V P +Q KGIG KLI  S   A++ G + IVL+G
Sbjct: 61  GHILLTKLKIKNESNEFDSLALAPVSVLPEFQGKGIGGKLILESHKKAKELGYKSIVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY + G++      + LP  V     + + L++N  + + G+V  
Sbjct: 121 HEKYYPRFGYEQADKYGIELPFEVPKENCMVIELIENGLKGVNGMVEY 168


>gi|206975381|ref|ZP_03236294.1| acetyltransferase, GNAT family [Bacillus cereus H3081.97]
 gi|217960892|ref|YP_002339458.1| acetyltransferase, GNAT family [Bacillus cereus AH187]
 gi|229140102|ref|ZP_04268662.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST26]
 gi|206746283|gb|EDZ57677.1| acetyltransferase, GNAT family [Bacillus cereus H3081.97]
 gi|217066019|gb|ACJ80269.1| acetyltransferase, GNAT family [Bacillus cereus AH187]
 gi|228643357|gb|EEK99628.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST26]
          Length = 174

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +  + + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDTFIPELSIVAVD-EEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALESVEGVVQYS 169


>gi|229075384|ref|ZP_04208373.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock4-18]
 gi|228707633|gb|EEL59817.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock4-18]
          Length = 174

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEKVVKEAFSLEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQGGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++GIV+  
Sbjct: 121 HPEYYPKFGFERASQWNIKAPFEVPDEVFMVMELRENTLQGVEGIVQYS 169


>gi|13472620|ref|NP_104187.1| hypothetical protein mll2972 [Mesorhizobium loti MAFF303099]
 gi|14023366|dbj|BAB49973.1| mll2972 [Mesorhizobium loti MAFF303099]
          Length = 211

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 75/161 (46%), Gaps = 6/161 (3%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E  + +    A+   + GP R  +++  LR        L+F+  +    + G+VR
Sbjct: 36  FSMVAETVADVAAREALLDRAMGPMRRKKSSEKLRRGRRPSEGLAFVARDASGGVAGTVR 95

Query: 90  MTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           +  +          LLGP+ V P  +N GIG  L+  +V  A + G   I+LVGD  YY 
Sbjct: 96  LWDVRLGEGGPAALLLGPLAVDPSLKNVGIGSALMRHAVTEAARLGHAAILLVGDAPYYG 155

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + GF A     L +P P + +R+L L LV+     + G ++
Sbjct: 156 RFGFSADKTGRLAMPGPYERHRLLALELVEGALDGVHGTLK 196


>gi|262372747|ref|ZP_06066026.1| acetyltransferase family protein [Acinetobacter junii SH205]
 gi|262312772|gb|EEY93857.1| acetyltransferase family protein [Acinetobacter junii SH205]
          Length = 168

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 67/168 (39%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E ++ I A+   +                ++   +  + L+LS +     ++V
Sbjct: 1   MNIRIRNEQNTDIQAIFDLTQSAFSQVEYSSHTEQFIVNALRENNQLTLSLIAEINNQVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P+S        + LGPI V P YQ  GIG +LI   ++  +   ++  VL+GD 
Sbjct: 61  GHIAFSPVSISDGATDWYGLGPISVLPEYQANGIGSQLIKEGLNKIKALNAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY K GF+A     L     V  +    L    ++     G V   E
Sbjct: 121 NYYGKFGFKADARLILE---DVPADYFQILAFTDHIP---SGYVTYSE 162


>gi|118478747|ref|YP_895898.1| acetyltransferase [Bacillus thuringiensis str. Al Hakam]
 gi|196042757|ref|ZP_03109996.1| acetyltransferase, GNAT family [Bacillus cereus 03BB108]
 gi|225865454|ref|YP_002750832.1| acetyltransferase, GNAT family [Bacillus cereus 03BB102]
 gi|229185708|ref|ZP_04312886.1| GCN5-related N-acetyltransferase [Bacillus cereus BGSC 6E1]
 gi|118417972|gb|ABK86391.1| acetyltransferase, GNAT family [Bacillus thuringiensis str. Al
           Hakam]
 gi|196026241|gb|EDX64909.1| acetyltransferase, GNAT family [Bacillus cereus 03BB108]
 gi|225787712|gb|ACO27929.1| acetyltransferase, GNAT family [Bacillus cereus 03BB102]
 gi|228597795|gb|EEK55437.1| GCN5-related N-acetyltransferase [Bacillus cereus BGSC 6E1]
          Length = 174

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|229191573|ref|ZP_04318554.1| GCN5-related N-acetyltransferase [Bacillus cereus ATCC 10876]
 gi|228591903|gb|EEK49741.1| GCN5-related N-acetyltransferase [Bacillus cereus ATCC 10876]
          Length = 174

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEVFSLEEFSDKTEHELVKRIRECEAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQGGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     +   L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKAPFEVPEEVFMIKELTENALRGVEGIVQYS 169


>gi|324327389|gb|ADY22649.1| acetyltransferase, GNAT family protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 174

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLYEEFSDKKEHELVKRIRECDAFIPELSIIAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIGRKLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGYQKKGIGRKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  +++KG+V+  
Sbjct: 121 HPKYYPKFGFKKASEWNIKAPFEVPEEVFMVMELTENALESVKGVVQYS 169


>gi|254440487|ref|ZP_05053981.1| acetyltransferase, GNAT family [Octadecabacter antarcticus 307]
 gi|198255933|gb|EDY80247.1| acetyltransferase, GNAT family [Octadecabacter antarcticus 307]
          Length = 157

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/154 (27%), Positives = 78/154 (50%), Gaps = 7/154 (4%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMTPIS 94
           E  +    +  ++  +F PGR   ++  LR+      +   +   +   I G++R  PI 
Sbjct: 6   ETTDDWWGVETLYDLTFAPGRKALSSYRLRDDVPPVAAFCRVVRSDDGVIGGAIRCWPIR 65

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           IE+    LLGP+ +HP  Q +G+G  +I   ++ A   G   ++L+GD+ YY++ GF+++
Sbjct: 66  IEQHDALLLGPVAIHPTRQGEGLGGLMIRDVLERAAPAGWPRVLLIGDVPYYARFGFKSL 125

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
               +++P P +P R+L           I+G VR
Sbjct: 126 --NGVVMPPPTNPARILGH----GAWAGIRGRVR 153


>gi|49478986|ref|YP_037580.1| acetyltransferase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52142039|ref|YP_084790.1| acetyltransferase [Bacillus cereus E33L]
 gi|49330542|gb|AAT61188.1| acetyltransferase, GNAT family [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51975508|gb|AAU17058.1| acetyltransferase, GNAT family [Bacillus cereus E33L]
          Length = 174

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|42782549|ref|NP_979796.1| acetyltransferase [Bacillus cereus ATCC 10987]
 gi|42738475|gb|AAS42404.1| acetyltransferase, GNAT family [Bacillus cereus ATCC 10987]
          Length = 174

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQEQQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q I+G+V+  
Sbjct: 121 HSEYYPKFGFKKASEWNIKAPFEVPDEAFMAVELSENALQGIEGVVQYS 169


>gi|116253892|ref|YP_769730.1| acetyltransferase protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258540|emb|CAK09644.1| putative acetyltransferase protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 196

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     GP R  +++  +R   +    L+ +  +    ++GSVR
Sbjct: 17  FAIDAENPSDVVARENLLDRVMGPDRRKKSSEKIRRNRVPAEGLALVARDRDGHVIGSVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V P    KGIG  L+  ++  A+K+G   ++LVGD 
Sbjct: 77  LWNIEAGVNDEGTPINALLLGPLAVAPHQGGKGIGSALMRAAILEAKKRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + L++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAEKARHLVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|167644660|ref|YP_001682323.1| GCN5-like N-acetyltransferase [Caulobacter sp. K31]
 gi|167347090|gb|ABZ69825.1| GCN5-related N-acetyltransferase [Caulobacter sp. K31]
          Length = 177

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 56/160 (35%), Positives = 88/160 (55%), Gaps = 5/160 (3%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC-----AEGKRIVGSV 88
            LER EH  ++ A+   +FGPGRF +++  LRE      + SF+      A   R++GSV
Sbjct: 16  LLERPEHARAVEALVDRAFGPGRFAKSSERLREGNRKLDACSFVALSQEWARDGRVIGSV 75

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           R+ P++I       LGP+ V    +  G+G+ L+  + +AA K G + ++LVGD  Y+ +
Sbjct: 76  RLWPVTIGGQPVAFLGPLAVDADERKHGLGQALVEAACEAAAKAGWRAVLLVGDAPYFGR 135

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           +GF + P    I+P P D  RVL   LV+    N+ G +R
Sbjct: 136 IGFSSAPAAQAIMPGPADQRRVLVKALVEGGDANLVGPIR 175


>gi|254561231|ref|YP_003068326.1| acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens DM4]
 gi|254268509|emb|CAX24466.1| Putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Methylobacterium extorquens DM4]
          Length = 185

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S + A        FGPGRF++ +  LRE  +    L+     G+++VG+VR+
Sbjct: 2   IQIRNETASDVVAREHLLGACFGPGRFLKTSQRLREGRLPARGLALSAVRGEKLVGTVRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q  G+G  L+  ++  A   G   ++LVGD  YY++ 
Sbjct: 62  WDVETGCGRPALLLGPLAVDPEVQGAGLGGALMRAALAEAAAVGHGAVLLVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           GF       L +P P +  R L L L  +     +G++R
Sbjct: 122 GFAPEKAAGLYMPGPFERERFLGLELAAHALAGAEGVLR 160


>gi|229113363|ref|ZP_04242821.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock1-15]
 gi|229146036|ref|ZP_04274413.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST24]
 gi|296503987|ref|YP_003665687.1| acetyltransferase [Bacillus thuringiensis BMB171]
 gi|228637376|gb|EEK93829.1| GCN5-related N-acetyltransferase [Bacillus cereus BDRD-ST24]
 gi|228670085|gb|EEL25470.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock1-15]
 gi|296325039|gb|ADH07967.1| acetyltransferase [Bacillus thuringiensis BMB171]
          Length = 174

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KGIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENSLRGVKGIVQYS 169


>gi|75761638|ref|ZP_00741588.1| Acetyltransferase [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|228901956|ref|ZP_04066122.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis IBL 4222]
 gi|228966364|ref|ZP_04127418.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|74490880|gb|EAO54146.1| Acetyltransferase [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|228793293|gb|EEM40842.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228857639|gb|EEN02133.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis IBL 4222]
          Length = 174

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLLEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKAPFEVPEEVFMAMELRENALQGVEGVVQYS 169


>gi|196035557|ref|ZP_03102961.1| acetyltransferase, GNAT family [Bacillus cereus W]
 gi|228934769|ref|ZP_04097600.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947109|ref|ZP_04109404.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229123010|ref|ZP_04252218.1| GCN5-related N-acetyltransferase [Bacillus cereus 95/8201]
 gi|195991858|gb|EDX55822.1| acetyltransferase, GNAT family [Bacillus cereus W]
 gi|228660594|gb|EEL16226.1| GCN5-related N-acetyltransferase [Bacillus cereus 95/8201]
 gi|228812588|gb|EEM58914.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824669|gb|EEM70470.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 174

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIKIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|218904619|ref|YP_002452453.1| acetyltransferase, GNAT family [Bacillus cereus AH820]
 gi|228928530|ref|ZP_04091569.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|218537074|gb|ACK89472.1| acetyltransferase, GNAT family [Bacillus cereus AH820]
 gi|228831135|gb|EEM76733.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 174

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEAIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|149181907|ref|ZP_01860395.1| hypothetical protein BSG1_08216 [Bacillus sp. SG-1]
 gi|148850346|gb|EDL64508.1| hypothetical protein BSG1_08216 [Bacillus sp. SG-1]
          Length = 192

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 79/181 (43%), Gaps = 13/181 (7%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMH--------ADSFGPGRFVRAAVLLREQGMHDLSLS 75
           R+  ++I      + E  +   A+          + +   +       +R+   +   LS
Sbjct: 8   RADQKEIEMEIKIQKELSTDYTAIEKVIVEAFLNEEYSDKKEHLLVNRIRKSEAYIPQLS 67

Query: 76  FLCAEGKR-IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE 130
            +  +G + ++G + ++ I        +    L P+ V P YQNKGIG +LI  ++  A+
Sbjct: 68  LIALKGDKDVIGHILLSKIKIINGDHAVDSLALAPVSVIPEYQNKGIGSQLIHTALKRAK 127

Query: 131 KKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             G + ++++G   YYSK GF+     ++  P  V       L L     +N++G+V+  
Sbjct: 128 DLGYRSVIVLGHKDYYSKFGFKPASLWNIQAPFEVPDEVFRALELTPGSLENVQGVVQYS 187

Query: 191 E 191
           +
Sbjct: 188 K 188


>gi|91975335|ref|YP_567994.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681791|gb|ABE38093.1| GCN5-related N-acetyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 195

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  S I A   +    FG GR  R    LR+       L+F      R+VG+VR+
Sbjct: 18  FAIRAEKSSDIVARERLLDACFGQGRHARTCQRLRDGRAPAEGLAFSAVRQGRLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +        +LGP+ V    +  G+G  L+  ++  A  +G   ++L+GD  YY++ G
Sbjct: 78  WHVDAGGRAALVLGPLAVDSSCREFGVGGALMRAALAEAAARGHGAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A    ++ LP P + NR+L L L         G++
Sbjct: 138 FSAEKMAAVALPGPFERNRLLGLELRHGALDGAAGLI 174


>gi|301054981|ref|YP_003793192.1| putative GNAT family acetyltransferase [Bacillus anthracis CI]
 gi|300377150|gb|ADK06054.1| predicted Acetyltransferase (GNAT) family [Bacillus cereus biovar
           anthracis str. CI]
          Length = 179

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIG KLI  +++ A++ G + +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYESVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPKYYPKFGFKKASEWNIKPPFEVPDEVFMVMELRENALESVEGVVQYS 169


>gi|229031145|ref|ZP_04187155.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1271]
 gi|228730184|gb|EEL81154.1| GCN5-related N-acetyltransferase [Bacillus cereus AH1271]
          Length = 174

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  + + IV
Sbjct: 2   VTIRQEQQNDYKKTEEVVQQAFLHEEFSDKTEHELVKRIRECDAFVPELSIVAVD-EEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI  +++ A + G   +V++G
Sbjct: 61  GHIMLSKITIEKGATSVESLALAPVSVARGHQKKGIGGKLIGAALEKAIELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPDEVFMVIELSENALQGVEGIVQYS 169


>gi|323136937|ref|ZP_08072017.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
 gi|322397698|gb|EFY00220.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
          Length = 197

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 2/154 (1%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPIS 94
           E      +  A+   +FGP RF++    LRE       L+ +  +    ++ ++R+ PI 
Sbjct: 29  ETQADAPAREALLDAAFGPARFLKTCERLREGRRPAPGLALMAKDDEGELIATIRLWPIF 88

Query: 95  IEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
                   LLGP+ V    ++ G+G ++I  S+  AE  G + ++LVGD  YY + GF+ 
Sbjct: 89  AGGRRPALLLGPLAVAEHARSLGLGGEMIRASLARAEALGHRAVLLVGDEPYYRRFGFER 148

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
              + L LP PV+  R L L L     +  +G V
Sbjct: 149 RFTEKLALPGPVERARFLGLELAPGALEGARGRV 182


>gi|298293890|ref|YP_003695829.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
 gi|296930401|gb|ADH91210.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
          Length = 193

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 81/159 (50%), Gaps = 6/159 (3%)

Query: 35  LERLEHDSSI---CAMHADSFG-PGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           +  LE D+ I    A+   SFG   R  + +  LRE       L+F       R++ ++R
Sbjct: 8   VISLETDADIAQREALLDLSFGRAARLAKTSERLREGRKPAEGLAFAAHGPDGRVIATLR 67

Query: 90  MTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           +  ++        LLGP+ VHP ++++G+G  ++S +++ A  +G   I+LVGD  YY++
Sbjct: 68  LWHVAAGPGRPALLLGPLAVHPWFRDRGLGGAMMSTAINEAALRGHGAIMLVGDAPYYAR 127

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            GF     + L LP   D NR L L LV    +  +G+V
Sbjct: 128 FGFDVALTEGLWLPGSFDRNRFLGLELVPGALEGARGLV 166


>gi|218233699|ref|YP_002368189.1| acetyltransferase, GNAT family [Bacillus cereus B4264]
 gi|218161656|gb|ACK61648.1| acetyltransferase, GNAT family [Bacillus cereus B4264]
          Length = 174

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFV-----RAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +       +  ++F    F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDCRKTEEVVKEAFSLEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQCGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     +   L +N    ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIKELTENALLGVEGIVQYS 169


>gi|117619839|ref|YP_855950.1| acetyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117561246|gb|ABK38194.1| acetyltransferase, GNAT family [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 173

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 69/159 (43%), Gaps = 3/159 (1%)

Query: 35  LERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
           + R E    +  ++       GR   A ++ R +      ++ +  E    +G + ++PI
Sbjct: 1   MLRTERPGDMLPVYDLVSAAFGRSDEAELVNRLRECGAAVVTMVEEEEYEFMGHLMLSPI 60

Query: 94  SIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           +I         L P+ VHP +Q +GIG  L+   +D A +   + +V++GD  YYS+ GF
Sbjct: 61  TINGMEGPWLGLAPVAVHPDWQGQGIGSDLVREGLDTALEMDWKAVVVLGDPTYYSRFGF 120

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +      L     V  +  + + L +     ++G V   
Sbjct: 121 RPASEFGLHCIYEVPADCFMAMELQEGGLTGMQGEVLYH 159


>gi|196038408|ref|ZP_03105717.1| acetyltransferase, GNAT family [Bacillus cereus NVH0597-99]
 gi|196030816|gb|EDX69414.1| acetyltransferase, GNAT family [Bacillus cereus NVH0597-99]
          Length = 174

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE          L P+ V   +Q KGIG KLI ++++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVVALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|222149794|ref|YP_002550751.1| acetyltransferase [Agrobacterium vitis S4]
 gi|221736776|gb|ACM37739.1| acetyltransferase [Agrobacterium vitis S4]
          Length = 196

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E  + +    A+   + GP R  +++  +R   +    L+ +  +    ++G+VR
Sbjct: 17  FKIDAETPADVVAREALLDRAMGPDRRTKSSEKIRRGRVPAEGLALVARDRKGHVIGTVR 76

Query: 90  MTPISIEK------ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V   ++ KG+G +L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNIEAGVNAEGQVIDALLLGPLAVDAAHEGKGVGSQLMRAALMEAKGRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A     L++P P   +R L L L+        G++   
Sbjct: 137 AYYERFGFFAAKTMHLVMPGPFARDRFLALELIHGWLDGAVGMISAS 183


>gi|90578231|ref|ZP_01234042.1| acetyltransferase [Vibrio angustum S14]
 gi|90441317|gb|EAS66497.1| acetyltransferase [Vibrio angustum S14]
          Length = 168

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 70/152 (46%), Gaps = 15/152 (9%)

Query: 34  FLERLEHDSSICAMHADSFG---------PGRF-VRAAVLLREQGMHDLSLSFLCAEGKR 83
            + R+E DS I  +   ++          PG       ++ R +  + L+LS +     +
Sbjct: 1   MIIRVEKDSDITVIETLTYSAFKDHPHHEPGSEPTEHLIVNRLRDANALTLSLVAEVNNQ 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           ++G +  +P+ I       + L P+ V P  Q KGIG+ LI+  +   ++ G++  VL+G
Sbjct: 61  VIGHIAFSPVLINGEATNWYGLAPVSVLPEQQGKGIGKALINEGLAQLKEHGAEGFVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFL 173
           +  YY + GF+A P  +L     V     L L
Sbjct: 121 EPEYYGRFGFKAQPELTLT---GVPAEYFLAL 149


>gi|219853084|ref|YP_002467516.1| GCN5-related N-acetyltransferase [Methanosphaerula palustris E1-9c]
 gi|219547343|gb|ACL17793.1| GCN5-related N-acetyltransferase [Methanosphaerula palustris E1-9c]
          Length = 176

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 67/173 (38%), Gaps = 12/173 (6%)

Query: 32  AFFLERLEHDSSI---CAMHADSF---GPGRFVRAAVL--LREQGMHDLSLSFLCAEGKR 83
                R E +        +  ++F            ++  LR+  +    LS +  +   
Sbjct: 1   MTIHIRQETEKDYLVSAQVVEEAFEHAAFSDHTEHNLVANLRKSDVFVPQLSLVAEDEGV 60

Query: 84  IVGSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T + I           L P+ V P +Q KG+G  LI  S++ A     + +++
Sbjct: 61  IVGHIMLTKLMIRDGEKQHESLALAPVSVVPGHQKKGVGSALIRKSLEIARDLNFRSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           +G   YY + GF+      +  P  V     + L LV      +KG V   +V
Sbjct: 121 LGHDTYYPRFGFKPAHTWGIKAPFDVSKEAFMALELVNGSLDQVKGTVMYPKV 173


>gi|209550965|ref|YP_002282882.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536721|gb|ACI56656.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 196

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     G  R  +++  +R   +    L+ +  +    ++GSVR
Sbjct: 17  FAIDAENPSDVVARENLLDRVMGADRRKKSSEKIRRNRVPAEGLALVARDRDGHVIGSVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V P +  KGIG  L+  ++  A+K+G   ++LVGD 
Sbjct: 77  LWNIEAGLNDEGTPIDALLLGPLAVAPHHGGKGIGSALMRAAILEAKKRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + L++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAEKARHLVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|229162329|ref|ZP_04290294.1| GCN5-related N-acetyltransferase [Bacillus cereus R309803]
 gi|228621129|gb|EEK77990.1| GCN5-related N-acetyltransferase [Bacillus cereus R309803]
          Length = 174

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE      +LS +    + IV
Sbjct: 2   VTIRQEQKNDYKKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPALSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V    Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSVARGRQKKGIGGKLIAAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPGYYPKFGFKKASEWNIKAPFEVPDEVFMAMELRENALEGVEGIVQYS 169


>gi|256838389|ref|ZP_05543899.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256739308|gb|EEU52632.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 178

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 65/171 (38%), Gaps = 12/171 (7%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRI 84
               R E ++   A+        R V             LR+   +   LSF+      I
Sbjct: 4   EIKIRPEQENDFQAVREVVELAFRDVEDSDQSEPYLVERLRKTDAYIPELSFVAELNGEI 63

Query: 85  VGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +G + M+ + I           L P+ V P YQ  G+G  LI  +   A + G +  VL+
Sbjct: 64  IGHLMMSKVEIVSEDQSVISLGLAPVSVVPKYQRIGVGSALIREAHKRAGELGYKSAVLL 123

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY + G++      +  P  V     + + L     +N+ G+++  +
Sbjct: 124 GHKDYYPRFGYKRAIDFGIEFPFDVPSEYCMVVELAPEGLKNVHGMIKYAK 174


>gi|262382797|ref|ZP_06075934.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262295675|gb|EEY83606.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 178

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 64/171 (37%), Gaps = 12/171 (7%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRI 84
               R E ++   A+        R V             LR+   +   LS +      I
Sbjct: 4   EIKIRPEQENDFQAVREVVELAFRDVEDSDQSEPYLVERLRKTDAYIPELSLVAELNGEI 63

Query: 85  VGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +G + M+ + I           L P+ V P YQ  G+G  LI  +   A + G +  VL+
Sbjct: 64  IGHLMMSKVEIVSEDQSVISLGLAPVSVVPKYQRIGVGSALIREAHKRAGELGYKSAVLL 123

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY + G++      +  P  V     + + L     +N+ G+++  +
Sbjct: 124 GHKDYYPRFGYKRAIDFGIEFPFDVPSEYCMVVELAPEGLKNVHGMIKYAK 174


>gi|228959680|ref|ZP_04121357.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228799983|gb|EEM46923.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 174

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 68/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +R        LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLKEEFSDKTEHELVKRIRGCDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T I+IE     +    L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLTKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + +KGIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENALRGVKGIVQYS 169


>gi|315303603|ref|ZP_07874147.1| acetyltransferase [Listeria ivanovii FSL F6-596]
 gi|313628023|gb|EFR96612.1| acetyltransferase [Listeria ivanovii FSL F6-596]
          Length = 172

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 67/166 (40%), Gaps = 8/166 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   +  +F           +R+   +   LS +   EG  IVG V 
Sbjct: 1   MIIRTEQPKDYRAIRHLNEQAFKGSVEADLIQKIRDSEYYQPGLSLVAEVEGGNIVGYVM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS++          L P+ V P +Q   IG +L+   +  + +K    + ++G  AY
Sbjct: 61  FSEISLQTENKSRFILGLAPLAVLPEFQGSRIGSRLMEEGIRLSREKAYPAVAVLGHAAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF+      +  P  V     + L L     +N++G ++  E
Sbjct: 121 YPRFGFRTSETFGIPAPFDVPAEYYMLLELYDGSLENLQGTIQYPE 166


>gi|298374256|ref|ZP_06984214.1| acetyltransferase, GNAT family [Bacteroides sp. 3_1_19]
 gi|298268624|gb|EFI10279.1| acetyltransferase, GNAT family [Bacteroides sp. 3_1_19]
          Length = 178

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 64/171 (37%), Gaps = 12/171 (7%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRI 84
               R E ++   A+        R V             LR+   +   LS +      I
Sbjct: 4   EIKIRPEQENDFQAVREVVELAFRNVEDSDQSEPYLVERLRKTDAYIPELSLVAELNGEI 63

Query: 85  VGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +G + M+ + I           L P+ V P YQ  G+G  LI  +   A + G +  VL+
Sbjct: 64  IGHLMMSKVEIVSEDQSVISLGLAPVSVVPKYQRIGVGSALIREAHKRAGELGYKSAVLL 123

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY + G++      +  P  V     + + L     +N+ G+++  +
Sbjct: 124 GHKDYYPRFGYKRAIDFGIEFPFDVPSEYCMVVELAPEGLKNVHGMIKYAK 174


>gi|293609347|ref|ZP_06691649.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827799|gb|EFF86162.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 168

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              + R E    I A+   +    +           ++   +    L++S +  E + I+
Sbjct: 1   MNIIIRDEQAEDIEAIEELTKAAFQNAEHTSHTEHFIVNSLRAHGQLTISLVAIEDESII 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S  +I  + LGPI VHP  Q  G+G  LI+ S++  ++ G+Q  VL+GD 
Sbjct: 61  GHIAISPVEISSGEIGWYGLGPISVHPNKQGCGVGSLLINKSLEKLKQLGAQGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+  P   LILP  V       L    N+ +     V+  E
Sbjct: 121 NYYSRFGFKNYPE--LILP-DVPSEYFQALTFSGNIPKA---NVKYHE 162


>gi|251809755|ref|ZP_04824228.1| possible acetyltransferase [Staphylococcus epidermidis BCM-HMP0060]
 gi|251806728|gb|EES59385.1| possible acetyltransferase [Staphylococcus epidermidis BCM-HMP0060]
          Length = 176

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 32  AFFLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
             F+ R E              A   + +   R  R    LR        LS +     +
Sbjct: 1   MNFIIRKEKKEDYKITEEVVKEAFANEEYSDQREHRLVASLRNSDEFIPDLSLVALHKDK 60

Query: 84  IVGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + ++ I I    + I    L PI V P YQNKG+G+ LI  S++ AE+     +++
Sbjct: 61  IIGHILLSKIFIVKGEKSIESLALAPISVLPNYQNKGVGQSLIQRSLEIAEELNFDSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K GF+      +  P  V    ++ + L +N      GI++  +
Sbjct: 121 MGHSEYYPKFGFEKASNWCIQAPFEVPDEFLMAIELKKNALDKTSGIIQYSD 172


>gi|114705386|ref|ZP_01438294.1| hypothetical protein FP2506_10616 [Fulvimarina pelagi HTCC2506]
 gi|114540171|gb|EAU43291.1| hypothetical protein FP2506_10616 [Fulvimarina pelagi HTCC2506]
          Length = 226

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 76/161 (47%), Gaps = 6/161 (3%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTP 92
             E   H  +   +   + GPGR  +++  +R        L+F        ++G++R+  
Sbjct: 38  VSETPAHVPARETLLDRAMGPGRTRKSSEAIRRNRRPAEGLAFSATAPDGALLGTLRLWH 97

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           I+  +         LLGP+ V P  Q  G+G  L+  +V  A+  G   IVLVGD  YY+
Sbjct: 98  IAAGQCDGEAVSALLLGPLAVEPTAQGLGVGGALVRHAVATAKVAGHGAIVLVGDPEYYA 157

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + GF A     L +P P +P R+L L L+ N  +   G++R
Sbjct: 158 RFGFSAAQTTGLAMPGPFEPRRLLALELIANTLRGAAGLIR 198


>gi|218898537|ref|YP_002446948.1| acetyltransferase, GNAT family [Bacillus cereus G9842]
 gi|218544769|gb|ACK97163.1| acetyltransferase, GNAT family [Bacillus cereus G9842]
          Length = 174

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLLEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  Q ++G+V+  
Sbjct: 121 PPEYYPKFGFKKASEWNVKAPFEVPEEVFMAMELRENALQGVEGVVQYS 169


>gi|229179758|ref|ZP_04307106.1| GCN5-related N-acetyltransferase [Bacillus cereus 172560W]
 gi|228603679|gb|EEK61152.1| GCN5-related N-acetyltransferase [Bacillus cereus 172560W]
          Length = 174

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F           +RE       LS +    + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEVFSLEEFSDKTEHELVKRIRECDAFVPELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIAIEQDGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKAPFEVPEEVFMIMELTENALRGVEGIVQYS 169


>gi|152975926|ref|YP_001375443.1| GCN5-related N-acetyltransferase [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152024678|gb|ABS22448.1| GCN5-related N-acetyltransferase [Bacillus cytotoxicus NVH 391-98]
          Length = 175

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E +                  F   R       +R+       LS +  + + I+
Sbjct: 3   IIVRQEREEEYKKTEEVVQQAFLHEEFSDKREHELVSRIRKCDAFIPELSLVAVD-QEII 61

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I I      I    L P+ V P YQ KGIG  LIS  +  A++ G   ++++G
Sbjct: 62  GHILLSKIQIVDGDKCIDSLALAPVSVAPGYQKKGIGSLLISNVLRKAKELGYHSVIVLG 121

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
              YY+K GF+      +  P  V     + + L ++  QN++G+V+  E
Sbjct: 122 HKEYYTKFGFKPTHLWDIRAPFDVPGEVFMAMELTEHALQNVQGVVQYSE 171


>gi|299769609|ref|YP_003731635.1| acetyltransferase, gnat family protein [Acinetobacter sp. DR1]
 gi|298699697|gb|ADI90262.1| acetyltransferase, gnat family protein [Acinetobacter sp. DR1]
          Length = 168

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADS---FGPGRFV---RAAVLLREQGMHDLSLSFLCAEGKRIV 85
              + R E    I A+   +   F            ++   +    L++S +  E   I+
Sbjct: 1   MNIIIRDEQVEDIEAIENLTKVAFQNAEHTSHTEHFIVNSLRNYGQLTISLVAVEDGSII 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +I  + LGPI VHP  Q  GIG  L++ S++  +  G++  VL+ D 
Sbjct: 61  GHVAISPVQISSGEIGWYGLGPISVHPDKQGLGIGSLLMNKSLEKLKNLGAKGCVLLDDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+  P   LILP  V       L    +     KG V   E
Sbjct: 121 NYYSRFGFKNNP--KLILP-DVPSEYFQALSFSGHF---AKGYVSYHE 162


>gi|15966627|ref|NP_386980.1| hypothetical protein SMc02982 [Sinorhizobium meliloti 1021]
 gi|307300338|ref|ZP_07580118.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
 gi|307319621|ref|ZP_07599047.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|15075899|emb|CAC47453.1| Acetyltransferase family protein [Sinorhizobium meliloti 1021]
 gi|306894743|gb|EFN25503.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|306904504|gb|EFN35088.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
          Length = 196

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 80/164 (48%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F+   E+   + A   +   + G GR  +++  LR   +    L+ +  +    ++G+VR
Sbjct: 17  FVIDSENPGDVVARENLLDRAMGAGRRRKSSEKLRRGRVPAEGLALVARDADGHVIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          +   LLGP+ V P ++ KGIG  L+  +V  A+ +G   ++LVGD 
Sbjct: 77  LWNVEAGVNREGQPVPALLLGPLAVDPAHEGKGIGGMLMRAAVQEAKNRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           AYY + GF +   + L++P P + NR L L L +       G++
Sbjct: 137 AYYERFGFFSQRAQHLVMPGPFERNRFLALELKEGWLDGAAGML 180


>gi|27382871|ref|NP_774400.1| hypothetical protein blr7760 [Bradyrhizobium japonicum USDA 110]
 gi|27356044|dbj|BAC53025.1| blr7760 [Bradyrhizobium japonicum USDA 110]
          Length = 195

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E  + +    A+   SFG  R  R    LR+       L+        +VG+VR+
Sbjct: 18  FAIRAERAADVAAREALLDASFGENRHGRTCQRLRDGRAPASGLALSAVREGTLVGTVRL 77

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +S       +LGP+ V P  +  GIG  L+  ++ AA  +G   ++L+GD  YY++ G
Sbjct: 78  WHVSAGGRPALVLGPLAVDPACRELGIGAALMQQALAAARARGHAAVILLGDAPYYARFG 137

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F A    +L+LP P + +R+L +          +G++
Sbjct: 138 FSAERTGALMLPGPFERDRLLAIEFQAGALDGAEGMI 174


>gi|182625043|ref|ZP_02952821.1| acetyltransferase, GNAT family [Clostridium perfringens D str.
           JGS1721]
 gi|177909840|gb|EDT72258.1| acetyltransferase, GNAT family [Clostridium perfringens D str.
           JGS1721]
          Length = 180

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEQDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIKAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|241206374|ref|YP_002977470.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860264|gb|ACS57931.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 196

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     GP R  +++  +R   +    L+ +  +    ++G+VR
Sbjct: 17  FAIDAENPSDVVARENLLDRVMGPDRRKKSSEKIRRSRVPAEGLALVARDRDGHVIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ + P +  KGIG  L+  ++  A+K+    ++LVGD 
Sbjct: 77  LWNIEAGVNDEGTPINALLLGPLAIAPHHGGKGIGSALMRAAILEAKKRRHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           AYY + GF A   + L++P P + +R L L L +       G++
Sbjct: 137 AYYERFGFFAEKARHLVMPGPFERSRFLALELTEGWLDGAAGMI 180


>gi|18309861|ref|NP_561795.1| GNAT family acetyltransferase [Clostridium perfringens str. 13]
 gi|169346949|ref|ZP_02865897.1| acetyltransferase, GNAT family [Clostridium perfringens C str.
           JGS1495]
 gi|18144539|dbj|BAB80585.1| probable acetyltransferase [Clostridium perfringens str. 13]
 gi|169297008|gb|EDS79132.1| acetyltransferase, GNAT family [Clostridium perfringens C str.
           JGS1495]
          Length = 180

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEQDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIKAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|301307773|ref|ZP_07213729.1| acetyltransferase, GNAT family [Bacteroides sp. 20_3]
 gi|300834116|gb|EFK64730.1| acetyltransferase, GNAT family [Bacteroides sp. 20_3]
          Length = 178

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 64/171 (37%), Gaps = 12/171 (7%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRI 84
               R E ++   A+        R V             LR+   +   LS +      I
Sbjct: 4   EIKIRQEQENDFQAVREVVELAFRDVEDSDQSEPYLVERLRKTDAYIPELSLVAELNGEI 63

Query: 85  VGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +G + M+ + I           L P+ V P YQ  G+G  LI  +   A + G +  VL+
Sbjct: 64  IGHLMMSKVEIVSEDQSVISLGLAPVSVVPKYQRIGVGSALIREAHKRAGELGYKSAVLL 123

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY + G++      +  P  V     + + L     +N+ G+++  +
Sbjct: 124 GHKDYYPRFGYKRAIDFGIEFPFDVPSEYCMVVELAPEGLKNVHGMIKYAK 174


>gi|15965408|ref|NP_385761.1| hypothetical protein SMc00230 [Sinorhizobium meliloti 1021]
 gi|307308799|ref|ZP_07588495.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
 gi|307317272|ref|ZP_07596713.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|15074589|emb|CAC46234.1| Putative acetyltransferase [Sinorhizobium meliloti 1021]
 gi|306897360|gb|EFN28105.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti AK83]
 gi|306900805|gb|EFN31416.1| GCN5-related N-acetyltransferase [Sinorhizobium meliloti BL225C]
          Length = 165

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 70/165 (42%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E      A+   +              A ++ R +    ++LS +  E   ++G 
Sbjct: 1   MIIRPETAGDAEAIRQITEAAFAGQPYSDQTEARIIDRLRSEDAMTLSLVAEEEGEVIGH 60

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P++I    +  + LGP+ V P +Q +G G  L+   +D   K G+   VL G+ A+
Sbjct: 61  IAFSPVTITPFAVGWYGLGPVSVRPDWQGRGTGSALVRRGLDMLRKAGASGCVLAGNPAF 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF+  P   L+ P    P   + LPL   +   + G V   
Sbjct: 121 YERFGFRNEPA--LVFPG-CAPQYFMALPLSGGL---VSGTVTYH 159


>gi|168207640|ref|ZP_02633645.1| acetyltransferase, GNAT family [Clostridium perfringens E str.
           JGS1987]
 gi|170661042|gb|EDT13725.1| acetyltransferase, GNAT family [Clostridium perfringens E str.
           JGS1987]
          Length = 180

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEQDHKTVEFLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIKAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|228922192|ref|ZP_04085500.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837436|gb|EEM82769.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 157

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 7/139 (5%)

Query: 58  VRAAV--LLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE----KITGHLLGPIVVHPL 111
              A+   +RE       LS +    + IVG + ++ I+IE     +    L P+ V   
Sbjct: 15  TEHALVKRIRECDAFIPELSIVAV-DEEIVGHIMLSKITIEQDGTSVESLALAPVSVDRG 73

Query: 112 YQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVL 171
           +Q KGIG KLI  +++ A++ G   +V++G   YY K GF+     ++  P  V     +
Sbjct: 74  HQKKGIGGKLIVAALEKAKELGYGSVVVLGHPGYYPKFGFKKASEWNIKAPFEVPDEVFM 133

Query: 172 FLPLVQNVAQNIKGIVRCR 190
            + L +N  Q ++G+V+  
Sbjct: 134 VIELSENALQGVEGVVQYS 152


>gi|222096951|ref|YP_002531008.1| acetyltransferase, gnat family [Bacillus cereus Q1]
 gi|221241009|gb|ACM13719.1| acetyltransferase, GNAT family [Bacillus cereus Q1]
          Length = 174

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F   +       +RE       LS +  + + IV
Sbjct: 2   VTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFIPELSIVAVD-EEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ +   YQ KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGASVDSLALAPVSIARSYQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVSEEVFMVMELTENALESVEGVVQYS 169


>gi|228940549|ref|ZP_04103115.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228973466|ref|ZP_04134051.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980028|ref|ZP_04140345.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis Bt407]
 gi|228779695|gb|EEM27945.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis Bt407]
 gi|228786246|gb|EEM34240.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228819055|gb|EEM65114.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326941185|gb|AEA17081.1| acetyltransferase [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 174

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVIKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG  LI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGNLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENSLRGVEGIVQYS 169


>gi|110799259|ref|YP_695322.1| acetyltransferase [Clostridium perfringens ATCC 13124]
 gi|168209149|ref|ZP_02634774.1| acetyltransferase, GNAT family [Clostridium perfringens B str. ATCC
           3626]
 gi|110673906|gb|ABG82893.1| acetyltransferase, GNAT family [Clostridium perfringens ATCC 13124]
 gi|170712623|gb|EDT24805.1| acetyltransferase, GNAT family [Clostridium perfringens B str. ATCC
           3626]
          Length = 180

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEEDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIKAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|49474544|ref|YP_032586.1| acetyltransferase [Bartonella quintana str. Toulouse]
 gi|49240048|emb|CAF26472.1| Acetyltransferase [Bartonella quintana str. Toulouse]
          Length = 192

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 9/169 (5%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVG 86
           G  F+  LE ++       +   + G GR  +++ +LR   +    LSF+       +VG
Sbjct: 9   GTLFMLALEQEADKPYREHLLDVTLGKGRKRKSSEVLRRGRLAAYGLSFVVKNVLGELVG 68

Query: 87  SVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           SVR+  +   K         LLGP+ V   Y   GIG  L+  +++ A+K G   I LVG
Sbjct: 69  SVRLWHVRFNKGRDEIQHALLLGPLAVSVEYSGMGIGSVLMRHAIETAKKLGYGAIFLVG 128

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           D A+Y + GF +   K+L +P P + +R   L L+     +  G++   
Sbjct: 129 DCAFYQRFGFSSSLTKNLAMPGPYEKHRFQALELIPQHLTSCHGVLTPS 177


>gi|30263445|ref|NP_845822.1| acetyltransferase [Bacillus anthracis str. Ames]
 gi|47528832|ref|YP_020181.1| acetyltransferase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186293|ref|YP_029545.1| acetyltransferase [Bacillus anthracis str. Sterne]
 gi|165872353|ref|ZP_02216989.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0488]
 gi|167632710|ref|ZP_02391037.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0442]
 gi|167637361|ref|ZP_02395641.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0193]
 gi|170689059|ref|ZP_02880258.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0465]
 gi|170708545|ref|ZP_02898986.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0389]
 gi|177654652|ref|ZP_02936476.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0174]
 gi|190564785|ref|ZP_03017706.1| acetyltransferase, GNAT family [Bacillus anthracis Tsiankovskii-I]
 gi|227813680|ref|YP_002813689.1| acetyltransferase, GNAT family [Bacillus anthracis str. CDC 684]
 gi|229602940|ref|YP_002867692.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0248]
 gi|254686061|ref|ZP_05149920.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723460|ref|ZP_05185248.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           A1055]
 gi|254738532|ref|ZP_05196235.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254740718|ref|ZP_05198409.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           Kruger B]
 gi|254752849|ref|ZP_05204885.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           Vollum]
 gi|254759121|ref|ZP_05211147.1| acetyltransferase, GNAT family protein [Bacillus anthracis str.
           Australia 94]
 gi|30258080|gb|AAP27308.1| acetyltransferase, GNAT family [Bacillus anthracis str. Ames]
 gi|47503980|gb|AAT32656.1| acetyltransferase, GNAT family [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180220|gb|AAT55596.1| acetyltransferase, GNAT family [Bacillus anthracis str. Sterne]
 gi|164711906|gb|EDR17447.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0488]
 gi|167514868|gb|EDR90234.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0193]
 gi|167533008|gb|EDR95644.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0442]
 gi|170126547|gb|EDS95433.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0389]
 gi|170666926|gb|EDT17690.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0465]
 gi|172080617|gb|EDT65701.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0174]
 gi|190564102|gb|EDV18066.1| acetyltransferase, GNAT family [Bacillus anthracis Tsiankovskii-I]
 gi|227003107|gb|ACP12850.1| acetyltransferase, GNAT family [Bacillus anthracis str. CDC 684]
 gi|229267348|gb|ACQ48985.1| acetyltransferase, GNAT family [Bacillus anthracis str. A0248]
          Length = 174

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +  + + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAVD-EAIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIKIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKAIEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYS 169


>gi|90418747|ref|ZP_01226658.1| possible acetyltransferase (GNAT family) [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336827|gb|EAS50532.1| possible acetyltransferase (GNAT family) [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 205

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 76/170 (44%), Gaps = 9/170 (5%)

Query: 27  WQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GK 82
           ++     F    E    I    A+   + GPGR  +++  +R+  +    L+F       
Sbjct: 14  FENAARLFAIGAEQPHQIDAREALLDRAMGPGRTRKSSEAIRQGRLPAEGLAFSATAGDG 73

Query: 83  RIVGSVRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            ++G+VR+  I             LLGP+ V P     GIG  L+  ++  A + G   I
Sbjct: 74  SLMGTVRLWNIEAGARDGSPVPALLLGPLAVDPQLAGTGIGAALMRHAIAEAARLGHDAI 133

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           VLVGD  YY++ GF A    +L +P P +  R+L L L  +  +   GI+
Sbjct: 134 VLVGDPEYYARFGFCADATAALAMPGPFESRRLLALELAPDHLRGASGII 183


>gi|298292468|ref|YP_003694407.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
 gi|296928979|gb|ADH89788.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
          Length = 178

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 66/163 (40%), Positives = 94/163 (57%), Gaps = 7/163 (4%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
               E  + D++I  + A +FGPGRF R A  LRE   H   LSF    G  +VGSVR+T
Sbjct: 7   TLLPENPDDDAAIERLVARTFGPGRFARTAYRLRENNPHRRDLSFTAYIGTMLVGSVRLT 66

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLI-----SMSVDAAEKKGSQVIVLVGDIAYY 146
           PI + ++ G LLGP+ V P +++ GIGR+L+     +   DA     +++++LVGD  YY
Sbjct: 67  PILVGEVPGLLLGPLTVEPPFRSHGIGRRLVDRALDAARADAGRAGAARLVLLVGDEPYY 126

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN-VAQNIKGIVR 188
            ++GFQ VP   + LP PVDP RVL   L+       ++G VR
Sbjct: 127 GRMGFQRVPGGHVSLPGPVDPQRVLAF-LMDGLALDEVRGAVR 168


>gi|327189542|gb|EGE56695.1| putative acetyltransferase protein [Rhizobium etli CNPAF512]
          Length = 196

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     GP R  +++  +R   +    L+ +  +    ++GSVR
Sbjct: 17  FAIDAENPSDVVARENLLDRVMGPDRRKKSSEKIRRNRVPAEGLALVARDRDGHVIGSVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V   +  KGIG  L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNIEAGVNDEGTPINALLLGPLAVDSRHGGKGIGAALMRAAILEAKNRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + L++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAEKARHLVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|251779112|ref|ZP_04822032.1| acetyltransferase, GNAT family [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|243083427|gb|EES49317.1| acetyltransferase, GNAT family [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 176

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAV--------LLREQGMHDLSLSFLCAEGKR 83
                R E       ++       +    +          LR    +   LS L    ++
Sbjct: 1   MNLKIRNESKKDYKTIYLLVKDAFKTAEHSDGNEHNLIDRLRTSESYIPELSLLAEIDEK 60

Query: 84  IVGSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG +  T + IE   G      L P+ VHP YQ+ GIG KLI   ++ A+  G +  ++
Sbjct: 61  IVGYIMFTKLFIENQNGKFQSLALAPLAVHPQYQDIGIGSKLIIEGLNIAKNLGFKSTIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +G   YY K GF+      +  P  V     + + L +N  ++I G V
Sbjct: 121 LGSEKYYPKFGFKEALDFGIKAPFEVPSENFMAIELQENALKDINGNV 168


>gi|190574886|ref|YP_001972731.1| putative acetyltransferase [Stenotrophomonas maltophilia K279a]
 gi|190012808|emb|CAQ46437.1| putative acetyltransferase [Stenotrophomonas maltophilia K279a]
          Length = 168

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 76/167 (45%), Gaps = 14/167 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIV 85
             +  R E       +HA +    R           ++   +   +LS+S +     +++
Sbjct: 1   MNYTIRAEAIDDHATLHALTEAAFRNAAHSSRTEQFIVDALRARGELSVSLVAEMDGKVI 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P++          LGPI V P +Q +GIG  L+  +++A  ++G+   VL+G+ 
Sbjct: 61  GHVAVSPVTISDGSTGWFGLGPISVLPAWQGQGIGAALMHAALEALRQQGAHGCVLLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A P   L+LP  V P     L L   +AQ   G V+  
Sbjct: 121 AYYGRFGFCAEP--GLVLPG-VPPEYFQALCLQPPLAQ---GEVQYS 161


>gi|154493610|ref|ZP_02032930.1| hypothetical protein PARMER_02950 [Parabacteroides merdae ATCC
           43184]
 gi|154086820|gb|EDN85865.1| hypothetical protein PARMER_02950 [Parabacteroides merdae ATCC
           43184]
          Length = 176

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 69/172 (40%), Gaps = 12/172 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQ--GMHDLSLSFLCAEGKR 83
             F  R E      A+H       R           ++ + +        LS +    + 
Sbjct: 1   MDFNIRQEQIKDYEAVHKVVELAFRDMEDSDHSEPFLVDQLRQTDAFIPELSLVDEVDEE 60

Query: 84  IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + MT +      + +T   L P+ V P YQN+GIG  LI  +   A + G   +VL
Sbjct: 61  IIGHILMTKVEIVSENKSVTSLGLAPVSVLPEYQNRGIGSALIREAHKRATELGYGSVVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY + G++      +  P  V     + + L     ++++G+++  +
Sbjct: 121 LGHKDYYPRFGYKQAIDFGIEFPFDVPHEYCMAIELRPKSLKDVQGMIQYAK 172


>gi|228953748|ref|ZP_04115788.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228805982|gb|EEM52561.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 174

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFISELSIVAV-DEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIAIEQDGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKQLGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKAPFEVPEEVFMIMELTENSLRGVEGIVQYS 169


>gi|303326283|ref|ZP_07356726.1| acetyltransferase, GNAT family [Desulfovibrio sp. 3_1_syn3]
 gi|302864199|gb|EFL87130.1| acetyltransferase, GNAT family [Desulfovibrio sp. 3_1_syn3]
          Length = 175

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 62/167 (37%), Gaps = 9/167 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKR 83
                R E       +H            A          LR    +   LS +  E  R
Sbjct: 1   MTIAIRPECPEDFPIIHDLVRTAFENAEHASGDEHFLVDRLRRSREYIPELSLVAEEDGR 60

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           IVG +  T + + + T   L P+ V P +Q +G G  LI    + A   G + ++LVG  
Sbjct: 61  IVGHIMFTRLKVGETTALALAPLAVQPSHQGRGTGGALIRRGHEIARSLGWEFVILVGHA 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            YY + G++      ++ P  V     + + L     + + G+++  
Sbjct: 121 GYYPRFGYKPAASFGIVSPFEVPEEAFMAINLRGGT-ERLPGLLKYS 166


>gi|168212482|ref|ZP_02638107.1| acetyltransferase, GNAT family [Clostridium perfringens CPE str.
           F4969]
 gi|170715991|gb|EDT28173.1| acetyltransferase, GNAT family [Clostridium perfringens CPE str.
           F4969]
          Length = 179

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEEDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIKAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|168216251|ref|ZP_02641876.1| acetyltransferase, GNAT family [Clostridium perfringens NCTC 8239]
 gi|182381606|gb|EDT79085.1| acetyltransferase, GNAT family [Clostridium perfringens NCTC 8239]
          Length = 180

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMH---ADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +     ++F    +       ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEQDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFGIRAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|218514642|ref|ZP_03511482.1| putative acetyltransferase protein [Rhizobium etli 8C-3]
          Length = 196

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     GP R  +++  +R   +    L+ +  +    ++GSVR
Sbjct: 17  FAIDAENPSDVVARENLLDRVMGPDRRKKSSEKIRRNRVPAEGLALVARDRDGHVIGSVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V   +  KGIG  L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNIEAGVNDEGTPINALLLGPLAVDSRHGGKGIGAALMRAAILEAKNRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + +++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAEKARHVVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|328544616|ref|YP_004304725.1| acetyltransferase, GNAT family [polymorphum gilvum SL003B-26A1]
 gi|326414358|gb|ADZ71421.1| Acetyltransferase, GNAT family [Polymorphum gilvum SL003B-26A1]
          Length = 185

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 2/154 (1%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI-SIE 96
            EH  +  A+   +FG  R  + +  LRE  +  L+ S +     R+V +VR+  + + +
Sbjct: 9   PEHFGAREALLDRAFGRARHAKTSERLREGRLPALAFSAV-DGEGRLVATVRLWNVATGD 67

Query: 97  KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                LLGP+ V    ++ G+G +L+  +++ A   G   ++LVGD  YY + GF A P 
Sbjct: 68  GREILLLGPLAVEAACRSDGLGGRLMRHALNRASLAGYGAVILVGDAPYYERFGFSAGPT 127

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            +L LP PV+ +R L L L  +      G++R  
Sbjct: 128 GALDLPGPVERSRFLGLELRPDALAGACGLIRPS 161


>gi|119357399|ref|YP_912043.1| GCN5-related N-acetyltransferase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354748|gb|ABL65619.1| GCN5-related N-acetyltransferase [Chlorobium phaeobacteroides DSM
           266]
          Length = 166

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E+ S I A+   +    +           ++   +    L++S +     RIVG 
Sbjct: 1   MIIRKENASDIDAISEVTMAAFKTLPISNHTEQFIIHALRAAGALTISLVAEIDGRIVGH 60

Query: 88  VRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+  S      + LGPI V P YQ +GIG+ L+   + A ++ G+Q   LVGD  Y
Sbjct: 61  IAFSPVAISDGTKNWYGLGPISVLPAYQKQGIGKALLQEGLSAIKRIGAQGCYLVGDPNY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
           Y + GF + P    ++   V     L LP  +N  Q I
Sbjct: 121 YKRFGFLSYPA---LIHEGVPEEVSLALPFTENTPQGI 155


>gi|239635908|ref|ZP_04676931.1| acetyltransferase, gnat family [Staphylococcus warneri L37603]
 gi|239598532|gb|EEQ81006.1| acetyltransferase, gnat family [Staphylococcus warneri L37603]
          Length = 176

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 32  AFFLERLEHDSSI--------CAMHADSFGPGRFVRAAVL--LREQGMHDLSLSFLCAEG 81
             F+ R E              A   +S+         ++  LR+       LS +    
Sbjct: 1   MKFIIRQEQKEDYLQTEEVVKKAFENESYS--DQSEHTLVAKLRKSEAFVPDLSLVAVNE 58

Query: 82  KRIVGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            +I+G + ++ I I+          L PI V P YQNKG+G+KLI  ++  AE    + +
Sbjct: 59  DKIIGHILLSKILIDTEDKKVESLALAPISVLPEYQNKGVGQKLIQQALTIAEILDFESV 118

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +++G  AYY K GF+      +  P  V    ++ + L  +   +  GI++ 
Sbjct: 119 IVMGHEAYYPKFGFKKASHWGIQAPFEVPDELLMAIELKDSALNHASGIIQY 170


>gi|227823449|ref|YP_002827422.1| putative acetyltransferase protein [Sinorhizobium fredii NGR234]
 gi|227342451|gb|ACP26669.1| putative acetyltransferase protein [Sinorhizobium fredii NGR234]
          Length = 196

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 80/164 (48%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F+   E+   + A   +   + G GR  +++  LR   +    L+ +  +     +G+VR
Sbjct: 17  FVIDAENPGDVVARENLLDRAMGSGRRKKSSEKLRRGRVPAEGLALVARDVDGHAIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          +   LLGP+ V P ++ KGIG  L+  +++ A  +G   I+LVGD 
Sbjct: 77  LWDIEAGVTREGQAVPALLLGPLAVDPAHEGKGIGGMLMRAAIEEAANRGHGAILLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           AYY + GF A   + L++P P + NR L L L +   +   G++
Sbjct: 137 AYYERFGFFAARTQHLVMPGPFERNRFLALELKEGWLEGAAGML 180


>gi|262279455|ref|ZP_06057240.1| acetyltransferase [Acinetobacter calcoaceticus RUH2202]
 gi|262259806|gb|EEY78539.1| acetyltransferase [Acinetobacter calcoaceticus RUH2202]
          Length = 168

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  + A+   +    +           ++   +    L++S +  E   ++
Sbjct: 1   MNITIRDEQNEDVEAIEKLTKAAFQNTEHTSHTEHFIVNSLRNHRQLTISLVAIEDSSVI 60

Query: 86  GSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+ +   +I  + LGPI VHP  Q  GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQMSSGEIGWYGLGPISVHPNKQGLGIGSLLMNKSLEKLKKLGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   LILP  V       L    N+    KG V   E
Sbjct: 121 NYYSRFGFKAYPE--LILP-DVPSEYFQALSFSGNIP---KGNVHYHE 162


>gi|218679789|ref|ZP_03527686.1| GCN5-related N-acetyltransferase [Rhizobium etli CIAT 894]
          Length = 172

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 71/150 (47%), Positives = 103/150 (68%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           ++    +  E   HD++I  ++ ++FGPGRF RAA  +REQG HDLSLSF+C +    + 
Sbjct: 23  YKHDLVYLTEDASHDAAIEHINEEAFGPGRFARAAARIREQGPHDLSLSFICTDNGETIA 82

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           SVRMTP+      GHLLGP+ V P ++N+GIGR+L+ ++V+AA +KGS+ ++LVGD  YY
Sbjct: 83  SVRMTPVLAGTAKGHLLGPLAVRPSHKNQGIGRELVRIAVEAARRKGSEAVILVGDPPYY 142

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
             LGF+ V + +L  P PVDP RVL +P+ 
Sbjct: 143 GPLGFEKVAYNALSFPGPVDPGRVLVVPIA 172


>gi|145298391|ref|YP_001141232.1| acetyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851163|gb|ABO89484.1| acetyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 169

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 3/159 (1%)

Query: 35  LERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
           + R E    +  ++       GR   A ++ R +      ++ +  E    +G + ++PI
Sbjct: 1   MLRTERPGDMLPVYELVSAAFGRSDEAELVNRLRECGAAVVTMVEEEEYEFMGHLMLSPI 60

Query: 94  SIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           +I         L P+ VHP +Q +GIG  L+   +D A +   + +V++GD  YY + GF
Sbjct: 61  TINGMEGPWLGLAPVAVHPDWQGQGIGSDLVREGLDTALEMDWKAVVVLGDPTYYGRFGF 120

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +      L     V  +  L + L +     + G V   
Sbjct: 121 RPASEFGLHCIYEVPADCFLAMELQEGGLAGMAGEVLYH 159


>gi|190893471|ref|YP_001980013.1| acetyltransferase [Rhizobium etli CIAT 652]
 gi|190698750|gb|ACE92835.1| putative acetyltransferase protein [Rhizobium etli CIAT 652]
          Length = 196

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     GP R  +++  +R   +    L+ +  +    ++GSVR
Sbjct: 17  FTIDAENPSDVVARENLLDRVMGPDRRKKSSEKIRRNRVPAEGLALVARDRDGHVIGSVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  I          I   LLGP+ V   +  +GIG  L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNIEAGVNDEGTPINALLLGPLAVDSRHGGRGIGAALMRAAILEAKNRGHGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + L++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAERARHLVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|242243148|ref|ZP_04797593.1| possible acetyltransferase [Staphylococcus epidermidis W23144]
 gi|242233400|gb|EES35712.1| possible acetyltransferase [Staphylococcus epidermidis W23144]
          Length = 177

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 74/170 (43%), Gaps = 12/170 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
                R E          +  ++F    +       ++  LR+       LS +  +  +
Sbjct: 1   MNLKIRKEKREDYSFTERLIKEAFAHETYSDHNEHKLVAKLRQSDTFVPDLSLIALDKNK 60

Query: 84  IVGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + ++ ISI           L P+ V   YQNKG+GR+LI  +++ A+    + +++
Sbjct: 61  IIGQILLSKISIVSGKNSTGSLALAPVSVLSAYQNKGVGRQLIQKALETAKNLNFESVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +G   YY K GF+     ++  P  V  + ++ + L ++   N+ G++  
Sbjct: 121 LGHSDYYPKFGFKKASNWNIEAPFDVPKDTLMAMELKEHALDNVSGVIHY 170


>gi|86359218|ref|YP_471110.1| putative acetyltransferase protein [Rhizobium etli CFN 42]
 gi|86283320|gb|ABC92383.1| putative acetyltransferase protein [Rhizobium etli CFN 42]
          Length = 196

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+ S + A   +     G  R  +++  +R   +    L+ +  +    ++G+VR
Sbjct: 17  FTIDAENPSDVVARENLLDRVMGTDRRKKSSEKIRRNRIPAEGLALVARDRDGHLIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          I   LLGP+ V   +  KG+G  L+  ++  A+ +G   ++LVGD 
Sbjct: 77  LWNVEAGVNAEGTPINALLLGPLAVDCRHGGKGVGSALMRAAILEAKNRGYGAVLLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYY + GF A   + L++P P + +R L L L +       G++   
Sbjct: 137 AYYERFGFFAKKARHLVMPGPFERSRFLALELTEGWLDGAAGMIVPS 183


>gi|37521541|ref|NP_924918.1| hypothetical protein gll1972 [Gloeobacter violaceus PCC 7421]
 gi|35212539|dbj|BAC89913.1| gll1972 [Gloeobacter violaceus PCC 7421]
          Length = 169

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 69/163 (42%), Gaps = 7/163 (4%)

Query: 34  FLERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
              R E    + A+   +    GR   A ++ + +G+   + SF+  E ++IVG +  +P
Sbjct: 1   MEVRAEKPEDVEAVRRLNVAAFGRESEANLVDQLRGV-ASTFSFVAVESEQIVGHIFFSP 59

Query: 93  ISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I            L P+ V P YQ KGIG  LI   +    + G + +V++G  AYY 
Sbjct: 60  VAIAGECAANLLVLGLAPVAVLPDYQRKGIGSLLIQHGLAECARFGFKAVVVLGSPAYYL 119

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +  F     K L     V     + L L     +   GI++  
Sbjct: 120 RFEFTPAKEKGLGCEYAVPDETFMVLELESGALEGCVGIIKYH 162


>gi|217977340|ref|YP_002361487.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2]
 gi|217502716|gb|ACK50125.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2]
          Length = 194

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 81/157 (51%), Gaps = 3/157 (1%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
                E    + A   +   +FG  RF +A   LRE  +    L+    +G R++G+VR+
Sbjct: 24  IHIAEEIPGDVFARENLLDAAFGETRFEKACERLREGRLPARGLALSMKDGSRLIGTVRL 83

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +    +   +LGP+ +   Y+++G+GR++++ ++  A+ +G + ++LVGD  YY   G
Sbjct: 84  WHVDAGGVDALMLGPLAIDAAYRSRGLGRRMMAEALWRAQGRGCRAVLLVGDAPYYEAFG 143

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F       L +P PVD  R L L L +   ++ +G+V
Sbjct: 144 FSRRLTLRLEMPGPVDEARFLGLELAEGALRDARGLV 180


>gi|193077669|gb|ABO12505.2| predicted acetyltransferase [Acinetobacter baumannii ATCC 17978]
          Length = 168

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIFIRDEREEDIKEIEELTKAAFLNAEHTSHTEHFIVNNLRKHKQLTVSLVAVEDNTIV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQISSGEKNWYGLGPISVAPNKQGQGIGSLLMNSSLEKLKKLGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   L LP  V P     L     V    KG V   E
Sbjct: 121 KYYSRFGFKAYP--DLKLPG-VPPEYFQALSFQNYVP---KGDVSYHE 162


>gi|65320771|ref|ZP_00393730.1| COG3153: Predicted acetyltransferase [Bacillus anthracis str.
           A2012]
          Length = 174

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +    + IV
Sbjct: 2   ITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAV-DEAIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I IE          L P+ V   +Q KGIG KLI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIKIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKAIEWNIKAPFEVPEEVFMVIELTENXLESVEGVVQYS 169


>gi|325122612|gb|ADY82135.1| acetyltransferase, GNAT family [Acinetobacter calcoaceticus PHEA-2]
          Length = 168

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 74/158 (46%), Gaps = 11/158 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              + R E    I A+   +    +           ++   +    L++S +  E + I+
Sbjct: 1   MNIIIRDEQAEDIEAIEKLTKAAFQNAEHTSHTEHFIVNSLRAHGQLTISLVAIEDESII 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S  +I  + LGPI VHP  Q  G+G  LI+ S++  ++ G+Q  VL+GD 
Sbjct: 61  GHIAISPVEISSGEIGWYGLGPISVHPNKQGCGVGSLLINKSLEKLKQLGAQGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
            YYS+ GF+  P   LILP  V       L    N+ +
Sbjct: 121 NYYSRFGFKNYPE--LILP-DVPSEYFQVLTFSGNIPK 155


>gi|220905896|ref|YP_002481207.1| GCN5-like N-acetyltransferase [Cyanothece sp. PCC 7425]
 gi|219862507|gb|ACL42846.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7425]
          Length = 170

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 66/170 (38%), Gaps = 14/170 (8%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKR 83
           + +  + R E D+ I A+   +    +           ++   +    L +S +     R
Sbjct: 1   MNSNIIIRSETDADISAITEVTVTAFKTLEISSHTEQFIIEALRAAKALVVSLVAEVDGR 60

Query: 84  IVGSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           +VG +  +P++        + LGP+ V P YQ KGIG+ LI   +   +   ++   LVG
Sbjct: 61  VVGHIAFSPVTISDGTQGWYGLGPVSVLPDYQRKGIGKALIREGLSCLKDLNARGCCLVG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
              YY K GF+ V    L+    V       L       Q   G V   E
Sbjct: 121 HPEYYRKFGFKNVS--GLVYEG-VPQEVFFALAFDGYTPQ---GTVTFHE 164


>gi|319653782|ref|ZP_08007877.1| hypothetical protein HMPREF1013_04496 [Bacillus sp. 2_A_57_CT2]
 gi|317394508|gb|EFV75251.1| hypothetical protein HMPREF1013_04496 [Bacillus sp. 2_A_57_CT2]
          Length = 177

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 13/173 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRF---VRAAV--LLREQGMHDLSLSFLCA-EGK 82
              L R E  +       M  ++F    +       +   +R        LS +   + K
Sbjct: 1   MDILIRQEFPADYHSTEEMIREAFLNEEYSDKTEHFLVKRIRNSDAFIPELSLVALTQAK 60

Query: 83  RIVGSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
            +VG + ++ I+I           L P+ V P YQ KGIG +LI  +++ A++ G Q ++
Sbjct: 61  EVVGHILLSKITIADGEKAADSLALAPVSVAPGYQGKGIGSQLIRSALNKAKEGGFQSVI 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           ++G   YY K GF+     ++  P  V     + L L +N  +   G+V   +
Sbjct: 121 VLGHKDYYPKFGFKPASLWNIQAPFEVPDEVFMALELTENALEKAAGVVHYSK 173


>gi|300117619|ref|ZP_07055401.1| acetyltransferase, GNAT family protein [Bacillus cereus SJ1]
 gi|298724952|gb|EFI65612.1| acetyltransferase, GNAT family protein [Bacillus cereus SJ1]
          Length = 174

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +  + + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVRRIRECDAFIPELSIVAVD-EEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIVIEQDGTSVESLALAPVSVARGHQKKGIGGKLIAYALEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  ++++G+V+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELAENALESVEGVVQYS 169


>gi|323494936|ref|ZP_08100028.1| acetyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323310900|gb|EGA64072.1| acetyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 170

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 73/161 (45%), Gaps = 15/161 (9%)

Query: 34  FLERLEHDSSICAMHADSF---------GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
              R E  S I  +    +          PG +     ++ + +    LSLS +C +   
Sbjct: 1   MNIRAEIHSDIEQIEKLVYRAFENHPHHAPGAQPTEHLIVNKLRQAEALSLSLVCEDETG 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           I+G +  +P++I     + + LGP+ V P  Q +GIG  LI   +   +++ +Q +VL+G
Sbjct: 61  IIGHIAFSPVAINGELTSCYGLGPVSVVPERQGEGIGGALIRQGLSQLKEQNAQGVVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           +  YY + GF+  P  +L     V     + L L  ++A+ 
Sbjct: 121 EPEYYRRFGFECFPQLTLT---GVPAEYFMSLALSNHIAEG 158


>gi|330683856|gb|EGG95631.1| acetyltransferase, GNAT family [Staphylococcus epidermidis VCU121]
          Length = 176

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 32  AFFLERLEHDSSI--------CAMHADSFGPGRFVRAAVL--LREQGMHDLSLSFLCAEG 81
             F+ R E              A   +S+         ++  LR+       LS +    
Sbjct: 1   MKFIIRQEQKEDYLQTEEVVKKAFENESYS--DQSEHTLVAKLRKSEAFVPDLSLVAVNE 58

Query: 82  KRIVGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            +I+G + ++ I I+          L PI V P YQNKG+G+KLI  ++  AE    + +
Sbjct: 59  DKIIGHILLSKILIDTKDKKVESLALAPISVLPEYQNKGVGQKLIQQALTIAESLDFESV 118

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +++G  AYY K GF+      +  P  V    ++ + L  +   +  GI++ 
Sbjct: 119 IVMGHEAYYPKFGFKKASHWGIQAPFEVSDELLMAIELKDSALNHASGIIQY 170


>gi|237748341|ref|ZP_04578821.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379703|gb|EEO29794.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 169

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 57/150 (38%), Gaps = 8/150 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRA--------AVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E    I A+H                       LRE       LS +  E  RIV
Sbjct: 1   MIIRQEKTGDIDAVHEVVRQAFEKALHTNHDEHNLVNRLRESEAFIPELSLVAEENGRIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T +++       L P+ V P +Q KGIG KLI      A++ G    +LVG  +Y
Sbjct: 61  GHILFTKLNVGDTVQLGLAPLAVLPQWQGKGIGGKLIEAGHAKAKELGFDYSILVGHESY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           Y + G+       +  P  V    ++   L
Sbjct: 121 YPRFGYFPASCIGVTAPFDVPDENLMAFSL 150


>gi|260554664|ref|ZP_05826885.1| acetyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|260411206|gb|EEX04503.1| acetyltransferase [Acinetobacter baumannii ATCC 19606]
          Length = 168

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 72/168 (42%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIFIRDEREEDIKEIEELTKAAFLNAEHTSHTEHFIVNNLRKHKQLTVSLVAVEDNTIV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQISSGEKNWYGLGPISVAPNKQGQGIGSLLMNSSLEKLKKLGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   L   A V P     L     V    KG V   E
Sbjct: 121 KYYSRFGFKAYPDLKL---AGVPPEYFQALSFQNYVP---KGDVSYHE 162


>gi|184158593|ref|YP_001846932.1| acetyltransferase [Acinetobacter baumannii ACICU]
 gi|239501540|ref|ZP_04660850.1| acetyltransferase [Acinetobacter baumannii AB900]
 gi|332875363|ref|ZP_08443192.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6014059]
 gi|183210187|gb|ACC57585.1| predicted acetyltransferase [Acinetobacter baumannii ACICU]
 gi|322507640|gb|ADX03094.1| putative acetyltransferase [Acinetobacter baumannii 1656-2]
 gi|323518514|gb|ADX92895.1| acetyltransferase [Acinetobacter baumannii TCDC-AB0715]
 gi|332736467|gb|EGJ67465.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6014059]
          Length = 168

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIFIRDEREEDIKEIEELTKAAFLNAEHTSHTEHFIVNSLRKHKQLTVSLVAVEDNTIV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQISSGEKNWYGLGPISVAPNKQGQGIGSLLMNSSLEKLKKSGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   L LP  V P     L     V    KG V   E
Sbjct: 121 KYYSRFGFKAYP--DLKLPG-VPPEYFQALSFQNYVP---KGDVSYHE 162


>gi|262274873|ref|ZP_06052684.1| acetyltransferase [Grimontia hollisae CIP 101886]
 gi|262221436|gb|EEY72750.1| acetyltransferase [Grimontia hollisae CIP 101886]
          Length = 167

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 66/162 (40%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  +    I  +    F           LRE G +  +LS +   +G  +VG + 
Sbjct: 1   MLIRSEALADQFAIDRLLKKVFPTDAEAELVKSLRENGHN--TLSLVACNDGGDVVGHLM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        L P+ VHP Y+ +GI  +L+    D   + G    V++GD AYYS
Sbjct: 59  FSPVLVDGTDTGVQGLAPLCVHPDYRGQGIAAQLVREGFDTLNEFGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+      L     V  +  +     +     ++G V  
Sbjct: 119 RFGFKPAEEFGLSCKWDVPADAFMAFEFAEGAFNTVQGQVTY 160


>gi|188590210|ref|YP_001921191.1| acetyltransferase, gnat family [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188500491|gb|ACD53627.1| acetyltransferase, gnat family [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 176

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAV--------LLREQGMHDLSLSFLCAEGKR 83
                R E       ++       +    +          LR    +   LS L    ++
Sbjct: 1   MSLKIRNESKKDYKTIYLLVKDAFKTAEHSDGNEHNLIDTLRTSESYIPELSLLAEIDEK 60

Query: 84  IVGSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG +  T + IE   G      L P+ VHP YQ+ GIG KLI   ++ A+  G +  ++
Sbjct: 61  IVGYIMFTKLFIENQNGKFESLALAPLAVHPQYQDIGIGSKLIIEGLNIAKNLGFKSAIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +G   YY K GF+      +  P  V     + + L +N  ++I G V
Sbjct: 121 LGSEKYYPKFGFKEASDFGIKAPFEVPSENFMVIELQENALKDINGNV 168


>gi|229070920|ref|ZP_04204148.1| GCN5-related N-acetyltransferase [Bacillus cereus F65185]
 gi|228712310|gb|EEL64257.1| GCN5-related N-acetyltransferase [Bacillus cereus F65185]
          Length = 174

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +R+       LS +    + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRKSDAFVPELSIVA-IDEEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++  ++ G   +V++G
Sbjct: 61  GHIMLSNITIEQGGTSVESLALAPVSVARGHQKKGIGGKLITAALEKVKQLGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKAPFEVPEEVFMIMELTENSLRGVEGIVQYS 169


>gi|229151664|ref|ZP_04279865.1| GCN5-related N-acetyltransferase [Bacillus cereus m1550]
 gi|228631725|gb|EEK88353.1| GCN5-related N-acetyltransferase [Bacillus cereus m1550]
          Length = 174

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +           A   + F           +RE       LS +  +   IV
Sbjct: 2   VTIRQEQKNDYRKTEEVIKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDED-IV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG  LI  +++ A++ G   +V++G
Sbjct: 61  GHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGNLIVATLEKAKELGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++  P  V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNIKAPFEVSEEVFMIMELTENSLRGVEGIVQYS 169


>gi|110803143|ref|YP_698183.1| acetyltransferase [Clostridium perfringens SM101]
 gi|110683644|gb|ABG87014.1| acetyltransferase, GNAT family [Clostridium perfringens SM101]
          Length = 179

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 66/171 (38%), Gaps = 12/171 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVR------AAVL--LREQGMHDLSLSFLCAEGKR 83
              + R E +     +        +           ++  LR+       LS +      
Sbjct: 1   MKVIVRKELEEDHKTVELLVEEAFKDAEYSDHMEHVLVSKLRKGENFIDGLSLVAEREGE 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T  +IE          L P+ V P YQ  GIG +LI   +  A++ G   I++
Sbjct: 61  IVGHILLTKANIENETEKYETLALAPVSVLPKYQGIGIGGELIREGMRMAKELGYDSIIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YY K GF+      +  P  V     + + L +   +NI G+VR  
Sbjct: 121 LGHDKYYPKFGFKKAGDFEIRAPFEVPEENFMAIELNEEALKNISGVVRYA 171


>gi|283778278|ref|YP_003369033.1| GCN5-like N-acetyltransferase [Pirellula staleyi DSM 6068]
 gi|283436731|gb|ADB15173.1| GCN5-related N-acetyltransferase [Pirellula staleyi DSM 6068]
          Length = 174

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 35  LERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
             R E  + + A+ + +    R           ++   +    LS+S +     ++VG +
Sbjct: 10  TIRPETSADLSAIRSLTERAFRDAEHTSHTEHFIVDALRNADALSVSLVAEIEGQLVGHI 69

Query: 89  RMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
             +PI+     +    LGPI VHP YQ  GIG  L+   + A  +  +   V++G+  +Y
Sbjct: 70  AFSPITCTDGSLQWFGLGPISVHPDYQRIGIGTALVVAGLAALCELDAHGCVVLGEPTFY 129

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            + GF+  P   L     V P     L + +   Q ++G+V    
Sbjct: 130 RRFGFRYDPHCVLE---GVPPEYFQMLSIGE---QKLRGVVSYHA 168


>gi|307154450|ref|YP_003889834.1| GCN5-like N-acetyltransferase [Cyanothece sp. PCC 7822]
 gi|306984678|gb|ADN16559.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7822]
          Length = 169

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 68/163 (41%), Gaps = 9/163 (5%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           +  R E    +     +   +F  GR   A ++   +    ++LS +     +IVG +  
Sbjct: 2   YSIRPEIKDDVEGVRLLLEKTF--GRPQEADLVDTLREREVITLSMVAHIDGQIVGYIAF 59

Query: 91  TPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +P+ IE  +       L P+ + P YQ + IG KL+   +   +K G Q IV++G   +Y
Sbjct: 60  SPVEIESESSTQKILGLAPLAILPPYQRQEIGSKLVETGLIECQKMGYQAIVVLGAPEFY 119

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           ++ GF+      L     +     +   L+       KG+V  
Sbjct: 120 NRFGFRQASLYQLYSSFDIPSEFFMVKELLNGALGGHKGVVNY 162


>gi|71280226|ref|YP_268906.1| acetyltransferase [Colwellia psychrerythraea 34H]
 gi|71145966|gb|AAZ26439.1| acetyltransferase, GNAT family [Colwellia psychrerythraea 34H]
          Length = 168

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 71/166 (42%), Gaps = 14/166 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              RLE    I ++HA +                ++   +    LS+S +  +  +I+G 
Sbjct: 3   INIRLEKTRDIQSIHAITIAAFLDAPHTDHTEQFIVDALRDSGALSVSLIAEDSSKIIGH 62

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P++        + LGPI V P  QNKGIG KL+  ++       +   VL+GD  Y
Sbjct: 63  VALSPVTISDGSKDWYGLGPISVVPTDQNKGIGSKLMHAALRELNNLNANGCVLLGDPNY 122

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF+ +    L+LP  V P       L  +      G+V   E
Sbjct: 123 YRRFGFEPIG--GLVLP-DVPPEYFQATLLKGSYP---TGVVTYHE 162


>gi|154253671|ref|YP_001414495.1| GCN5-like N-acetyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154157621|gb|ABS64838.1| GCN5-related N-acetyltransferase [Parvibaculum lavamentivorans
           DS-1]
          Length = 188

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 44  ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI-TGHL 102
           + ++ AD+FGP RF +A   LR+    + SLS +  +  ++VG++R  P+ I       L
Sbjct: 28  VESLVADAFGPDRFAKAVYRLRDGVDAEASLSLVAIDKGKVVGTLRFWPVEIAGQVPALL 87

Query: 103 LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILP 162
           LGP+V  P  Q +GIG KL+   +  A  +G +++VLVGD  YY + GF     + L LP
Sbjct: 88  LGPLVTCPERQGEGIGSKLMHEGLARAAAQGHRIVVLVGDEPYYRRFGFHRALARRLELP 147

Query: 163 APVDPNRVLFLP 174
             VDP R L   
Sbjct: 148 GWVDPARFLARE 159


>gi|306832601|ref|ZP_07465740.1| GNAT family acetyltransferase [Streptococcus bovis ATCC 700338]
 gi|304425209|gb|EFM28336.1| GNAT family acetyltransferase [Streptococcus bovis ATCC 700338]
          Length = 169

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 65/166 (39%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHAD---SFG---PGRFVRAAVLLREQGM--HDLSLSFLCAEGKRIV 85
              + E  S I A+      +F            ++ R +        LS +     +IV
Sbjct: 1   MFIKQEQASDITAVDQVIKKAFASLPYSDHQEHLLVRRLRQSKEFIPELSLVAELDGQIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   +   T   L P+ VHP YQ +GIG  L+      A+       +++GD  Y
Sbjct: 61  GHILFTKAQVNHTTVLALAPLAVHPDYQQQGIGSALVKKGHQLAQTLQFPYSIVLGDPQY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           YS+ G+QA     +  P  V  N  + + L+Q+      G +   E
Sbjct: 121 YSRFGYQAAKNWGIFPPFDVPSNHFMGIKLIQSAP-PFHGTLAYSE 165


>gi|169795605|ref|YP_001713398.1| putative acetyltransferase [Acinetobacter baumannii AYE]
 gi|215483092|ref|YP_002325299.1| Acetyltransferase (GNAT) family protein [Acinetobacter baumannii
           AB307-0294]
 gi|301513667|ref|ZP_07238904.1| Acetyltransferase (GNAT) family protein [Acinetobacter baumannii
           AB058]
 gi|301594686|ref|ZP_07239694.1| Acetyltransferase (GNAT) family protein [Acinetobacter baumannii
           AB059]
 gi|332850941|ref|ZP_08433094.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6013150]
 gi|332871397|ref|ZP_08439932.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6013113]
 gi|169148532|emb|CAM86398.1| putative acetyltransferase [Acinetobacter baumannii AYE]
 gi|213986097|gb|ACJ56396.1| Acetyltransferase (GNAT) family protein [Acinetobacter baumannii
           AB307-0294]
 gi|332730376|gb|EGJ61698.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6013150]
 gi|332731529|gb|EGJ62817.1| acetyltransferase, GNAT family [Acinetobacter baumannii 6013113]
          Length = 168

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIFIRDEREEDIKEIEELTKAAFLNAEHTSHTEHFIVNSLRKHKQLTVSLVAVEDNTIV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQISSGEKNWYGLGPISVTPNKQGQGIGSLLMNSSLEKLKKSGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   L LP  V P     L     V    KG V   E
Sbjct: 121 KYYSRFGFKAYP--DLKLPG-VPPEYFQALSFQNYVP---KGDVSYHE 162


>gi|326793007|ref|YP_004310828.1| GCN5-related N-acetyltransferase [Clostridium lentocellum DSM 5427]
 gi|326543771|gb|ADZ85630.1| GCN5-related N-acetyltransferase [Clostridium lentocellum DSM 5427]
          Length = 203

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 71/173 (41%), Gaps = 16/173 (9%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAV--LLREQGMHDLSLSFLCAEGK 82
              + RLE       +   +       + PG      +   LRE       L +L  +G 
Sbjct: 1   MDIVLRLEEAKDYEVVENLTREAFWDVYKPG-CDEHLILRQLRESEGFVKELDYLAIDGD 59

Query: 83  RIVGSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           +IVG++  T +++E  +       +GPI V P Y+ KGIG  L+  +++ A K G + IV
Sbjct: 60  KIVGNIAYTKVTVENNSADNKVLCMGPIGVLPEYKGKGIGSMLMRHTIELARKMGFKGIV 119

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  +Y   GF       L      +    + L L +     + G  +C E
Sbjct: 120 LYGDPKFYHHFGFVNAEQYGLQTSWGTNFEEFMALELSEGSLSGMSG--KCFE 170


>gi|213158453|ref|YP_002319751.1| acetyltransferase, gnat family [Acinetobacter baumannii AB0057]
 gi|213057613|gb|ACJ42515.1| acetyltransferase, gnat family [Acinetobacter baumannii AB0057]
          Length = 168

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +  I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIFIRDEREEDIKEIEELTKAAFLNAEHTSHTEHFIVNSLRKHKQLTVSLVAVEDNTIV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+  S  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD 
Sbjct: 61  GHVAISPVQISSGEKNWYGLGPISVTPNKQGQGIGSLLMNSSLEKLKKIGAKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+A P   L LP  V P     L     V    KG V   E
Sbjct: 121 KYYSRFGFKAYP--DLKLPG-VPPEYFQALSFQNYVP---KGDVSYHE 162


>gi|114705046|ref|ZP_01437954.1| hypothetical protein FP2506_08916 [Fulvimarina pelagi HTCC2506]
 gi|114539831|gb|EAU42951.1| hypothetical protein FP2506_08916 [Fulvimarina pelagi HTCC2506]
          Length = 174

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/145 (37%), Positives = 82/145 (56%), Gaps = 3/145 (2%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R E       +  +  D+FGPGR+ RAA  +RE      +L F+  +G+ I GSVR+
Sbjct: 30  IIYRPETPEDAQVVETIADDAFGPGRYARAAERVRELFSVVPNLCFVACDGEFIAGSVRV 89

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T +        +LGP+ V P  + +GIG+ L+  +   A+ +G   I LVGD  YY+ LG
Sbjct: 90  TQLPSAPEKALMLGPLAVRPHLKGRGIGKALMRHTAARAKMEGFAAIYLVGDTPYYAPLG 149

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPL 175
           ++A+  K ++LP PVDP R LFL L
Sbjct: 150 YRAIEPKRIVLPRPVDPARTLFLQL 174


>gi|325103143|ref|YP_004272797.1| GCN5-related N-acetyltransferase [Pedobacter saltans DSM 12145]
 gi|324971991|gb|ADY50975.1| GCN5-related N-acetyltransferase [Pedobacter saltans DSM 12145]
          Length = 178

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
              R E       +        R    +          LR        LS +  E  +IV
Sbjct: 3   LKIRKEKKGDFRVVFKLVQNAFRNEELSDHKEQYLVERLRSSDAFIPELSLVAEEDSQIV 62

Query: 86  GSVRMTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G + +T I+I            + P+ V P +Q KGIG KLI  + D A++ G   +V++
Sbjct: 63  GYILLTKINIIDAGSNMHVSLAMAPVAVLPEFQGKGIGTKLIRYAHDKAKELGFGSVVVL 122

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           G   YY K G++      + LP  V     + + L +N  +N+ G V+ 
Sbjct: 123 GHENYYPKFGYKLTKEFGIKLPFEVPEANCIAIELTENSLKNVTGTVKY 171


>gi|104782339|ref|YP_608837.1| acetyltransferase [Pseudomonas entomophila L48]
 gi|95111326|emb|CAK16046.1| putative acetyltransferase, GNAT family [Pseudomonas entomophila
           L48]
          Length = 168

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 69/168 (41%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A++  +                ++   +    LS+S +  EG  +V
Sbjct: 1   MNITLRNERPEDIPAINRLTEAAFANAEHSSHTEHFIVDALRRAGQLSVSLVAVEGDTLV 60

Query: 86  GSVRMTPISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+++         LGPI V P  Q +GIG  L+  ++   ++ G    V++GD 
Sbjct: 61  GHVALSPVTLSSGVSGWFGLGPISVLPARQGQGIGSLLMKAALAELQRMGGAGCVVLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           AYY + GF+  P   L LP  V       L          +G+VR  +
Sbjct: 121 AYYGRFGFKPQP--GLTLPG-VPAEYFQALAF-DGAMA--QGVVRYHD 162


>gi|240851012|ref|YP_002972412.1| acetyltransferase [Bartonella grahamii as4aup]
 gi|240268135|gb|ACS51723.1| acetyltransferase [Bartonella grahamii as4aup]
          Length = 194

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 45/166 (27%), Positives = 74/166 (44%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F   LE ++       +   + G GR  +++  LR   +    LSF+       +VGSVR
Sbjct: 14  FTLLLEQEADKPYREILLDSTMGHGRKRKSSEALRRGRLAAQGLSFVVKNAFGELVGSVR 73

Query: 90  MTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +  +S  K         LLGP+ V       GIG  L+  +++ A+K G   I+LVGD  
Sbjct: 74  LWHVSFSKGKNKTQYALLLGPLAVASECAGLGIGSILVRHAIETAKKLGYGAILLVGDCE 133

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +Y + GF     ++L +P P + +R   L L+ +      G +   
Sbjct: 134 FYQRFGFSNSLTENLAMPGPYEKHRFQALELIPHYLSGCYGTLVPS 179


>gi|332703918|ref|ZP_08424006.1| GCN5-related N-acetyltransferase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554067|gb|EGJ51111.1| GCN5-related N-acetyltransferase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 169

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHAD---SF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E ++    ++     +F       G+       LR  G +   L+ +  E  ++V
Sbjct: 1   MVIRRETEAEFPQIYDLVKVAFQTAKVSNGKEQDFVNQLRSGGNYIPELALVAEENGQLV 60

Query: 86  GSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T         K    LL PI V   Y+N+GIG  LI  S   A+ +G   ++LVG
Sbjct: 61  GHIMLTKAHVVDGETKFETLLLAPISVALEYRNRGIGSALIKESFRLAKARGYTSVLLVG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           D AYY + GF+      +    P+    V+   LV N  + + G   C
Sbjct: 121 DPAYYHRYGFRTAAGFGIKPTHPIPDENVMACELVPNALRGVSGTTDC 168


>gi|33596413|ref|NP_884056.1| hypothetical protein BPP1786 [Bordetella parapertussis 12822]
 gi|33602296|ref|NP_889856.1| hypothetical protein BB3321 [Bordetella bronchiseptica RB50]
 gi|33566182|emb|CAE37088.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33576735|emb|CAE33813.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 174

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 70/168 (41%), Gaps = 15/168 (8%)

Query: 31  GAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRI 84
           G   L R E  +   A+   +    R         A ++   +    L+LS +     R+
Sbjct: 6   GGPMLIRSETPADQRAIFDVTQAAFRGHPHSEQTEAYIVQALRAAGALTLSLVAELDARV 65

Query: 85  VGSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           VG    +P+  S    +   LGP+ V P +Q +GIG  LI   +   + +G+   VLVG+
Sbjct: 66  VGHAAFSPVQISDGSPSWFGLGPVSVDPAHQGRGIGTALIEHGLARLQARGAAGCVLVGE 125

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            AYY + GF+  P   L+LP  + P   L L          +G V   
Sbjct: 126 PAYYGRFGFRPEP--GLVLP-DMPPTHFLALTFG----APARGTVTYH 166


>gi|70727599|ref|YP_254515.1| hypothetical protein SH2600 [Staphylococcus haemolyticus JCSC1435]
 gi|68448325|dbj|BAE05909.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 176

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
             F+ R E          +  ++F    +       ++  LR        LS +     +
Sbjct: 1   MNFIIRKEKKEDYKITEEVVKEAFANEEYSDQSEHRLVASLRNSDEFIPDLSLVALHKDK 60

Query: 84  IVGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + ++ I I    + I    L PI V P YQNKG+G+ LI  S++ AE+     +++
Sbjct: 61  IIGHILLSKIFIVKGEKSIESLALAPISVLPNYQNKGVGQSLIQRSLEIAEELNFDSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K GF+      +  P  V    ++ + L +N       I++  +
Sbjct: 121 MGHSEYYPKFGFKKASNWCIQAPFEVPDEFLMAIELKKNALDKTSRIIQYSD 172


>gi|33593182|ref|NP_880826.1| hypothetical protein BP2177 [Bordetella pertussis Tohama I]
 gi|33563557|emb|CAE42455.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382593|gb|AEE67440.1| hypothetical protein BPTD_2143 [Bordetella pertussis CS]
          Length = 166

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 69/165 (41%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E  +   A+   +    R         A ++   +    L+LS +     R+VG 
Sbjct: 1   MLIRSETPADQRAIFDVTQAAFRGHPHSEQTEAYIVQALRAAGALTLSLVAELDARVVGH 60

Query: 88  VRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
              +P+  S    +   LGP+ V P +Q +GIG  LI   +   + +G+   VLVG+ AY
Sbjct: 61  AAFSPVQISDGSPSWFGLGPVSVDPAHQGRGIGTALIEHGLARLQARGAAGCVLVGEPAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF+  P   L+LP  + P   L L          +G V   
Sbjct: 121 YGRFGFRPEP--GLVLP-DMPPTHFLALTFG----APARGTVTYH 158


>gi|228916098|ref|ZP_04079669.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228843570|gb|EEM88647.1| GCN5-related N-acetyltransferase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 151

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 67/136 (49%), Gaps = 5/136 (3%)

Query: 59  RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE----KITGHLLGPIVVHPLYQN 114
                +RE       LS +  + + IVG + ++ I+IE          L P+ V   +Q 
Sbjct: 12  ELVKRIRECDAFVPELSIVAVD-EEIVGHIMLSKITIEQDGTSEESLALAPVSVARGHQK 70

Query: 115 KGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP 174
           KGIG KLI  +++ A++ G + +V++G   YY K GF+     ++  P  V     + + 
Sbjct: 71  KGIGGKLIVAALEKAKELGYESVVVLGHPKYYPKFGFKKASEWNIKPPFEVPDEVFMVME 130

Query: 175 LVQNVAQNIKGIVRCR 190
           L +N  ++++G+V+  
Sbjct: 131 LRENALESVEGVVQYS 146


>gi|330828853|ref|YP_004391805.1| GNAT family acetyltransferase [Aeromonas veronii B565]
 gi|328803989|gb|AEB49188.1| Acetyltransferase, GNAT family [Aeromonas veronii B565]
          Length = 179

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 3/159 (1%)

Query: 35  LERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
           + R E    +  ++       GR   A ++ R +      ++ +  E    +G + ++PI
Sbjct: 1   MLRTERPGDMLPVYELLSAAFGRSDEAELVNRLRECGAAVVTMVEEEEYEFMGHLMLSPI 60

Query: 94  SIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
           +I         L P+ VHP +Q +GIG  LI   +D A +   + +V++GD  YYS+ GF
Sbjct: 61  TINGMEGPWLGLAPVAVHPDWQGQGIGSDLIREGLDTALEMDWKGVVVLGDPVYYSRFGF 120

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +      L     V  +  + + L +     ++G V   
Sbjct: 121 RPASEFGLHCIYEVPADCFMAMELQERGFAGVQGEVLYH 159


>gi|186682799|ref|YP_001865995.1| GCN5-related N-acetyltransferase [Nostoc punctiforme PCC 73102]
 gi|186465251|gb|ACC81052.1| GCN5-related N-acetyltransferase [Nostoc punctiforme PCC 73102]
          Length = 169

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 63/148 (42%), Gaps = 6/148 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  S    I  ++  +FG     +    +R    +   LS +      +VG +  
Sbjct: 2   IDIRYETLSDYTVIAEVNTLAFGQENEAKLVEKIRRSDRYIPELSLVAEIENVVVGHILF 61

Query: 91  TPISIEKITGH---LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           + I +          L P+ V+P +Q +GIG  LI   ++ AE K   +++++G   +Y+
Sbjct: 62  SYIDLVGEETLQVIGLAPLAVYPQFQRQGIGSALIKAGLEIAEAKKEAIVIVLGHPHFYT 121

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           + GFQ      +  P PV  +  +  PL
Sbjct: 122 RFGFQPSVVYEIESPFPVPEDVFMVKPL 149


>gi|172058431|ref|YP_001814891.1| GCN5-related N-acetyltransferase [Exiguobacterium sibiricum 255-15]
 gi|171990952|gb|ACB61874.1| GCN5-related N-acetyltransferase [Exiguobacterium sibiricum 255-15]
          Length = 167

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
              R E     + I  +H  +FG          LRE        S +   +   IVG V 
Sbjct: 1   MQIRTEIFKDAAGIRLVHQAAFGQRTEADLVEALREDEASLPHYSRVAVTDKGEIVGHVL 60

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           ++ I IE I    L P+ V P +Q KGIG +LI   ++ A + G   IV++G  +YY + 
Sbjct: 61  LSRIYIEDIPSLALAPVGVKPHWQRKGIGSELIRQVIEDAREAGESHIVVLGHDSYYPQF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           GF+      +  P PV  +  L +PL +   + I G VR  +
Sbjct: 121 GFERAVDYGIEAPFPVPMDVFLVMPLERQALKGIAGTVRYSK 162


>gi|229080684|ref|ZP_04213203.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock4-2]
 gi|228702622|gb|EEL55089.1| GCN5-related N-acetyltransferase [Bacillus cereus Rock4-2]
          Length = 174

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 71/169 (42%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +                 F   +       +RE       LS +  + + IV
Sbjct: 2   VTIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFIPELSIVAVD-EEIV 60

Query: 86  GSVRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I+IE     +    L P+ V   +Q KGIG KLI+ +++ A++ G   +V++G
Sbjct: 61  GHIMLSKIAIEQDGTSVESLALAPVSVARGHQKKGIGGKLITAALEKAKQLGYGSVVVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
              YY K GF+     ++     V     + + L +N  + ++GIV+  
Sbjct: 121 HPEYYPKFGFKKASEWNVKALFEVPEEVFMIMELTENSLRGVEGIVQYS 169


>gi|294816391|ref|ZP_06775034.1| putative transferase [Streptomyces clavuligerus ATCC 27064]
 gi|294328990|gb|EFG10633.1| putative transferase [Streptomyces clavuligerus ATCC 27064]
          Length = 176

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 66/161 (40%), Gaps = 6/161 (3%)

Query: 35  LERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDL---SLSFLCA-EGKRIVGSVR 89
             R E    I A+HA  +        A ++   +   +     LS + A     +V    
Sbjct: 12  TVRPESPEDIPAVHAVNAAAFDTPAEADLVDALRADPEAWIDGLSLVAAASDGTVVAHAL 71

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   I       L P  V P +Q +G G  ++  +++AA ++G   +V++G  AYY + 
Sbjct: 72  LTRCHIGGGPALALAPCAVLPGHQRRGAGSAVVRAALEAAREQGESPVVVLGHPAYYRRF 131

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+      +  P  V    ++ L L  +     +G++R  
Sbjct: 132 GFEPASRWGIRAPFDVPDEALMALVLDSDRPVP-RGVIRYA 171


>gi|54307825|ref|YP_128845.1| putative acetyltransferase [Photobacterium profundum SS9]
 gi|46912248|emb|CAG19043.1| putative acetyltransferase [Photobacterium profundum SS9]
          Length = 167

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++R +     +LS +   +   ++G + 
Sbjct: 1   MLIRTEAPADILPIDRLLKTVF--ETDAEADLVMRLRENSHRTLSLVACSDDGEVIGHIL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++ +      L P+ V P YQ +GIG+ L+  +       G  V+V++G   YY 
Sbjct: 59  FSPVTVDDVDDNWQGLAPLSVKPEYQRQGIGKALMEEAKIMLADFGYPVVVVLGHSEYYP 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           ++GF+      L     V     + L ++        G+V+  E
Sbjct: 119 QVGFEKASEHGLGCIWEVPDEAFMVLEVIPEHLAGKSGVVKYSE 162


>gi|251810492|ref|ZP_04824965.1| possible acetyltransferase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875450|ref|ZP_06284321.1| acetyltransferase, GNAT family [Staphylococcus epidermidis SK135]
 gi|251806096|gb|EES58753.1| possible acetyltransferase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295477|gb|EFA88000.1| acetyltransferase, GNAT family [Staphylococcus epidermidis SK135]
 gi|329732994|gb|EGG69335.1| acetyltransferase, GNAT family [Staphylococcus epidermidis VCU028]
          Length = 176

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKR 83
             F  R E          +  ++F    +       ++  LR        LS +     +
Sbjct: 1   MNFFIRKEKKEDYKITEEVVKEAFANEEYSDQSEHRLVASLRNSDEFIPDLSLVALHRDK 60

Query: 84  IVGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + ++ I I    + I    L P+ V P YQNKG+G+ LI  S++ AEK     +++
Sbjct: 61  IIGHILVSKIFIVKGEKSIESLALAPVSVLPNYQNKGVGQSLIQKSLEVAEKLNFDSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY K  F+      +  P  V    ++ + L +N      GI++  +
Sbjct: 121 MGHSEYYPKFEFKKASNWGIKAPFEVPDEFLMAIELKKNALDKTSGIIQYSD 172


>gi|294084806|ref|YP_003551566.1| GCN5-like N-acetyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664381|gb|ADE39482.1| GCN5-related N-acetyltransferase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 164

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 1/142 (0%)

Query: 44  ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLL 103
           + A+  ++FG  R  R+   LR        + F+  +    VGS+R   + +      LL
Sbjct: 15  VDALMDEAFGLNRHARSVWNLRPG-APVAEMCFVLRDNGIAVGSLRFWEVMLGTHPILLL 73

Query: 104 GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPA 163
           GP+ V P  + KG G+ L+S  +  A+      I++ G++ YY K GF       +  P 
Sbjct: 74  GPLAVRPDLRGKGYGKALVSAGLTHAKSFNWPAILVSGEVDYYPKFGFVPAAPYDVQWPG 133

Query: 164 PVDPNRVLFLPLVQNVAQNIKG 185
            ++P R+ F  L      ++ G
Sbjct: 134 FIEPERLQFFELKNGFLASLVG 155


>gi|253572325|ref|ZP_04849728.1| acetyltransferase [Bacteroides sp. 1_1_6]
 gi|251838100|gb|EES66188.1| acetyltransferase [Bacteroides sp. 1_1_6]
          Length = 172

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 68/168 (40%), Gaps = 14/168 (8%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRA--------AVLLREQGMHDLSLSFLCAEGKRI 84
            F  R E    +  ++          +         AV LRE       LS +     ++
Sbjct: 3   NFKIRQETKEDLDEVYQLIKTAFETAKVKDGDEQDFAVKLREGKNFIPELSMVAETDGKL 62

Query: 85  VGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G + MT       + E+ T  L+ P+ V   Y++ G+G  L+   +  A + G Q + L
Sbjct: 63  IGHIMMTQTPVLQSNGERYTALLVAPLSVQLEYRDLGVGSALMKEGLRLAAEMGYQAVFL 122

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            GD  YYS+ G+Q+     +  P  +    VL   LV +    ++G +
Sbjct: 123 TGDPNYYSRFGYQSSSRFGITCPG-IPDQYVLAYELVPHALDKVEGTI 169


>gi|298386490|ref|ZP_06996046.1| acetyltransferase, GNAT family [Bacteroides sp. 1_1_14]
 gi|298260867|gb|EFI03735.1| acetyltransferase, GNAT family [Bacteroides sp. 1_1_14]
          Length = 172

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 68/168 (40%), Gaps = 14/168 (8%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRA--------AVLLREQGMHDLSLSFLCAEGKRI 84
            F  R E    +  ++          +         AV LRE       LS +     ++
Sbjct: 3   NFKIRQETKEDLDEVYQLIKTAFETAKVKDGDEQDFAVKLREGKNFIPELSMVAETDGKL 62

Query: 85  VGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G + MT       + E+ T  L+ P+ V   Y++ G+G  L+   +  A + G Q + L
Sbjct: 63  IGHIMMTQTPVLQSNGERYTALLVAPLSVLLEYRDLGVGSALMKEGLRLAAEMGYQAVFL 122

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            GD  YYS+ G+Q+     +  P  +    VL   LV +    ++G +
Sbjct: 123 TGDPNYYSRFGYQSSSRFGITCPG-IPDQYVLAYELVPHALDKVEGTI 169


>gi|90412495|ref|ZP_01220498.1| putative acetyltransferase [Photobacterium profundum 3TCK]
 gi|90326532|gb|EAS42938.1| putative acetyltransferase [Photobacterium profundum 3TCK]
          Length = 167

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++R +     +LS +   +   ++G + 
Sbjct: 1   MLIRTEAPADILPIDRLLKTVF--ETDAEADLVMRLRENSHRTLSLVACSDDGEVIGHIL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++ +      L P+ V P YQ +GIG+ L+  +       G  V+V++G   YY 
Sbjct: 59  FSPVTVDDVDDNWQGLAPLSVKPEYQRQGIGKALMEEAKLMLADFGYPVVVVLGHSEYYP 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           ++GF+      L     V     + L ++        G+V+  E
Sbjct: 119 QVGFEKASEHGLGCIWEVPDEAFMVLEVIPEHLAGKSGVVKYSE 162


>gi|255292008|dbj|BAH90491.1| GCN5-related N-acetyltransferase [uncultured bacterium]
 gi|255292869|dbj|BAH89969.1| GCN5-related N-acetyltransferase [uncultured bacterium]
 gi|255292953|dbj|BAH90051.1| GCN5-related N-acetyltransferase [uncultured bacterium]
 gi|255293223|dbj|BAH90313.1| GCN5-related N-acetyltransferase [uncultured bacterium]
          Length = 172

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 70/165 (42%), Gaps = 15/165 (9%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+ A +                ++   +   +L+LS +  E  +IV
Sbjct: 1   MTIQLRHETPDDIAAIEAVTVAAFADALHTSHTEQFIVRALRAADELTLSIMAEEHGQIV 60

Query: 86  GSVRMTPIS------IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           G V ++P+S            + LGPI V P  Q +GIG +L+  ++       +   VL
Sbjct: 61  GHVALSPVSITDQHGQNAQGWYGLGPISVLPKRQGQGIGSRLMEQALSELRAMRAAGCVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +GD AYY++ GFQA     L LP  V P   + L L   V + + 
Sbjct: 121 LGDPAYYARFGFQA--HAGLQLPG-VPPGYFMALALYGPVPEGVA 162


>gi|325959147|ref|YP_004290613.1| GCN5-related N-acetyltransferase [Methanobacterium sp. AL-21]
 gi|325330579|gb|ADZ09641.1| GCN5-related N-acetyltransferase [Methanobacterium sp. AL-21]
          Length = 168

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 34  FLERLEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
            + R E      A+   +       + A ++ + +   D ++S +     ++VG +  +P
Sbjct: 1   MIIRNEKIEDHEAVREINLKAFPTDIEATLVDKLRSSMD-TISLVAVHEDKVVGHILFSP 59

Query: 93  ISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           ++IE         +L PI V P YQ +GIG KL+   +      G  +I+LVG   YY +
Sbjct: 60  LTIENDEESFPALILAPIAVLPEYQKQGIGSKLVENGIIECRNHGHSIIILVGHPGYYPR 119

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            GF +     +  P  V  +  +   LV +    + G+++  +
Sbjct: 120 FGFISAEQNRIEHPFEVPEDVFMVYELVPDTLSRVNGVLKYSK 162


>gi|75909188|ref|YP_323484.1| GCN5-like N-acetyltransferase [Anabaena variabilis ATCC 29413]
 gi|75702913|gb|ABA22589.1| GCN5-related N-acetyltransferase [Anabaena variabilis ATCC 29413]
          Length = 173

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 62/149 (41%), Gaps = 6/149 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  +    I  ++  +FG     +    +R    +   LS +      +VG +  
Sbjct: 6   MNIRCETATDYLAISEVNNLAFGQENESQLIDKIRISEFYIPELSLIAEVNHTVVGHILF 65

Query: 91  TPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           + I +          L P+ VHP +Q +GIG  L+   ++ A+ +G  +++++G   +YS
Sbjct: 66  SYIELAGEEKIQVLGLAPMAVHPEFQRQGIGSALVKAGLEKADARGESLVIVLGHPQFYS 125

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           + GF       +  P PV  +  +   L 
Sbjct: 126 RFGFVPSVNYKIASPFPVPDDVFMVKTLR 154


>gi|302341635|ref|YP_003806164.1| GCN5-related N-acetyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301638248|gb|ADK83570.1| GCN5-related N-acetyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 170

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 65/166 (39%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
            L R E       +H       +  + +          LR  G +   L+ +  E  RI+
Sbjct: 1   MLIRQEKPEDFPTIHDLVKIAFQTAKVSNGDEQNFVERLRAGGNYIPELALVAEEEGRII 60

Query: 86  GSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T  +I          LLGP+ V    + +G+G +L+  +   A   G   +VL G
Sbjct: 61  GHIMLTATAIATAGGPRAVLLLGPLAVMLERRGRGVGARLVEEACAKARALGHGAVVLAG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           D AYY++ GF+      +     +    V+   L     Q + G++
Sbjct: 121 DPAYYARFGFRPTADFGVGNTNGIPEAYVMARELWPGALQGVGGLI 166


>gi|326382337|ref|ZP_08204029.1| acetyltransferase [Gordonia neofelifaecis NRRL B-59395]
 gi|326199067|gb|EGD56249.1| acetyltransferase [Gordonia neofelifaecis NRRL B-59395]
          Length = 170

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 61/167 (36%), Gaps = 5/167 (2%)

Query: 29  KIGAFFLERLEHDSSICAMHADSFGPGRFVR-AAVLLREQGMH---DLSLSFLCAEGKRI 84
                +  R E      A+ A           A ++   +         LS++      +
Sbjct: 1   MTENNWSVRPEKHGDEAAIRAVEMAAFPSAEEADLVDALRRDPTAWIDGLSYVAVVDGDV 60

Query: 85  VGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +G   +T   I+      L P  V P  Q  G+G  +I+  +DAA + G    V++G   
Sbjct: 61  IGHALLTRAEIDGEPVLALAPCAVVPSAQGTGVGTSVITALLDAAREAGETTAVVLGHAD 120

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           YY + GF+      +  P  V  +  L LPL  +      G++R   
Sbjct: 121 YYPRFGFRPASGFGVTAPFDVPDDAFLVLPLAPDTV-PPSGLMRYAA 166


>gi|332715984|ref|YP_004443450.1| GCN5-like N-acetyltransferase [Agrobacterium sp. H13-3]
 gi|325062669|gb|ADY66359.1| GCN5-related N-acetyltransferase [Agrobacterium sp. H13-3]
          Length = 189

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 78/164 (47%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+   + A   +   + G GR  +++  LR   +    L+ +  +    ++G+VR
Sbjct: 17  FHVDQENPGDVVARENLLDRAMGAGRRRKSSEKLRAGRVPAEGLALVARDEDGHVIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          +   LLGP+ V   ++ KGIG  L+  ++  A K+G   I+LVGD 
Sbjct: 77  LWNVEAGISREGRAVEALLLGPLAVDAAHEGKGIGSALMRAAISEATKRGHGGILLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           AYY + GF A   + LI+P P + +R L L L     +   G++
Sbjct: 137 AYYERFGFFADKAQHLIMPGPFERSRFLALELKAGWLEGAAGML 180


>gi|150396617|ref|YP_001327084.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
 gi|150028132|gb|ABR60249.1| GCN5-related N-acetyltransferase [Sinorhizobium medicae WSM419]
          Length = 165

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 67/165 (40%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R + +    A+   +              A ++ R +    L+LS +  E   I+G 
Sbjct: 1   MIIRPDTEGDDEAIRQITEAAFAGQPYSSQTEARIIDRLRSEDALTLSLVAEEEGEIIGH 60

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P++I    +  + LGP+ V P  Q  G G  L+   +D   K G+   VL GD A+
Sbjct: 61  IAFSPVTIAPFAVGWYGLGPVAVRPDRQGHGTGSALVRRGLDMLRKAGASGCVLAGDPAF 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF+  P   L+      P   + LPL       + G V   
Sbjct: 121 YGRFGFRNEPA--LVYEG-CAPQYFMALPLS-GAL--VSGTVTYH 159


>gi|127513734|ref|YP_001094931.1| GCN5-related N-acetyltransferase [Shewanella loihica PV-4]
 gi|126639029|gb|ABO24672.1| GCN5-related N-acetyltransferase [Shewanella loihica PV-4]
          Length = 166

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 65/166 (39%), Gaps = 14/166 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    I A+   +                ++   +    L++S +     +IVG 
Sbjct: 1   MHIRSEAPGDIAAIEEITKAAFLEAPHTDHTEHLIVNALRDAGALAISLVAEVQGKIVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++ ++        + LGPI V P  Q +GIG  L+  +++A +   +   VL+G+  +
Sbjct: 61  VALSRVTISDGSQDWYGLGPISVVPERQGEGIGSALMGAALEALDNASAHGCVLLGEPEF 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF   P   LILP  V     L   L     Q   G V   +
Sbjct: 121 YQRFGF--APKAGLILPG-VPEAYFLACKLGGEWPQ---GEVSYHD 160


>gi|254393846|ref|ZP_05008955.1| acetyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|326444719|ref|ZP_08219453.1| putative transferase [Streptomyces clavuligerus ATCC 27064]
 gi|197707442|gb|EDY53254.1| acetyltransferase [Streptomyces clavuligerus ATCC 27064]
          Length = 169

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 66/161 (40%), Gaps = 6/161 (3%)

Query: 35  LERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDL---SLSFLCA-EGKRIVGSVR 89
             R E    I A+HA  +        A ++   +   +     LS + A     +V    
Sbjct: 5   TVRPESPEDIPAVHAVNAAAFDTPAEADLVDALRADPEAWIDGLSLVAAASDGTVVAHAL 64

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   I       L P  V P +Q +G G  ++  +++AA ++G   +V++G  AYY + 
Sbjct: 65  LTRCHIGGGPALALAPCAVLPGHQRRGAGSAVVRAALEAAREQGESPVVVLGHPAYYRRF 124

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+      +  P  V    ++ L L  +     +G++R  
Sbjct: 125 GFEPASRWGIRAPFDVPDEALMALVLDSDRPVP-RGVIRYA 164


>gi|193078125|gb|ABO13067.2| GCN5-related N-acetyltransferase [Acinetobacter baumannii ATCC
           17978]
          Length = 168

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I  + A +                ++   +    L++S +  E   IV
Sbjct: 1   MNITIRDEQPEDIKNIEALTKAAFLNEEHSSHTEQFIVNSLRKHKQLTISLVAIEDDLIV 60

Query: 86  GSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P++I       + LGPI V P  Q  GIG  L++ ++   ++ G +  VL+GD 
Sbjct: 61  GHVAISPVTITSGDTGWYGLGPISVCPKKQGIGIGSLLMNAALQKLKELGGKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF++ P  +L     V       L  + ++     G V   +
Sbjct: 121 NYYSRFGFKSYPDLNL---PDVPNEYFQALSFINHIP---SGEVTYHD 162


>gi|38505885|ref|NP_942503.1| hypothetical protein sll6060 [Synechocystis sp. PCC 6803]
 gi|38423909|dbj|BAD02117.1| sll6060 [Synechocystis sp. PCC 6803]
          Length = 177

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 67/171 (39%), Gaps = 14/171 (8%)

Query: 29  KIGAFFLERLEHDSS---ICAMHADSFGP---GRFVRAAVLLREQGMHDLSLSFLCAEGK 82
             G   L R E       I  +   +F P          ++   +    L+LS +     
Sbjct: 1   MTGQEILIRDERKDDAVLITEVTIAAFAPLEISNHTEQFIIEALRSAGALTLSLVAEVNS 60

Query: 83  RIVGSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           R+VG +  +P+  S      + LGP+ V PLYQ +GIG+ LI   +   +  G++   LV
Sbjct: 61  RVVGHIAFSPVAISDGTKNWYGLGPVSVLPLYQRRGIGKALIQEGLSQLKGLGAKGCCLV 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY K GF+ V   +L     V       L    +  Q   G V   E
Sbjct: 121 GHPEYYKKFGFKNVAGLALE---GVPDEVFFALSFDSHYPQ---GDVTFHE 165


>gi|222087144|ref|YP_002545679.1| acetyltransferase protein [Agrobacterium radiobacter K84]
 gi|221724592|gb|ACM27748.1| acetyltransferase protein [Agrobacterium radiobacter K84]
          Length = 196

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F   LE+   + A       + G  R  +++  +R   +    L+ +  +    I+G+VR
Sbjct: 17  FTLDLENAGDVVARENLLDQAMGTDRRKKSSEKIRRGRVPAEGLALVARDRTGHIIGTVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          +   LLGP+ V   ++ KGIG  L+  ++  A+K+G   I+LVGD 
Sbjct: 77  LWNVEAGVDRETRPVEALLLGPLAVDAAHEGKGIGSALMRAAILEAKKRGHGAILLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            YY + GF A   + L++P P   +R L L L +       G++
Sbjct: 137 PYYERFGFFAEKARHLVMPGPFQRDRFLGLELKEGWLAGAAGMI 180


>gi|119489140|ref|ZP_01622046.1| hypothetical protein L8106_22596 [Lyngbya sp. PCC 8106]
 gi|119454889|gb|EAW36033.1| hypothetical protein L8106_22596 [Lyngbya sp. PCC 8106]
          Length = 175

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 61/150 (40%), Gaps = 11/150 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E  S I A+   +                ++   +    L++S +    +R+VG 
Sbjct: 1   MIIRSEAASDIQAIAEVTIAAFENLEVSNQTEQFIIETLRAAEMLTISLVAEIDERVVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P++        + +GP  V P YQ + IG  L+   +    + G Q   LVGD  Y
Sbjct: 61  IAFSPVTISDGSRDWYGIGPFSVLPEYQRQSIGTTLMQHGLSLLREMGGQGCCLVGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           Y + GF+ +P   L     V     L LPL
Sbjct: 121 YKRFGFKNIPKLIL---DGVPQEVFLALPL 147


>gi|15640675|ref|NP_230304.1| acetyltransferase, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587858|ref|ZP_01677615.1| acetyltransferase, putative [Vibrio cholerae 2740-80]
 gi|121728402|ref|ZP_01681430.1| acetyltransferase, putative [Vibrio cholerae V52]
 gi|153822521|ref|ZP_01975188.1| acetyltransferase, putative [Vibrio cholerae B33]
 gi|227080836|ref|YP_002809387.1| putative acetyltransferase [Vibrio cholerae M66-2]
 gi|229505723|ref|ZP_04395233.1| acetyltransferase [Vibrio cholerae BX 330286]
 gi|229509244|ref|ZP_04398729.1| acetyltransferase [Vibrio cholerae B33]
 gi|229519548|ref|ZP_04408991.1| acetyltransferase [Vibrio cholerae RC9]
 gi|229520946|ref|ZP_04410368.1| acetyltransferase [Vibrio cholerae TM 11079-80]
 gi|229525308|ref|ZP_04414713.1| acetyltransferase [Vibrio cholerae bv. albensis VL426]
 gi|229608834|ref|YP_002879482.1| acetyltransferase [Vibrio cholerae MJ-1236]
 gi|254226537|ref|ZP_04920120.1| acetyltransferase, putative [Vibrio cholerae V51]
 gi|254291895|ref|ZP_04962677.1| acetyltransferase, putative [Vibrio cholerae AM-19226]
 gi|254850889|ref|ZP_05240239.1| acetyltransferase [Vibrio cholerae MO10]
 gi|298500771|ref|ZP_07010574.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655092|gb|AAF93821.1| acetyltransferase, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547894|gb|EAX57978.1| acetyltransferase, putative [Vibrio cholerae 2740-80]
 gi|121629336|gb|EAX61768.1| acetyltransferase, putative [Vibrio cholerae V52]
 gi|125620941|gb|EAZ49292.1| acetyltransferase, putative [Vibrio cholerae V51]
 gi|126519939|gb|EAZ77162.1| acetyltransferase, putative [Vibrio cholerae B33]
 gi|150422181|gb|EDN14146.1| acetyltransferase, putative [Vibrio cholerae AM-19226]
 gi|227008724|gb|ACP04936.1| putative acetyltransferase [Vibrio cholerae M66-2]
 gi|227012480|gb|ACP08690.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|229338889|gb|EEO03906.1| acetyltransferase [Vibrio cholerae bv. albensis VL426]
 gi|229342179|gb|EEO07175.1| acetyltransferase [Vibrio cholerae TM 11079-80]
 gi|229344237|gb|EEO09212.1| acetyltransferase [Vibrio cholerae RC9]
 gi|229353816|gb|EEO18752.1| acetyltransferase [Vibrio cholerae B33]
 gi|229357946|gb|EEO22863.1| acetyltransferase [Vibrio cholerae BX 330286]
 gi|229371489|gb|ACQ61912.1| acetyltransferase [Vibrio cholerae MJ-1236]
 gi|254846594|gb|EET25008.1| acetyltransferase [Vibrio cholerae MO10]
 gi|297540552|gb|EFH76610.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 183

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 8/174 (4%)

Query: 24  RSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           + R        L R E  + I     +  + F       A +++  +     +LS +  +
Sbjct: 7   KRRIHPTRLLMLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACD 64

Query: 81  G-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               IVG V  +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    
Sbjct: 65  DEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPAC 124

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           V++GD AYYS+ GF+     SL     V       + L +       G++   +
Sbjct: 125 VVLGDPAYYSRFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYSQ 178


>gi|89894076|ref|YP_517563.1| hypothetical protein DSY1330 [Desulfitobacterium hafniense Y51]
 gi|89333524|dbj|BAE83119.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 169

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAV--------LLREQGMHDLSLSFLCAEGKRIV 85
            L R E       ++         +  +          LR  G     LS +     RI 
Sbjct: 1   MLIRQETKEDYAQIYDLVKTAFSTIEHSDGNEQNLVTALRNSGAFVPGLSLVAEIDGRIA 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   + + T  +L P+ V P YQ +GIG  LI+    AA++ G Q  +++G   Y
Sbjct: 61  GHIMFTEGKVGQDTVLILAPLSVLPEYQQQGIGTALIAEGHKAAQELGYQYSLVLGSEQY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G++      + +P  +     + + L +N  + IKG V   +
Sbjct: 121 YPRSGYRPARGLGIEVPVGMPDENFMAIKLQENA-KPIKGAVTYAK 165


>gi|197106340|ref|YP_002131717.1| acetyltransferase, GNAT family [Phenylobacterium zucineum HLK1]
 gi|196479760|gb|ACG79288.1| acetyltransferase, GNAT family [Phenylobacterium zucineum HLK1]
          Length = 166

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/156 (32%), Positives = 77/156 (49%), Gaps = 8/156 (5%)

Query: 38  LEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
            E  +    I A+   +FGPGR  +++  +RE       LSF   E  R+ G VRM  ++
Sbjct: 16  PEDPADAALIEALLDRAFGPGRLAKSSERVREFADFAPELSFCAREDGRLAGVVRMWRVN 75

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           + +     LGP+ V P  Q+ G+G  L+  +  AA+  G   ++LVGD  Y+++ GF+  
Sbjct: 76  VGETPVVFLGPLAVEPELQSGGVGGLLVQRACAAAKAAGEAAVLLVGDPPYFARFGFEGA 135

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           P    ++P PVD  RVL L           G VR R
Sbjct: 136 PDA--VMPGPVDRARVLALRFADVAL---SGPVRPR 166


>gi|153829158|ref|ZP_01981825.1| putative acetyltransferase [Vibrio cholerae 623-39]
 gi|229512916|ref|ZP_04402383.1| acetyltransferase [Vibrio cholerae TMA 21]
 gi|148875347|gb|EDL73482.1| putative acetyltransferase [Vibrio cholerae 623-39]
 gi|229350165|gb|EEO15118.1| acetyltransferase [Vibrio cholerae TMA 21]
          Length = 183

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 8/173 (4%)

Query: 24  RSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           + R        L R E  + I     +  + F       A +++  +     +LS +  +
Sbjct: 7   KRRIHPTRLLMLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACD 64

Query: 81  G-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               IVG V  +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    
Sbjct: 65  DEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPAC 124

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           V++GD AYYS+ GF+     SL     V       + L +       G++   
Sbjct: 125 VVLGDPAYYSRFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYS 177


>gi|15891735|ref|NP_357407.1| acetyltransferase [Agrobacterium tumefaciens str. C58]
 gi|15160199|gb|AAK90192.1| acetyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 189

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 10/164 (6%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F    E+   + A   +   + G GR  +++  LR   +    L+ +  +    ++ +VR
Sbjct: 17  FHVDQENPGDVVARENLLDRAMGAGRRRKSSEKLRAGRVPAEGLALVARDEDGHVIATVR 76

Query: 90  MTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  +          +   LLGP+ V   ++ KGIG  L+  ++  A K+G   I+LVGD 
Sbjct: 77  LWNVEAGISREGRPVEALLLGPLAVDAAHEGKGIGSALMRAAIGEATKRGHGAILLVGDA 136

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
            YY + GF A   + LI+P P + NR L L L     +   G++
Sbjct: 137 PYYERFGFFADKAQHLIMPGPFERNRFLALELKAGWLEGAAGLL 180


>gi|319947915|ref|ZP_08022098.1| putative acetyltransferase [Dietzia cinnamea P4]
 gi|319438424|gb|EFV93361.1| putative acetyltransferase [Dietzia cinnamea P4]
          Length = 169

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 60/160 (37%), Gaps = 6/160 (3%)

Query: 35  LERLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMHDL---SLSFLCA-EGKRIVGSVR 89
             R E D+ I A+             A ++   +         LS + A      VG   
Sbjct: 5   TTRAETDADIPAIRDIILRAFPTAAEADLVDALRADPAACIDGLSLVAATADGHPVGHAL 64

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   +       L P  V P +Q  G G   I   + AA + G +++V++G   YY + 
Sbjct: 65  LTRCHVGDEPTLALAPCSVLPEFQRTGAGSAAIRAVLTAAREAGEKLVVVLGHAGYYPRF 124

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF+      +     V    ++ LPL  +     +G++R 
Sbjct: 125 GFRRASGFGIRASFDVPDEALMALPL-DDSPAVPEGVIRY 163


>gi|118593253|ref|ZP_01550638.1| GCN5-related N-acetyltransferase [Stappia aggregata IAM 12614]
 gi|118434144|gb|EAV40800.1| GCN5-related N-acetyltransferase [Stappia aggregata IAM 12614]
          Length = 183

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 72/151 (47%), Gaps = 2/151 (1%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI-SIE 96
            +H  +   +    FG  RF + +  LRE  +   + S    E  ++VG+VR+  +    
Sbjct: 9   PDHTGAREGLLDLCFGEDRFRKTSERLREGRLPVFAFS-AIDESGKLVGTVRLWSVADRN 67

Query: 97  KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                LLGP+ V P  +   +G +L+  +++ A   G   ++LVGD  YY++ GF A   
Sbjct: 68  SSQSLLLGPLAVDPGCRGLKVGDRLMRHALNQAAMHGHGSVILVGDQPYYARFGFVAGLL 127

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             + LP PVD +R L L         ++G++
Sbjct: 128 DKVGLPGPVDDHRFLALEFASGHIAGLEGVL 158


>gi|219668487|ref|YP_002458922.1| GCN5-related N-acetyltransferase [Desulfitobacterium hafniense
           DCB-2]
 gi|219538747|gb|ACL20486.1| GCN5-related N-acetyltransferase [Desulfitobacterium hafniense
           DCB-2]
          Length = 169

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAV--------LLREQGMHDLSLSFLCAEGKRIV 85
            L R E       ++         +  +          LR  G     LS +     RI 
Sbjct: 1   MLIRQETKEDYAQIYDLVKTAFSTIEHSDGNEQNLVTALRNSGAFVPGLSLVAEIDGRIA 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   + + T  +L P+ V P YQ +GIG  LI+    AA+  G Q  +++G   Y
Sbjct: 61  GHIMFTEGKVGQDTVLILAPLSVLPEYQQQGIGTALIAEGHKAAQALGYQYSLVLGSEQY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G++      + +P  +     + + L +N  + IKG V   +
Sbjct: 121 YPRSGYRPARGLGIEVPVGMPDENFMAIKLQENA-KPIKGAVTYAK 165


>gi|87121568|ref|ZP_01077456.1| acetyltransferase [Marinomonas sp. MED121]
 gi|86163100|gb|EAQ64377.1| acetyltransferase [Marinomonas sp. MED121]
          Length = 169

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query: 34  FLERLEHDSSICAMHADSFG---------PG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
              R E+ +   A+ A ++          PG +     ++   +    L+LS +    + 
Sbjct: 1   MKIRFENAADYKAIEAITYQAFENHPHHEPGAKPSEHLIVNGLRNSGALTLSLVAENERG 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           I+G +  +P+ I     +   LGP+ V P YQ KG+G +LI   ++    +G+Q +VL+G
Sbjct: 61  IIGHIAFSPVKIAGEASSWFGLGPVSVKPEYQGKGVGSQLILNGLNELASQGAQGVVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +  YY++ GF+A    +L   A V     L   L  +      G V   +
Sbjct: 121 EPEYYARFGFKAESELTL---AGVPAQYFLVKALTSSPL--PMGEVSYHQ 165


>gi|221068282|ref|ZP_03544387.1| GCN5-related N-acetyltransferase [Comamonas testosteroni KF-1]
 gi|220713305|gb|EED68673.1| GCN5-related N-acetyltransferase [Comamonas testosteroni KF-1]
          Length = 166

 Score =  123 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E  +   A+   +    R           ++   +    L+LS +      +VG 
Sbjct: 1   MHIRTELPADAEAVEQVTILAFRHAPHSEHTEQFIVRALREAGALALSLVAEIDGLVVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P++          LGPI V P  Q +GIG  L+  ++ A + + +Q  VL+GD  Y
Sbjct: 61  VAVSPVTISDGSQHWFGLGPISVLPEKQQQGIGSALMRTAISALQAQSAQGCVLLGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+AVP   L+LP  V       L     + Q 
Sbjct: 121 YRRFGFRAVP--GLVLPG-VPAEYFQALSFAGPLPQG 154


>gi|159904652|ref|YP_001548314.1| GCN5-like N-acetyltransferase [Methanococcus maripaludis C6]
 gi|159886145|gb|ABX01082.1| GCN5-related N-acetyltransferase [Methanococcus maripaludis C6]
          Length = 202

 Score =  123 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 13/168 (7%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                RLE  S    +   +       + PG         LR+  +    L F+  EG+ 
Sbjct: 1   MNITIRLEDKSDFKTVENITREAFWDVYQPGCEEHLVLHKLRKTDVFIKELDFVALEGET 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG++  +       + EK     +GPI V P YQ KGIG  L++ S+  A K     I+
Sbjct: 61  IVGNIVYSIADVINKNNEKFKILCMGPISVLPNYQGKGIGTLLMNHSIKVARKLRYPGII 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
           + G+  YY + GF+      +      +    + L L +    +I G 
Sbjct: 121 IFGNPNYYHRFGFKNAKNYDIQTSEGENFEEFMALELNKGSLDDISGK 168


>gi|332653191|ref|ZP_08418936.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
 gi|332518337|gb|EGJ47940.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
          Length = 170

 Score =  123 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 59/165 (35%), Gaps = 9/165 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +    +++           A          LR+       LS +     +IV
Sbjct: 1   MHIRKEISTDYETVYSVVKRAFESAEHADGNEQDLVNALRKGDAFIPELSLVAEVDGKIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T  +++  T   L P+   P  Q KGIG+ LI      A++ G    +++G   Y
Sbjct: 61  GHIMFTKATVDGKTVLALAPLSALPECQRKGIGKALIREGHKIAKELGYTYSIVLGSEKY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y K G+       +  P  V     +   LV+     I G ++  
Sbjct: 121 YPKSGYSPAEGFGIKAPFDVPNENFMACKLVETDVT-IHGTIKYA 164


>gi|254523770|ref|ZP_05135825.1| acetyltransferase, gnat family [Stenotrophomonas sp. SKA14]
 gi|330824209|ref|YP_004387512.1| GCN5-like N-acetyltransferase [Alicycliphilus denitrificans K601]
 gi|219721361|gb|EED39886.1| acetyltransferase, gnat family [Stenotrophomonas sp. SKA14]
 gi|321116521|dbj|BAJ72220.1| hypothetical protein [Acidovorax sp. KKS102]
 gi|329309581|gb|AEB83996.1| GCN5-related N-acetyltransferase [Alicycliphilus denitrificans
           K601]
          Length = 176

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/163 (27%), Positives = 71/163 (43%), Gaps = 15/163 (9%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    I A+ A +                ++   +  ++L+LS +  E  R+VG 
Sbjct: 7   IQLRHETADDIAAIEAVTTAAFADAPHTSHTEQFIVRALRAANELTLSIVAEEHGRVVGH 66

Query: 88  VRMTPISIEKIT------GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           V ++P++I           + LGPI V P  Q +GIG +L+  ++       +   VL+G
Sbjct: 67  VALSPVTITHEHRRKTEGWYGLGPISVLPPRQGRGIGSRLMEQALSELRAMQAAGCVLLG 126

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           D  YY++ GFQA     L LP  V P   + L L   V + I 
Sbjct: 127 DPTYYTRFGFQA--HAGLQLPG-VPPGYFMALALHGTVPEGIA 166


>gi|145295375|ref|YP_001138196.1| hypothetical protein cgR_1313 [Corynebacterium glutamicum R]
 gi|140845295|dbj|BAF54294.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 168

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 13/165 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAEGKRIVGS 87
           F  R E    I A+H  +      +  +      ++ + +    LSLS +      ++G 
Sbjct: 4   FHIRAEQSHDISAIHDVTEAAFTGIEHSDGTEQDLVDKLRAAKALSLSLVAEADGEVIGH 63

Query: 88  VRMTPISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  + + I         +GP+ V P  Q +G+G  L+  ++D    +G+  +VL+GD  Y
Sbjct: 64  IAASEVLIGGGAQGWFGIGPVSVRPDKQQQGVGIALMGSALDQLRAEGAGGVVLLGDPGY 123

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF+ VP   L+ P        + + L  N     +G+V+  
Sbjct: 124 YRRFGFEVVP--GLVYP-DAPAEFFMAVCL--NAPAFPQGVVKYH 163


>gi|16800914|ref|NP_471182.1| hypothetical protein lin1847 [Listeria innocua Clip11262]
 gi|16414349|emb|CAC97078.1| lin1847 [Listeria innocua Clip11262]
          Length = 172

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R+   +   LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIQNIRKSDYYQPGLSLVAETEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ K +G  L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLETAGRSRFILGLAPLAVLPEYQGKRVGSSLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSNQFAIPAPFDVPSEYFMLLELYDGSLENLAGTIHY 164


>gi|117617763|ref|YP_857759.1| acetyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117559170|gb|ABK36118.1| acetyltransferase, GNAT family [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 167

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 60/152 (39%), Gaps = 11/152 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R E  +   A+ A +                ++   +    LSLS +     R+V
Sbjct: 1   MNILIRPETGADHDAIEALTVAAFLNAPHTDHNEQRIVRDLRQAGALSLSLVAELEGRVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++        + LGPI V P    KG+G +L+   +   +  G+   V++G+ 
Sbjct: 61  GHLCFSPVTISDGSPHWYGLGPISVSPALHGKGLGSRLMDAGLAELKGMGAAGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
            +Y + GF + P   L LP  V     +    
Sbjct: 121 GFYGRFGFVSEP--GLALPG-VPAEYFMARSF 149


>gi|125622945|ref|YP_001031428.1| GNAT family acetyltransferase [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124491753|emb|CAL96672.1| putative acetyltransferase, GNAT family [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300069685|gb|ADJ59085.1| GNAT family acetyltransferase [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 173

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 64/166 (38%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
              LE    +  +  +SF     G G        +R +  +   L  +  E  +I G   
Sbjct: 5   TINLEDYKEVAELIRESFSQSEHGYGNEAELVDKIRNEEGYIKDLEIVAFEDGKITGHGL 64

Query: 90  MTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++ +SI    +   G +L P+ V P YQ KGIG  ++      A+      I ++G  +Y
Sbjct: 65  LSEVSIVNQSQSFKGLVLAPLDVLPAYQGKGIGAAILLELEKRAKILDYSFISILGHESY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       +  P  V     +   L+    +   G+++  E
Sbjct: 125 YPRFGYVPASQYQIQAPFEVPDQNFMIKELIDGRLEGKSGVIQYSE 170


>gi|315179233|gb|ADT86147.1| hypothetical acetyltransferase [Vibrio furnissii NCTC 11218]
          Length = 168

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 64/162 (39%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    +VG   
Sbjct: 1   MLIRTEAPADILAVDRLLKTVF--DTDAEANLVMALRENSHRTLSLVACDDEGEVVGHAM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V   ++++G+G +L++  + +  + G    V++G+  YY+
Sbjct: 59  FSPVLLNGEDLNWQGLAPLAVKAEFRHQGLGSELVNEGLASLGELGYPACVVLGNPDYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF +           V  +    + L  +      G ++ 
Sbjct: 119 RFGFTSAEKHGFHCQWDVPADAFQIVALWDDELTGRSGEIQY 160


>gi|107100178|ref|ZP_01364096.1| hypothetical protein PaerPA_01001200 [Pseudomonas aeruginosa PACS2]
          Length = 168

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIEAIARLTEAAFRNETHSSHTEQYIIDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPERQRQGLGSQLVRRLLAELRMLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+      L LP  V             +A+ I
Sbjct: 121 TYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMARGI 157


>gi|146300005|ref|YP_001194596.1| GCN5-related N-acetyltransferase [Flavobacterium johnsoniae UW101]
 gi|146154423|gb|ABQ05277.1| GCN5-related N-acetyltransferase [Flavobacterium johnsoniae UW101]
          Length = 176

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 12/173 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKR 83
              L R E+ +   ++        +    +          LR+  +    LS +     +
Sbjct: 1   MKVLIRQENRNDYKSVFELIEKAFKNQEYSDHKEQFLVERLRKSEVFIPQLSIVAEVDGQ 60

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG +  T + I           L P+ V P +Q K IG KLI    + AE+ G + ++L
Sbjct: 61  IVGHILFTKLQIVNELSVFESLTLAPVSVLPEFQGKEIGSKLILYGHEQAERLGYKSVIL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           +G   YY + G+Q     ++ +P  V     + +PLV++  + + G +   +V
Sbjct: 121 LGHEDYYPRFGYQRCEKYNIKMPFDVPAENCMVVPLVKDGLKEVYGKIVYPDV 173


>gi|227508073|ref|ZP_03938122.1| GNAT family acetyltransferase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227192302|gb|EEI72369.1| GNAT family acetyltransferase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 174

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 63/168 (37%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHADSF--------GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R        A+             G G        +R    +  +L  +  +  +I+
Sbjct: 1   MQIRTVRKEDYSAISDLILTAFSKSSNGYGGEAELVEKIRLDPTYHKTLEVVADQSGQII 60

Query: 86  GSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ +      +  TG  L P+ V P +Q +GIG+ +++     A++     I ++G
Sbjct: 61  GHGLLSEVQVKNANQSKTGLCLAPLEVSPSFQKQGIGQAILAELEQRAKRAKYNFISILG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
              YYS+ G++     ++  P P   +  +   LV    + + G V  
Sbjct: 121 WPDYYSRFGYKKASLFNIKAPFPAPDDAYMIKALVPKGLEGVTGTVNY 168


>gi|229530461|ref|ZP_04419849.1| acetyltransferase [Vibrio cholerae 12129(1)]
 gi|229332234|gb|EEN97722.1| acetyltransferase [Vibrio cholerae 12129(1)]
          Length = 183

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 8/174 (4%)

Query: 24  RSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           + R        L R E  + I     +  + F       A +++  +     +LS +  +
Sbjct: 7   KRRIHPTRLLMLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACD 64

Query: 81  G-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               IVG V  +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    
Sbjct: 65  DEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPAC 124

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           V++GD AYYS+ GF+     SL     V       + L +       G++   +
Sbjct: 125 VVLGDPAYYSRFGFEDAARYSLRCAWDVPLGAFQVVALWERELDGRCGVIEYSQ 178


>gi|163868810|ref|YP_001610034.1| hypothetical protein Btr_1748 [Bartonella tribocorum CIP 105476]
 gi|161018481|emb|CAK02039.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 194

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/166 (27%), Positives = 74/166 (44%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F   LE ++       +   + G GR  +++  LR   +    LSF+       +VGSVR
Sbjct: 14  FTLLLEQEADKPYREILLDATMGRGRKRKSSEALRRGRLAAQGLSFVVKNALGELVGSVR 73

Query: 90  MTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +  +       E     LLGP+ V       GIG  L+  +++ A+K G   I+LVGD  
Sbjct: 74  LWHVAFLKEKNETQHALLLGPLAVAAECAGMGIGSILVRHAIETAKKLGYGAILLVGDFE 133

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +Y + GF     ++L +P P + +R   L L+ +      G +  R
Sbjct: 134 FYQRFGFSNRLTENLAMPGPYEKHRFQALELIPHYLSGCYGTLVAR 179


>gi|116510879|ref|YP_808095.1| acetyltransferase [Lactococcus lactis subsp. cremoris SK11]
 gi|116106533|gb|ABJ71673.1| Predicted acetyltransferase [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 173

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 64/166 (38%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
              LE    +  +  +SF     G G        +R +  +   L  +  E  +I G   
Sbjct: 5   TINLEDYKEVAELIRESFSQSEHGYGNEAELVDKIRNEEGYIKDLEIVAFEDGKITGHGL 64

Query: 90  MTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++ +SI    +   G +L P+ V P YQ KGIG  ++      A+      I ++G  +Y
Sbjct: 65  LSEVSIVNQSQSFKGLVLAPLDVLPAYQGKGIGAAILLELEKRAKILDYSFISILGHESY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       +  P  V     +   L+    +   G+++  E
Sbjct: 125 YPRFGYVPASQYQIQAPFEVPNENFMIKELIDGRLEGKSGVIQYSE 170


>gi|289435072|ref|YP_003464944.1| acetyltransferase, GNAT family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289171316|emb|CBH27858.1| acetyltransferase, GNAT family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 172

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 8/166 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E       I  ++  +F           +R+   +   LS +   E   +VG + 
Sbjct: 1   MIIRTEQPKDFQAIRQVNEAAFKGSVEADLIENIRQSDYYQPGLSLVAEAEDGSVVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P +Q + IG +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLETENKSRFILGLAPLAVLPEFQKQRIGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF +    ++  P  V     + L L     +N++GI+   E
Sbjct: 121 YPRFGFISSEAFNIPAPFDVPAEYYMLLELYDASLENLQGIIHYPE 166


>gi|290893393|ref|ZP_06556378.1| acetyltransferase [Listeria monocytogenes FSL J2-071]
 gi|290557044|gb|EFD90573.1| acetyltransferase [Listeria monocytogenes FSL J2-071]
          Length = 172

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRSVNEEAFKGTVEADLIESIRRSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|310827042|ref|YP_003959399.1| GCN5-related N-acetyltransferase [Eubacterium limosum KIST612]
 gi|308738776|gb|ADO36436.1| GCN5-related N-acetyltransferase [Eubacterium limosum KIST612]
          Length = 169

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
            + R E +     ++A           +          LR+ G     LS +  +  RIV
Sbjct: 1   MVIRQETEKDYDEVYAVVKAAFERAEHSDGNEQDLVAALRKGGAFVPELSLVAQKDGRIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G + +T  S+      +L P+ V P  Q++GIG  L+     AAE  G   I ++G   Y
Sbjct: 61  GHILLTKGSVGSRDVLVLAPLSVLPENQSQGIGSALMEAGRQAAEALGYDYITVLGSEDY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       +  P  V P   + L L ++    + G++R   
Sbjct: 121 YPRAGYIPAEQLGIRAPFEVPPENFMALRLREDA-GPVSGVLRYAA 165


>gi|152972080|ref|YP_001337226.1| hypothetical protein KPN_03564 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238896663|ref|YP_002921408.1| hypothetical protein KP1_4870 [Klebsiella pneumoniae NTUH-K2044]
 gi|329997859|ref|ZP_08302929.1| acetyltransferase, GNAT family [Klebsiella sp. MS 92-3]
 gi|150956929|gb|ABR78959.1| hypothetical protein KPN_03564 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238548990|dbj|BAH65341.1| hypothetical protein KP1_4870 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|328538894|gb|EGF64958.1| acetyltransferase, GNAT family [Klebsiella sp. MS 92-3]
          Length = 167

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++   +    ++L  +  +   +++G V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRTF--GRDAEAQLVHDLREDGLITLGVVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIGR+L+   +D+  + G   +V +GD   Y 
Sbjct: 59  FSPVAVEGEELQWVGLAPLAVDERYRGQGIGRQLVYEGLDSLNEFGYAAVVTLGDPDLYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P          L  +    + G V   E
Sbjct: 119 RFGFEPAARFDLRCRWPDSAEAFQVHRLADDALDGVHGQVEYSE 162


>gi|114799412|ref|YP_759066.1| acetyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|114739586|gb|ABI77711.1| acetyltransferase, GNAT family [Hyphomonas neptunium ATCC 15444]
          Length = 163

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP--ISIEK 97
           H  +I A+   +FGPG F + A  LRE      +++ +     +++G  R+ P  +   +
Sbjct: 12  HAEAIEALFDATFGPGHFAKTAERLRENSRSLPAINRVALNDGKVIGVCRVWPLAVGPSR 71

Query: 98  ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWK 157
                 GP+ V P Y+   +  ++   +++A  + G    +L+G  + + K+GF   P  
Sbjct: 72  SPALFYGPVAVDPAYRGNFLSLQITQAALEAGREAGWPAAILIGAHSLFGKVGFTVAPKG 131

Query: 158 SLILPAPVDPNRVLFLPLVQNV--AQNI 183
            L  P P D  RV+ + L  +    + +
Sbjct: 132 RLTFPGPQDGARVMVMDLAGDASLLEGL 159


>gi|156935680|ref|YP_001439596.1| hypothetical protein ESA_03546 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533934|gb|ABU78760.1| hypothetical protein ESA_03546 [Cronobacter sakazakii ATCC BAA-894]
          Length = 167

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRAF--GRADEAELVHALREDGLLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIGR+L+   +D+  + G   +V +G   +Y+
Sbjct: 59  FSPVTVAGEERQWLGLAPLAVDEEWRGQGIGRQLVYEGLDSLNEFGYAAVVTLGAPEFYN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P          L  +    + G V   E
Sbjct: 119 RLGFEPAARYDLHCRWPGAEAAFQVHRLADDALDGVHGPVDYHE 162


>gi|297580781|ref|ZP_06942707.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535197|gb|EFH74032.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 183

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 8/173 (4%)

Query: 24  RSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           + R        L R E  + I     +  + F       A +++  +     +LS +  +
Sbjct: 7   KRRIHPTRLLMLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACD 64

Query: 81  G-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               IVG V  +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    
Sbjct: 65  DEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPAC 124

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           V++GD AYYS+ GF+     SL     V       + L +       G++   
Sbjct: 125 VVLGDPAYYSRFGFEDAARYSLRCAWDVPLGAFQVVALWERELDGRCGVIEYS 177


>gi|313632865|gb|EFR99813.1| acetyltransferase [Listeria seeligeri FSL N1-067]
          Length = 172

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 8/166 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E       I  ++  +F           +R+   +   LS +   E   +VG + 
Sbjct: 1   MIIRTEQPKDFQAIRQLNEAAFKGSVEADLIENIRQSDYYQPGLSLVAEAEDGLVVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P +Q + IG +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLETENKNRFILGLAPLAVLPEFQKQRIGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF +    ++  P  V     + L L     +N++GI+   E
Sbjct: 121 YPRFGFISSEAFNIPAPFDVPAEYYMLLELYDASLENLQGIIHYPE 166


>gi|206578216|ref|YP_002236434.1| acetyltransferase, GNAT family [Klebsiella pneumoniae 342]
 gi|288933416|ref|YP_003437475.1| GCN5-related N-acetyltransferase [Klebsiella variicola At-22]
 gi|290511533|ref|ZP_06550902.1| acetyltransferase [Klebsiella sp. 1_1_55]
 gi|206567274|gb|ACI09050.1| acetyltransferase, GNAT family [Klebsiella pneumoniae 342]
 gi|288888145|gb|ADC56463.1| GCN5-related N-acetyltransferase [Klebsiella variicola At-22]
 gi|289776526|gb|EFD84525.1| acetyltransferase [Klebsiella sp. 1_1_55]
          Length = 167

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++   +    ++L  +  +   +++G V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRTF--GRDAEAQLVHDLREDGLITLGVVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIGR+L+   +D+  + G   +V +GD   Y 
Sbjct: 59  FSPVAVEGEELQWVGLAPLAVDEHYRGQGIGRQLVYEGLDSLNEFGYAAVVTLGDPDLYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P          L  +  + + G V   +
Sbjct: 119 RFGFEPAARFDLRCRWPDSAEAFQVHRLADDALEGVHGQVEYSD 162


>gi|116695222|ref|YP_840798.1| acetyltransferase [Ralstonia eutropha H16]
 gi|113529721|emb|CAJ96068.1| predicted acetyltransferase [Ralstonia eutropha H16]
          Length = 168

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  S   A+   +              A V+   +    L++S +   G  +V
Sbjct: 1   MSVQIRPEAPSDADAIARLTTAAFLTAPHTSHTEAFVVNALRRAGQLTVSLVAQAGDELV 60

Query: 86  GSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+++       + LGPI V P  Q +GIG +L+  S+D   + G+   V++GD 
Sbjct: 61  GHVAISPVTVSSGATGWYGLGPISVAPDLQGQGIGSQLMRASLDQLRRLGAAGCVVLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY + GF A P   L     V P     L           G V+  +
Sbjct: 121 GYYGRFGFAARPGLVL---DGVPPEYFQALAFHGGYPA---GSVQYHD 162


>gi|221067659|ref|ZP_03543764.1| GCN5-related N-acetyltransferase [Comamonas testosteroni KF-1]
 gi|220712682|gb|EED68050.1| GCN5-related N-acetyltransferase [Comamonas testosteroni KF-1]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 71/165 (43%), Gaps = 15/165 (9%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  + I A+ A +                ++   +   +L+LS +  E  ++V
Sbjct: 37  MTIQLRHETTNDIAAIEAVTIAAFADAPHTSHTEQFIVRALRDASELTLSIVAEEHGQVV 96

Query: 86  GSVRMTPISIEKITGH------LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           G V ++P++I    GH       LGPI V P  Q  GIG +L+  ++       ++  VL
Sbjct: 97  GHVALSPVTITNDHGHKAKGWCGLGPISVLPQRQGHGIGSRLMEQALSELRAMQAEGCVL 156

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +G+ AYY + GFQA     L LP  V P   L L     V + I 
Sbjct: 157 LGEPAYYGRFGFQA--HAGLQLPG-VPPGYFLALAFHGPVPEGIA 198


>gi|254473099|ref|ZP_05086497.1| acetyltransferase [Pseudovibrio sp. JE062]
 gi|211957820|gb|EEA93022.1| acetyltransferase [Pseudovibrio sp. JE062]
          Length = 169

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 18/170 (10%)

Query: 34  FLERLEHDSSICAMHADSFG---------PG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
            + R E  S I  +    +          PG +     ++ + +   +LSLS +  +   
Sbjct: 1   MIIRAELPSDIEIIRDLVYAAFENHPHHEPGAKPTEHLIVDQLRENGELSLSLIAGQAGG 60

Query: 84  IVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           +VG +  +P++I+      + LGP+ + P +Q KG G  LI   +    ++G++ +VL+G
Sbjct: 61  MVGHIAFSPVTIDGEDEGWYGLGPVAIVPKHQGKGFGAALIMEGMQQIRQRGAKGVVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +  YYS+ GFQ    +SL  P  V     +             G V   E
Sbjct: 121 EPKYYSRFGFQQA--ESLTFPG-VPAEYFMQHTFEGETP---TGTVAYSE 164


>gi|227523278|ref|ZP_03953327.1| GNAT family acetyltransferase [Lactobacillus hilgardii ATCC 8290]
 gi|227089558|gb|EEI24870.1| GNAT family acetyltransferase [Lactobacillus hilgardii ATCC 8290]
          Length = 174

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 63/168 (37%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHADSF--------GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R        A+             G G        +R    +  +L  +  +  +I+
Sbjct: 1   MQIRTVRKEDYSAISDLILTAFSKSSNGYGGEAELVEKIRLDPTYHKTLEVVADQSGQII 60

Query: 86  GSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ +      +  TG  L P+ V P +Q +GIG+ +++     A++     I ++G
Sbjct: 61  GHGLLSEVQVKNANKSKTGLCLAPLEVSPSFQKQGIGQAILAELEQRAKRAKYNFISILG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
              YYS+ G++     ++  P P   +  +   LV    + + G V  
Sbjct: 121 WPDYYSRFGYKKASLFNIKAPFPAPDDAYMIKALVPKGLEGVTGTVNY 168


>gi|254239088|ref|ZP_04932411.1| hypothetical protein PACG_05270 [Pseudomonas aeruginosa C3719]
 gi|126171019|gb|EAZ56530.1| hypothetical protein PACG_05270 [Pseudomonas aeruginosa C3719]
          Length = 168

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 60/160 (37%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIDAIARLTEAAFRNETHSSHTEQYIIDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPERQRQGLGSQLVRRLLAELRMLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS  GF+      L LP  V             +AQ I
Sbjct: 121 TYYSHFGFRV--ESGLALPG-VPAEYFQAQSFSGRMAQGI 157


>gi|153826537|ref|ZP_01979204.1| acetyltransferase, putative [Vibrio cholerae MZO-2]
 gi|149739717|gb|EDM53924.1| acetyltransferase, putative [Vibrio cholerae MZO-2]
          Length = 183

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 8/173 (4%)

Query: 24  RSRWQKIGAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE 80
           + R        L R E  + I     +  + F       A +++  +     +LS +  +
Sbjct: 7   KRRIHPTRLLMLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACD 64

Query: 81  G-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               IVG V  +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    
Sbjct: 65  DEGEIVGHVMFSPVTLEDEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPAC 124

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           V++GD AYYS+ GF+     SL     V       + L +       G++   
Sbjct: 125 VVLGDPAYYSRFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYS 177


>gi|94311963|ref|YP_585173.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
 gi|160898172|ref|YP_001563754.1| GCN5-like N-acetyltransferase [Delftia acidovorans SPH-1]
 gi|93355815|gb|ABF09904.1| GCN5-related N-acetyltransferase, GNAT family [Cupriavidus
           metallidurans CH34]
 gi|160363756|gb|ABX35369.1| GCN5-related N-acetyltransferase [Delftia acidovorans SPH-1]
          Length = 172

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 71/165 (43%), Gaps = 15/165 (9%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  + I A+ A +                ++   +   +L+LS +  E  ++V
Sbjct: 1   MTIQLRHETTNDIAAIEAVTIAAFADAPHTSHTEQFIVRALRDASELTLSIVAEEHGQVV 60

Query: 86  GSVRMTPISIEKITGH------LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           G V ++P++I    GH       LGPI V P  Q  GIG +L+  ++       ++  VL
Sbjct: 61  GHVALSPVTITNDHGHKAKGWCGLGPISVLPQRQGHGIGSRLMEQALSELRAMQAEGCVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +G+ AYY + GFQA     L LP  V P   L L     V + I 
Sbjct: 121 LGEPAYYGRFGFQA--HAGLQLPG-VPPGYFLALAFHGPVPEGIA 162


>gi|94310191|ref|YP_583401.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
 gi|93354043|gb|ABF08132.1| GCN5-related N-acetyltransferase, GNAT family [Cupriavidus
           metallidurans CH34]
          Length = 172

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 71/165 (43%), Gaps = 15/165 (9%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+ A +                ++   +  ++L+LS +  E  R+V
Sbjct: 1   MTLQLRHETPDDIAAIEAVTIAAFADAPHTSHTEQFIVRALRAANELTLSIVAEEHGRVV 60

Query: 86  GSVRMTPISIEKIT------GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           G V ++P++I           + LGPI V P  Q +GIG +L+  ++       +   VL
Sbjct: 61  GHVALSPVTITHEHGRKTEGWYRLGPISVLPPRQGQGIGSRLMEQALSELRAMQAAGCVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +GD  YY++ GFQA     L LP  V P   + L L   V + I 
Sbjct: 121 LGDPTYYTRFGFQA--HAGLQLPG-VPPGYFMALALHGTVPEGIA 162


>gi|260596215|ref|YP_003208786.1| N-acetyltransferase YhbS [Cronobacter turicensis z3032]
 gi|260215392|emb|CBA27429.1| Uncharacterized N-acetyltransferase yhbS [Cronobacter turicensis
           z3032]
          Length = 167

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRAF--GRADEAELVHALREDGLLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIGR+L+   +D+  + G   +V +G   +Y+
Sbjct: 59  FSPVTVAGEERQWLGLAPLAVDEAWRGQGIGRQLVYEGLDSLNEFGYSAVVTLGSPEFYN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P          L  +    + G V   E
Sbjct: 119 RLGFEPAARYDLHCRWPGAEAAFQVHRLADDALNGVHGPVDYHE 162


>gi|46907966|ref|YP_014355.1| acetyltransferase [Listeria monocytogenes serotype 4b str. F2365]
 gi|47092890|ref|ZP_00230672.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 4b
           H7858]
 gi|226224339|ref|YP_002758446.1| hypothetical protein Lm4b_01750 [Listeria monocytogenes Clip81459]
 gi|254826020|ref|ZP_05231021.1| acetyltransferase [Listeria monocytogenes FSL J1-194]
 gi|254853647|ref|ZP_05242995.1| acetyltransferase [Listeria monocytogenes FSL R2-503]
 gi|254932819|ref|ZP_05266178.1| acetyltransferase [Listeria monocytogenes HPB2262]
 gi|255520510|ref|ZP_05387747.1| hypothetical protein LmonocFSL_04636 [Listeria monocytogenes FSL
           J1-175]
 gi|300764650|ref|ZP_07074641.1| GNAT family acetyltransferase [Listeria monocytogenes FSL N1-017]
 gi|46881236|gb|AAT04532.1| acetyltransferase, GNAT family [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018716|gb|EAL09467.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 4b
           H7858]
 gi|225876801|emb|CAS05510.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258607025|gb|EEW19633.1| acetyltransferase [Listeria monocytogenes FSL R2-503]
 gi|293584372|gb|EFF96404.1| acetyltransferase [Listeria monocytogenes HPB2262]
 gi|293595259|gb|EFG03020.1| acetyltransferase [Listeria monocytogenes FSL J1-194]
 gi|300514536|gb|EFK41592.1| GNAT family acetyltransferase [Listeria monocytogenes FSL N1-017]
 gi|328466489|gb|EGF37632.1| hypothetical protein LM1816_07262 [Listeria monocytogenes 1816]
 gi|328473970|gb|EGF44786.1| hypothetical protein LM220_02201 [Listeria monocytogenes 220]
          Length = 172

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +   LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRTSDYYQPGLSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|319899289|ref|YP_004159384.1| Acetyltransferase [Bartonella clarridgeiae 73]
 gi|319403255|emb|CBI76814.1| Acetyltransferase [Bartonella clarridgeiae 73]
          Length = 197

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 31  GAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVG 86
           GAFF    E ++       +     G  R  +++ +LR        LSF+       +VG
Sbjct: 14  GAFFTLMSEQEADRFHREKLLDLVMGKERKRKSSEILRRGRFPAYGLSFVIKNFLDELVG 73

Query: 87  SVRMTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           SVR+  ++      E     LLGP+ V       GIG  L+  +++ A+K G   I LVG
Sbjct: 74  SVRLWNVTFHKGQNETQGALLLGPLAVSAECSGIGIGSVLMQHAIETAKKLGHGAIFLVG 133

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           D  +Y + GF +   K+  +P   + +    L L+     +  GI+
Sbjct: 134 DSQFYQRFGFSSHLTKNFAMPGSYEKHHFQALELIPQYLISCHGIL 179


>gi|295133252|ref|YP_003583928.1| acetyltransferase [Zunongwangia profunda SM-A87]
 gi|294981267|gb|ADF51732.1| probable acetyltransferase [Zunongwangia profunda SM-A87]
          Length = 176

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 67/172 (38%), Gaps = 12/172 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQG--MHDLSLSFLCAEGKR 83
                R E       + +                  ++ R +        LS +     +
Sbjct: 1   MEVHIRQEKPEDHEDVFSLIEAAFLHESNSDHQEQFLVDRIRKSYAFIPELSLVAEVDNK 60

Query: 84  IVGSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +VG V ++ I+I     K     L P+ V P +Q+KGIG KL+  +   A +   +++++
Sbjct: 61  LVGYVLLSEITIQNDKNKFPALALAPVAVLPEFQSKGIGSKLLKQAHQKARELDYKLVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +G   YY +  ++      +  P  V     +   LV + A++I GIV   E
Sbjct: 121 LGHEEYYPRFEYEPAINFDIQAPFEVPKKNFMLKELVPDAAKHIFGIVVYPE 172


>gi|17986749|ref|NP_539383.1| acetyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|225627992|ref|ZP_03786028.1| acetyltransferase [Brucella ceti str. Cudo]
 gi|294852868|ref|ZP_06793541.1| acetyltransferase [Brucella sp. NVSL 07-0026]
 gi|17982376|gb|AAL51647.1| acetyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|225617155|gb|EEH14201.1| acetyltransferase [Brucella ceti str. Cudo]
 gi|294821457|gb|EFG38456.1| acetyltransferase [Brucella sp. NVSL 07-0026]
          Length = 169

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 65/162 (40%), Gaps = 11/162 (6%)

Query: 29  KIGAFFLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGK 82
             G     R E       +   +    R V         ++   +    L+LS +  E  
Sbjct: 1   MKGGRMHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDG 60

Query: 83  RIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +++G +  +P+ I       + LGP+ V P  Q +GIG KLI   +      G++  VL+
Sbjct: 61  QVLGHIAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLL 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           GD+ YY + GF+A   + L     V P     L    ++ Q 
Sbjct: 121 GDLGYYGRFGFKADARQKL---PGVPPEYFQCLAFGPDMPQG 159


>gi|260771161|ref|ZP_05880088.1| predicted acetyltransferase [Vibrio furnissii CIP 102972]
 gi|260613758|gb|EEX38950.1| predicted acetyltransferase [Vibrio furnissii CIP 102972]
          Length = 168

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 64/162 (39%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    +VG   
Sbjct: 1   MLIRTEAPADILAVDRLLKTVF--DTDAEANLVMALRENSHRTLSLVACDDEGEVVGHAM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V   ++++G+G +L++  + +  + G    V++G+  YY+
Sbjct: 59  FSPVLLNGEDLNWQGLAPLAVKAEFRHQGLGGELVNEGLASLGELGYPACVVLGNPDYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF +           V  +    + L  +      G ++ 
Sbjct: 119 RFGFTSAEKHGFHCQWDVPADAFQIVALWDDELTGRSGEIQY 160


>gi|78188574|ref|YP_378912.1| acetyltransferase [Chlorobium chlorochromatii CaD3]
 gi|78170773|gb|ABB27869.1| acetyltransferase, GNAT family [Chlorobium chlorochromatii CaD3]
          Length = 173

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 69/172 (40%), Gaps = 14/172 (8%)

Query: 28  QKIGAFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEG 81
           + +    + R E ++ I A+   +                ++   +    L++S +    
Sbjct: 2   KHMNPKIVIRNEANADIRAISEVTAAAFQTLEISNHTEQFIIEALRATKALTVSLVAEID 61

Query: 82  KRIVGSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
             ++G +  +P++        + LGP+ V P YQ +GIG+ LI   +   +   +Q   L
Sbjct: 62  GLVIGHIAFSPVTISDGTRNWYGLGPVSVLPAYQQQGIGKALIWEGLLRLKDMNAQGCCL 121

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           VG   YY K GF+ +P   L+    V       LP   ++ Q   G V   E
Sbjct: 122 VGHPDYYIKFGFKNLP--GLVHEG-VPLEVFFALPFDGHIPQ---GTVTFHE 167


>gi|239832433|ref|ZP_04680762.1| GCN5-related N-acetyltransferase [Ochrobactrum intermedium LMG
           3301]
 gi|239824700|gb|EEQ96268.1| GCN5-related N-acetyltransferase [Ochrobactrum intermedium LMG
           3301]
          Length = 169

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 63/162 (38%), Gaps = 11/162 (6%)

Query: 29  KIGAFFLER---LEHDSSICAMHADSFGPGRFV---RAAVLLREQGMHDLSLSFLCAEGK 82
                   R    E  + I  +  D+F            ++   +    L+LS +  E  
Sbjct: 1   MKERDMHIRNETPEDAADIRRLTDDAFRNAAHSSGKEGEIIDALRAADALTLSLVAEEDG 60

Query: 83  RIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +++G V  +P+ +       H LGP+ V P  Q +GIG KLI   +      G++  VL+
Sbjct: 61  QVLGHVAFSPVLVGGEDKGWHGLGPVSVRPDRQGEGIGGKLIREGLARLRSLGAEGCVLL 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           GD  YY + GF+A     L     V       L    ++ + 
Sbjct: 121 GDPGYYGRFGFKADERLKL---PGVPAEYFQCLAFGPDIPEG 159


>gi|306844550|ref|ZP_07477139.1| acetyltransferase [Brucella sp. BO1]
 gi|306275161|gb|EFM56917.1| acetyltransferase [Brucella sp. BO1]
          Length = 164

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 63/157 (40%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  E  +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTETAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I+      + LGP+ V P  Q +GIG KLI   +      G++  VL+GD  Y
Sbjct: 61  IGFSPVLIDGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+A     L     V P     L    ++ Q 
Sbjct: 121 YGRFGFKADARLKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|323491478|ref|ZP_08096661.1| putative acetyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323314262|gb|EGA67343.1| putative acetyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 167

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I A+      +F       A ++++ +     +LS +   +   +VG V 
Sbjct: 1   MLIRTEAPADILAVDKLLKSTF--ETEAEANLVMKLRENGRRTLSLVACNDEGEVVGYVL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ VH  Y+NKGI  +++   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLAVHQDYRNKGIAAEIVKEGLSSLLEFGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+A    ++     V       L L Q   +N  G++    
Sbjct: 119 RFGFEASEKHNMRCEWDVPQGAFQVLGLAQGELENRNGLIEYSA 162


>gi|226954166|ref|ZP_03824630.1| possible acetyltransferase [Acinetobacter sp. ATCC 27244]
 gi|226835115|gb|EEH67498.1| possible acetyltransferase [Acinetobacter sp. ATCC 27244]
          Length = 145

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADS-FGPGRF-----VRAAVLLREQGMHDLSLSFL 77
           +   +K+    + R E+ + I A+   +     R          ++   +  + L+LS +
Sbjct: 4   QDTQEKMNMNLIIRDENPTDINAIFDLTRLAFEREEYSSHTEQFIVNALRDSNQLTLSLV 63

Query: 78  CAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
                +++G +  +P+ I   T   + LGPI V P +Q K IG KLI   ++A +   + 
Sbjct: 64  AESDHQVIGHIAFSPVQISDATTGWYGLGPISVLPDFQGKDIGAKLIHAGLEALKDLDAL 123

Query: 136 VIVLVGDIAYYSKLGFQAVPW 156
             VL+GD  YY + GF+A P 
Sbjct: 124 GCVLLGDPQYYGRFGFKADPK 144


>gi|255027673|ref|ZP_05299659.1| hypothetical protein LmonocytFSL_17297 [Listeria monocytogenes FSL
           J2-003]
          Length = 172

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRTSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|47095662|ref|ZP_00233269.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 1/2a
           F6854]
 gi|254900759|ref|ZP_05260683.1| hypothetical protein LmonJ_13124 [Listeria monocytogenes J0161]
 gi|254913755|ref|ZP_05263767.1| acetyltransferase [Listeria monocytogenes J2818]
 gi|254938142|ref|ZP_05269839.1| acetyltransferase [Listeria monocytogenes F6900]
 gi|47015947|gb|EAL06873.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258610756|gb|EEW23364.1| acetyltransferase [Listeria monocytogenes F6900]
 gi|293591772|gb|EFG00107.1| acetyltransferase [Listeria monocytogenes J2818]
          Length = 172

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 61/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+      +F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNKEAFKGTVEADLIESIRTSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|152988606|ref|YP_001350141.1| acetyltransferase [Pseudomonas aeruginosa PA7]
 gi|150963764|gb|ABR85789.1| acetyltransferase, GNAT family [Pseudomonas aeruginosa PA7]
          Length = 168

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 68/167 (40%), Gaps = 14/167 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  + I A+   +    R           ++   +    L+LS +     ++ 
Sbjct: 1   MNISIRAETAADIDAIARLTEAAFRRATHASHTEQFIVAALRRAGSLTLSLVAEGNGQLF 60

Query: 86  GSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V  +P++I+      + L P+ V P +Q +GIG +LI   +      G++  V++G+ 
Sbjct: 61  GHVAASPVTIDGAPGGWYGLAPVSVEPEWQGRGIGSRLIRQLLAELRSLGAEGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           AYYS+ GF+A     L+LP  V                 ++G V   
Sbjct: 121 AYYSRFGFRA--ESGLVLPG-VPAAFFQAQSFAGAA---VRGTVAFH 161


>gi|16803776|ref|NP_465261.1| hypothetical protein lmo1736 [Listeria monocytogenes EGD-e]
 gi|217964118|ref|YP_002349795.1| acetyltransferase, gnat family [Listeria monocytogenes HCC23]
 gi|224503339|ref|ZP_03671646.1| acetyltransferase, gnat family protein [Listeria monocytogenes FSL
           R2-561]
 gi|254832439|ref|ZP_05237094.1| acetyltransferase, gnat family protein [Listeria monocytogenes
           10403S]
 gi|255029608|ref|ZP_05301559.1| acetyltransferase, gnat family protein [Listeria monocytogenes
           LO28]
 gi|16411190|emb|CAC99814.1| lmo1736 [Listeria monocytogenes EGD-e]
 gi|217333388|gb|ACK39182.1| acetyltransferase, gnat family [Listeria monocytogenes HCC23]
 gi|307571316|emb|CAR84495.1| acetyltransferase, putative [Listeria monocytogenes L99]
          Length = 172

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRRSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|149187354|ref|ZP_01865652.1| acetyltransferase [Vibrio shilonii AK1]
 gi|148838890|gb|EDL55829.1| acetyltransferase [Vibrio shilonii AK1]
          Length = 170

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 18/170 (10%)

Query: 34  FLERLEHDSSICAMHADSFG---------PG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
              R E       +H+ ++          PG +     ++   +  + L++S +C     
Sbjct: 1   MKIRTETHEDTKQIHSITYQAFENHPHHEPGAKPTEHLIVDGLRRDNALTVSLVCEANNE 60

Query: 84  IVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           ++G +  +PI I+    T   LGP+ V P +Q KGIG  LI       ++ G Q IVL+G
Sbjct: 61  VIGHIAFSPILIDGEASTWVGLGPVSVIPEHQGKGIGGALIREGEAQIKQLGYQGIVLLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           D +YY + GF++ P  +    A V     L       +    KG V   +
Sbjct: 121 DPSYYGRFGFESHPNLTF---ADVPAEYFLVKGFENTIP---KGEVTYHK 164


>gi|82702344|ref|YP_411910.1| GCN5-related N-acetyltransferase [Nitrosospira multiformis ATCC
           25196]
 gi|82410409|gb|ABB74518.1| GCN5-related N-acetyltransferase [Nitrosospira multiformis ATCC
           25196]
          Length = 165

 Score =  121 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 62/157 (39%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              RLE    I A+ +           G     AV    +    L LS +  E   I+G 
Sbjct: 1   MQIRLERPEDIAAIQSLITAAFKEMPYGSQTEGAVADALRSAGALILSLIAIEDGEIIGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I   T   + LGP+ V P  Q +GIG+ LI   +       +Q  V++GD  Y
Sbjct: 61  VAFSPVAISGATNGWYGLGPVSVRPDRQGRGIGQALIREGLARLRDMNAQGCVVLGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           YS+ GF + P         V P     L     V + 
Sbjct: 121 YSRFGFISDPGLR---YGDVPPEYFQRLGFTGIVPEG 154


>gi|212702130|ref|ZP_03310258.1| hypothetical protein DESPIG_00140 [Desulfovibrio piger ATCC 29098]
 gi|212674437|gb|EEB34920.1| hypothetical protein DESPIG_00140 [Desulfovibrio piger ATCC 29098]
          Length = 169

 Score =  121 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 65/166 (39%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E  +           A  +     G        LR+       LS +  E  +IV
Sbjct: 1   MIIRKETVADRDNVYYVIKRAFESAEHADGNEHDLVNSLRKGDAFIPELSLVAEEEGKIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T  +++  T   L P+ V P YQ KGIG+ LI      A++ G    +++G   Y
Sbjct: 61  GHIMFTKATVDGKTVLALAPLSVLPEYQRKGIGKSLIREGHSIAKQLGYTHSIVLGSEKY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           YS  G+       +  P  V     +   + +N   ++ GI+R  +
Sbjct: 121 YSSEGYVPAEDFGIKAPFDVPRENFMVYMITKNG-DDLHGIIRYAQ 165


>gi|147674103|ref|YP_001216149.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|153215834|ref|ZP_01950166.1| acetyltransferase, putative [Vibrio cholerae 1587]
 gi|153801999|ref|ZP_01956585.1| acetyltransferase, putative [Vibrio cholerae MZO-3]
 gi|153818675|ref|ZP_01971342.1| acetyltransferase, putative [Vibrio cholerae NCTC 8457]
 gi|255744128|ref|ZP_05418081.1| acetyltransferase [Vibrio cholera CIRS 101]
 gi|262156104|ref|ZP_06029223.1| acetyltransferase [Vibrio cholerae INDRE 91/1]
 gi|262169954|ref|ZP_06037644.1| acetyltransferase [Vibrio cholerae RC27]
 gi|124114551|gb|EAY33371.1| acetyltransferase, putative [Vibrio cholerae 1587]
 gi|124122458|gb|EAY41201.1| acetyltransferase, putative [Vibrio cholerae MZO-3]
 gi|126510755|gb|EAZ73349.1| acetyltransferase, putative [Vibrio cholerae NCTC 8457]
 gi|146315986|gb|ABQ20525.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|255738068|gb|EET93460.1| acetyltransferase [Vibrio cholera CIRS 101]
 gi|262021688|gb|EEY40399.1| acetyltransferase [Vibrio cholerae RC27]
 gi|262030140|gb|EEY48785.1| acetyltransferase [Vibrio cholerae INDRE 91/1]
          Length = 167

 Score =  121 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I     +  + F       A +++  +     +LS +  +    IVG V 
Sbjct: 1   MLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACDDEGEIVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     SL     V       + L +       G++   +
Sbjct: 119 RFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYSQ 162


>gi|227357047|ref|ZP_03841417.1| acetyltransferase [Proteus mirabilis ATCC 29906]
 gi|227162739|gb|EEI47702.1| acetyltransferase [Proteus mirabilis ATCC 29906]
          Length = 167

 Score =  121 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E    I A+      SF  G    A ++   +    L+L  +   +  RIVG + 
Sbjct: 1   MLIRVEIPVDIPAIDDLLRQSFPTG--AEADLVGHLREEGLLTLGMVAINDEGRIVGYIG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ IE        L P+ V P Y+ +GIGR+LI+  +D+  + G   +V++G+  YY 
Sbjct: 59  FTPVDIEGKDCQWVGLAPLAVAPQYRGQGIGRQLINEGLDSLNEFGYGAVVVLGEPTYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           K GF     + L    P       F  L      +I G+V   
Sbjct: 119 KSGFIPAKSQGLHCKWPNTEEAFQFYALDNGNVDDIHGLVNFS 161


>gi|260771804|ref|ZP_05880722.1| predicted acetyltransferase [Vibrio metschnikovii CIP 69.14]
 gi|260613096|gb|EEX38297.1| predicted acetyltransferase [Vibrio metschnikovii CIP 69.14]
          Length = 173

 Score =  121 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 65/162 (40%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F           LRE G    +LS +  +    IVG   
Sbjct: 1   MLIRTEAPADILAVERLLSAVFATNSEANLVTSLRENGRR--TLSLVACDEQGEIVGYAL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIG  L++  + +  + G    V++GD  YY 
Sbjct: 59  FSPVTLNGEDLNWQGLAPLAVAKEHRKQGIGALLVNEGLSSLGELGYPACVVLGDPNYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+         P P   +    + L ++   + +GI+  
Sbjct: 119 RFGFKEAQTHGFSCPWPELASAFQVVALWEDAFIDRQGIIEY 160


>gi|313608292|gb|EFR84284.1| acetyltransferase [Listeria monocytogenes FSL F2-208]
          Length = 172

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRRSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSDQFAIPAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|152980066|ref|YP_001352034.1| acetyltransferase [Janthinobacterium sp. Marseille]
 gi|151280143|gb|ABR88553.1| acetyltransferase [Janthinobacterium sp. Marseille]
          Length = 166

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 64/159 (40%), Gaps = 15/159 (9%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV--------RAAVLLREQGMHDLSLSFLCAEGKRIV 85
            L R E  +   A+ A +     F            ++   +    L +S +      IV
Sbjct: 1   MLIRPEQATDATAIEAVTRAA--FADHPHSDQCEHFIITALRAAGALPISLVAELKGEIV 58

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V  +P++        + LGP+ V P +QN+GIGR LI   +       +Q  V+ GD 
Sbjct: 59  GHVAFSPVNISDGSQHWYGLGPVSVLPEFQNRGIGRALIENGLALLRANKAQGCVVAGDP 118

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           AYY + GF+ +    L  P  +     + LP    + Q 
Sbjct: 119 AYYQRFGFRHIET--LSYPG-LPAEYFMALPFHTELPQG 154


>gi|329890226|ref|ZP_08268569.1| acetyltransferase GNAT family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328845527|gb|EGF95091.1| acetyltransferase GNAT family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 170

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 51/160 (31%), Positives = 78/160 (48%), Gaps = 4/160 (2%)

Query: 24  RSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
            +    +     E LE  ++I A+   +FGPGRF + A  LRE+            EG+R
Sbjct: 10  ENDPHFVRGIVRETLEDAAAIDALVIAAFGPGRFAKTAERLRERSPLAAGFCL--YEGER 67

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           ++GSVR+  I   +     LGPI V    ++ G+G +L+   +  A+  G   ++LVGD 
Sbjct: 68  LIGSVRLWSILTGEARSVFLGPIAVDRASRSTGLGGELVRACIAEAKALGLDGVLLVGDP 127

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            Y+S+ GF   P    +LP PVD  RV++LP         
Sbjct: 128 PYFSRFGFVPAPDA--VLPGPVDQRRVMWLPFTAAAPVGA 165


>gi|194292015|ref|YP_002007922.1| gcn5-related N-acetyltransferase, acetyltransferase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193225919|emb|CAQ71866.1| GCN5-related N-acetyltransferase, Putative acetyltransferase
           [Cupriavidus taiwanensis LMG 19424]
          Length = 172

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 74/162 (45%), Gaps = 11/162 (6%)

Query: 35  LERLEHDSSICAMHADSFGPGRF---VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            ER +   +I  +   +F            ++   +    L +S +     ++VG V ++
Sbjct: 11  SERPDDAHAITEVTQAAFAVATHSSGTEPLIIAALRAAGQLEISLVAELSGQVVGHVAIS 70

Query: 92  PI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           PI  S      + LGP+ V P  Q  G+G +LI  ++D   + G+Q  V++G+ AYYS+ 
Sbjct: 71  PIEISDGSARWYGLGPVSVLPAQQGIGVGSQLIRAALDRLRQSGAQGCVVLGEPAYYSRF 130

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           GF A    SL+LP  V       + L  +V     G+VR  E
Sbjct: 131 GFSA--QSSLVLPG-VPAEYFQAIALGPHVP---SGVVRYHE 166


>gi|331695919|ref|YP_004332158.1| GCN5-like N-acetyltransferase [Pseudonocardia dioxanivorans CB1190]
 gi|326950608|gb|AEA24305.1| GCN5-related N-acetyltransferase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 171

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 63/157 (40%), Gaps = 8/157 (5%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAV-----LLREQGMHDLSLSFLCAEGKRIV 85
              R E  +   A+   H  +F P     A        LR+      +LS +  +  R+V
Sbjct: 4   VRIRPETIADHDAVRAVHRAAFAPPDGSEAVEAGLTDRLRDGPWFLPALSLVADDEDRVV 63

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G V  T   + +     LGPI V P  Q  GIG  L+  +VD A  +G +++ L+GD  +
Sbjct: 64  GHVICTRAHVGEADALGLGPIGVLPEAQRHGIGSALVDAAVDVARSRGERLVGLLGDPDF 123

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF       +  P P        L L  +  + 
Sbjct: 124 YGRFGFVDSRTVGVDAPDPTWGVHFQVLALDDDTPRG 160


>gi|300776657|ref|ZP_07086515.1| GNAT family acetyltransferase [Chryseobacterium gleum ATCC 35910]
 gi|300502167|gb|EFK33307.1| GNAT family acetyltransferase [Chryseobacterium gleum ATCC 35910]
          Length = 179

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 65/163 (39%), Gaps = 13/163 (7%)

Query: 40  HDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEG-KRIVGSVRM 90
                  +   +    R +  +          LR+       LS +  +    I G +  
Sbjct: 10  RKKDHQQVFQLTEEAFREMEHSDHQEQFLLEKLRKSEAFIPELSLVAEDEKGTIAGHILF 69

Query: 91  TPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           T I    + E      L P+ V P +QN+G+G KLI      A++ G + ++L+G   YY
Sbjct: 70  TKIKIVNNSESFDSLALAPVSVKPEFQNRGLGGKLILEGHRIAKELGYESVILIGHENYY 129

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + G++      +  P  +     + + LV++  +N  G+V+ 
Sbjct: 130 PRFGYKKTSNFGISFPFDIPEENGMAVELVKDGLKNKTGVVKY 172


>gi|323499457|ref|ZP_08104429.1| putative acetyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323315513|gb|EGA68552.1| putative acetyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 167

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 67/162 (41%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLC-AEGKRIVGSVR 89
            L R E  + I A+      +F       A ++++ +     SLS +   +   +VG V 
Sbjct: 1   MLIRTEAPADILAVDRLLKSTF--ETDAEANLVMKLRENGHRSLSLVASTDEGEVVGFVL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GI +KL+  + ++  + G    V++GD AYYS
Sbjct: 59  FSPVTLGGADYNWQGLAPLAVKEEFRGQGIAQKLVEEAFESLFELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF A     L     V         L   V     G+V  
Sbjct: 119 RFGFTAAELHQLKCQWEVPEGAFQVKALADGVLDGHVGLVEY 160


>gi|19552457|ref|NP_600459.1| acetyltransferase [Corynebacterium glutamicum ATCC 13032]
 gi|62390123|ref|YP_225525.1| acetyltransferase [Corynebacterium glutamicum ATCC 13032]
 gi|21324003|dbj|BAB98629.1| Predicted acetyltransferase [Corynebacterium glutamicum ATCC 13032]
 gi|41325459|emb|CAF19939.1| Acetyltransferase, GNAT family [Corynebacterium glutamicum ATCC
           13032]
          Length = 168

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 70/165 (42%), Gaps = 13/165 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAEGKRIVGS 87
           F  R E    I A+H  +      +  +      ++ + +    LSLS +      ++G 
Sbjct: 4   FHIRAEQSRDISAIHDVTEAAFTGIEHSDGTEQDLVDKLRAAKALSLSLVAEADGEVIGH 63

Query: 88  VRMTPISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  + + I         +GP+ V P  Q +G+G  L+  ++D    +G+  IVL+GD  Y
Sbjct: 64  IAASEVLIGGGVQGWFGIGPVSVRPDKQQQGVGIALMGSALDQLRAEGAGGIVLLGDPGY 123

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF+ VP   L+ P        + + L  N     +G+V   
Sbjct: 124 YRRFGFEVVP--GLVYP-DAPAEFFMAVCL--NAPAFPQGVVEYH 163


>gi|262191209|ref|ZP_06049408.1| acetyltransferase [Vibrio cholerae CT 5369-93]
 gi|262032911|gb|EEY51450.1| acetyltransferase [Vibrio cholerae CT 5369-93]
          Length = 167

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I     +  + F       A +++  +     +LS +  +    IVG V 
Sbjct: 1   MLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACDDEGEIVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+     SL     V       + L +       G++   
Sbjct: 119 RFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYS 161


>gi|281490529|ref|YP_003352509.1| GNAT family acetyltransferase [Lactococcus lactis subsp. lactis
           KF147]
 gi|281374347|gb|ADA63880.1| Acetyltransferase, GNAT family [Lactococcus lactis subsp. lactis
           KF147]
          Length = 173

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 62/166 (37%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
              LE+   +  +  +SF     G G        +R +  +   L  +  E  +IVG   
Sbjct: 5   TINLENYKEVTELIRESFSQSEHGYGNEAELVDKIRNEEGYIKDLEIVAFEDGKIVGHGL 64

Query: 90  MTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++ + I    +K  G +L P+ V   +Q KGIG  ++      A+      I ++G   Y
Sbjct: 65  LSEVEIVSDSQKFKGLVLAPLDVLTTHQGKGIGAAVLLELEKRAKILDYPFISILGHETY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y K G+       +  P  V     +   L     +   G++   E
Sbjct: 125 YPKFGYVPASQYQIKAPFEVPDENFMIKELTDGGLEGKSGVIHYSE 170


>gi|326405647|gb|ADZ62718.1| acetyltransferase, GNAT family [Lactococcus lactis subsp. lactis
           CV56]
          Length = 173

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 62/166 (37%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
              LE+   +  +  +SF     G G        +R +  +   L  +  E  +IVG   
Sbjct: 5   TINLENYKEVTELIRESFSQSEHGYGNEAELVDKIRNEEGYIKDLEIVAFEDGKIVGHGL 64

Query: 90  MTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++ + I    +K  G +L P+ V   YQ KGIG  ++      A+      I ++G   Y
Sbjct: 65  LSEVEIVSDSQKFKGLVLAPLDVLTTYQGKGIGAAVLLELEKRAKILDYPFISILGHETY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y K G+       +  P  V     +   L     +   G++   E
Sbjct: 125 YPKFGYVPASQYQIKAPFEVPDENFMIKELTDGGLEGKSGVIHYSE 170


>gi|327483455|gb|AEA77862.1| Acetyltransferase [Vibrio cholerae LMA3894-4]
          Length = 167

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I     +  + F       A +++  +     +LS +  +    IVG V 
Sbjct: 1   MLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACDDEGEIVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+     SL     V       + L +       G++   
Sbjct: 119 RFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIGYS 161


>gi|62290436|ref|YP_222229.1| acetyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|82700359|ref|YP_414933.1| GCN5-related N-acetyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024664|ref|YP_001935432.1| GCN5-related N-acetyltransferase [Brucella abortus S19]
 gi|237815944|ref|ZP_04594941.1| acetyltransferase [Brucella abortus str. 2308 A]
 gi|254689736|ref|ZP_05152990.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 6 str. 870]
 gi|254697880|ref|ZP_05159708.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730771|ref|ZP_05189349.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 4 str. 292]
 gi|256257989|ref|ZP_05463525.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260546970|ref|ZP_05822709.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755268|ref|ZP_05867616.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758489|ref|ZP_05870837.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762314|ref|ZP_05874657.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884283|ref|ZP_05895897.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248821|ref|ZP_06932539.1| acetyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|62196568|gb|AAX74868.1| acetyltransferase, GNAT family [Brucella abortus bv. 1 str. 9-941]
 gi|82616460|emb|CAJ11523.1| GCN5-related N-acetyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|189020236|gb|ACD72958.1| GCN5-related N-acetyltransferase [Brucella abortus S19]
 gi|237789242|gb|EEP63453.1| acetyltransferase [Brucella abortus str. 2308 A]
 gi|260096020|gb|EEW79897.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668807|gb|EEX55747.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672746|gb|EEX59567.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675376|gb|EEX62197.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873811|gb|EEX80880.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175990|gb|EFH35337.1| acetyltransferase [Brucella abortus bv. 5 str. B3196]
          Length = 164

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 64/157 (40%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  E  +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I       + LGP+ V P  Q +GIG KLI   +      G++  VL+GD+ Y
Sbjct: 61  IAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+A   + L     V P     L    ++ Q 
Sbjct: 121 YRRFGFKADARQKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|116873169|ref|YP_849950.1| acetyltransferase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742047|emb|CAK21171.1| acetyltransferase, GNAT family [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 172

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
            + R E      A+   + ++F           +R    +  SLS +       IVG + 
Sbjct: 1   MIIRKEQPQDFQAIRRVNEEAFKGTVEADLIESIRSSDYYQPSLSLVVEAFDGNIVGYLM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   IG KL+   +  A +K    I ++G   +
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPEYQGSRIGSKLMEEGIRLAREKAYPAIAVLGHADF 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF +     +  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFISSEQFGIRAPFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|120404290|ref|YP_954119.1| GCN5-like N-acetyltransferase [Mycobacterium vanbaalenii PYR-1]
 gi|119957108|gb|ABM14113.1| GCN5-related N-acetyltransferase [Mycobacterium vanbaalenii PYR-1]
          Length = 174

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E +S I A+ A +          R   AAV+   +    L+LS +  EG  IV
Sbjct: 1   MSIAIRDEQESDIAAIRALTLQAFADVPQSRQTEAAVIDALRAAGALTLSLVAVEGGDIV 60

Query: 86  GSVRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           G V ++P+SI+       +  GP+ V P  Q  GIG  LI    +   + G++  V+VGD
Sbjct: 61  GHVAVSPLSIDGDAGPGWYGGGPLSVRPDRQRAGIGTALIRAVFERLRENGARGAVVVGD 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
             YY + GF+     +L     V    +L L L       
Sbjct: 121 PRYYERFGFRQATTLAL---PDVPAENLLVLALDGQCPTG 157


>gi|197287256|ref|YP_002153128.1| acetyltransferase [Proteus mirabilis HI4320]
 gi|194684743|emb|CAR46753.1| putative acetyltransferase [Proteus mirabilis HI4320]
          Length = 167

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E    I A+      SF  G    A ++   +    L+L  +   +  RIVG + 
Sbjct: 1   MLIRVEIPVDIPAIDDLLRQSFPTG--AEADLVGHLREEGLLTLGMVAINDEGRIVGYIG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ IE        L P+ V P Y+ +GIGR+LI+  +D+  + G   +V++G+  YY 
Sbjct: 59  FTPVDIEGKDCQWVGLAPLAVAPQYRGQGIGRQLINEGLDSLNEFGYGAVVVLGEPTYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           K GF     + L    P       F  L      +I G+V   
Sbjct: 119 KSGFIPAKSQGLHCKWPNTEEVFQFYALDNGNVDDIHGLVNFS 161


>gi|158320962|ref|YP_001513469.1| GCN5-related N-acetyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158141161|gb|ABW19473.1| GCN5-related N-acetyltransferase [Alkaliphilus oremlandii OhILAs]
          Length = 176

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 71/170 (41%), Gaps = 12/170 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSFGPGRFV---RAAVLLREQ--GMHDLSLSFLCAEGKR 83
                R E          +  ++F    +       ++ R +        LS +    K+
Sbjct: 1   MNVKIRQETVVDYKISERVVEEAFKDAEYSDHKEHLLVDRLRKSEAFIPELSIIAELDKK 60

Query: 84  IVGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           IVG + +T I I+          L P+ V P YQNKGIG  LI  S+  A++ G   +++
Sbjct: 61  IVGHIMLTKILIKNDDKEHEALALAPVSVLPQYQNKGIGNSLIIESIKVAKELGYTSVIV 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +G+  YY + GF++    ++  P  V     + L L +     ++G+V  
Sbjct: 121 LGEDRYYHRFGFKSTSIWNIRAPFDVPRESFMALELKRESLVQVEGVVTY 170


>gi|256114124|ref|ZP_05454878.1| acetyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265995442|ref|ZP_06107999.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766555|gb|EEZ12344.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 164

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  EG +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEGGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I       + LGP+ V P  Q +GIG KLI   +      G++  VL+GD+ Y
Sbjct: 61  IAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+A   + L     V P     L    ++ Q 
Sbjct: 121 YGRFGFKADARQKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|23502416|ref|NP_698543.1| acetyltransferase [Brucella suis 1330]
 gi|148559961|ref|YP_001259426.1| acetyltransferase [Brucella ovis ATCC 25840]
 gi|161619495|ref|YP_001593382.1| GCN5-related N-acetyltransferase [Brucella canis ATCC 23365]
 gi|163843805|ref|YP_001628209.1| GCN5-related N-acetyltransferase [Brucella suis ATCC 23445]
 gi|225853030|ref|YP_002733263.1| GCN5-related N-acetyltransferase [Brucella melitensis ATCC 23457]
 gi|254694225|ref|ZP_05156053.1| GCN5-related N-acetyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254702271|ref|ZP_05164099.1| GCN5-related N-acetyltransferase [Brucella suis bv. 5 str. 513]
 gi|254704803|ref|ZP_05166631.1| GCN5-related N-acetyltransferase [Brucella suis bv. 3 str. 686]
 gi|254708217|ref|ZP_05170045.1| GCN5-related N-acetyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254710587|ref|ZP_05172398.1| GCN5-related N-acetyltransferase [Brucella pinnipedialis B2/94]
 gi|256032081|ref|ZP_05445695.1| GCN5-related N-acetyltransferase [Brucella pinnipedialis M292/94/1]
 gi|256045173|ref|ZP_05448072.1| GCN5-related N-acetyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061603|ref|ZP_05451744.1| GCN5-related N-acetyltransferase [Brucella neotomae 5K33]
 gi|256160277|ref|ZP_05457971.1| GCN5-related N-acetyltransferase [Brucella ceti M490/95/1]
 gi|256255482|ref|ZP_05461018.1| GCN5-related N-acetyltransferase [Brucella ceti B1/94]
 gi|256263490|ref|ZP_05466022.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369967|ref|YP_003107478.1| acetyltransferase, GNAT family [Brucella microti CCM 4915]
 gi|260169216|ref|ZP_05756027.1| acetyltransferase, GNAT family protein [Brucella sp. F5/99]
 gi|260565228|ref|ZP_05835712.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260565954|ref|ZP_05836424.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261214532|ref|ZP_05928813.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261222689|ref|ZP_05936970.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315721|ref|ZP_05954918.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318159|ref|ZP_05957356.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261325610|ref|ZP_05964807.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261752839|ref|ZP_05996548.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755497|ref|ZP_05999206.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758728|ref|ZP_06002437.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265989190|ref|ZP_06101747.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991604|ref|ZP_06104161.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265998653|ref|ZP_06111210.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|23348403|gb|AAN30458.1| acetyltransferase, GNAT family [Brucella suis 1330]
 gi|148371218|gb|ABQ61197.1| acetyltransferase, GNAT family [Brucella ovis ATCC 25840]
 gi|161336306|gb|ABX62611.1| GCN5-related N-acetyltransferase [Brucella canis ATCC 23365]
 gi|163674528|gb|ABY38639.1| GCN5-related N-acetyltransferase [Brucella suis ATCC 23445]
 gi|225641395|gb|ACO01309.1| GCN5-related N-acetyltransferase [Brucella melitensis ATCC 23457]
 gi|256000130|gb|ACU48529.1| acetyltransferase, GNAT family [Brucella microti CCM 4915]
 gi|260151296|gb|EEW86390.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155472|gb|EEW90552.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260916139|gb|EEX83000.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260921273|gb|EEX87926.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261297382|gb|EEY00879.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301590|gb|EEY05087.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304747|gb|EEY08244.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738712|gb|EEY26708.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742592|gb|EEY30518.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745250|gb|EEY33176.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262553277|gb|EEZ09111.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|263002388|gb|EEZ14963.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093513|gb|EEZ17547.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661387|gb|EEZ31648.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|326409570|gb|ADZ66635.1| GCN5-related N-acetyltransferase [Brucella melitensis M28]
 gi|326539274|gb|ADZ87489.1| GCN5-related N-acetyltransferase [Brucella melitensis M5-90]
          Length = 164

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 64/157 (40%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  E  +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I       + LGP+ V P  Q +GIG KLI   +      G++  VL+GD+ Y
Sbjct: 61  IAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+A   + L     V P     L    ++ Q 
Sbjct: 121 YGRFGFKADARQKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|157368753|ref|YP_001476742.1| GCN5-related N-acetyltransferase [Serratia proteamaculans 568]
 gi|157320517|gb|ABV39614.1| GCN5-related N-acetyltransferase [Serratia proteamaculans 568]
          Length = 167

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLIRVEIPVDAAGIDALLRRAF--GRDDEADLVQQLREDGLLTLGIVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V    + +G+G KLI   +DA  +     +V++G+ AYY 
Sbjct: 59  FSPVDVAGEDRQWVGLAPLAVDESLRRQGLGEKLIYEGLDALNEFSYAAVVVLGEPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P         PL ++   ++ G V   E
Sbjct: 119 RFGFKPAAAYGLQCRWPDTEAAFQVYPLAEDALVDVGGAVEYSE 162


>gi|260549276|ref|ZP_05823496.1| acetyltransferase [Acinetobacter sp. RUH2624]
 gi|260407682|gb|EEX01155.1| acetyltransferase [Acinetobacter sp. RUH2624]
          Length = 168

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 68/168 (40%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              + R E    I  +   +                ++   +    L++S +  E   IV
Sbjct: 1   MNIIIRDEQPEDIKNIEELTKAAFLNAEHSSHTEQFIVNSLRKHKQLTISLVATENDLIV 60

Query: 86  GSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P++I   +   + LGPI V P  Q  GIG  L++ ++   ++ G +  VL+GD 
Sbjct: 61  GHVAISPVTITSGETGWYGLGPISVCPNKQGIGIGSLLMNAALQKLKELGGKGCVLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF++    +L     V       +   + +     G V   E
Sbjct: 121 NYYSRFGFKSYSDLNL---PDVPNEYFQAISFSKYIP---SGEVSYHE 162


>gi|258620325|ref|ZP_05715363.1| putative acetyltransferase [Vibrio mimicus VM573]
 gi|258587204|gb|EEW11915.1| putative acetyltransferase [Vibrio mimicus VM573]
          Length = 167

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    I+G V 
Sbjct: 1   MLIRTEAPADILAVDELLKTVFA--TEAEANLVMALRENGRRTLSLVACDDEGEIIGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTVDGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L     V       + L +      +G+V   
Sbjct: 119 RFGFEDAAQYQLHCAWEVPQGAFRVVALWERELDGRRGLVEYS 161


>gi|148976695|ref|ZP_01813382.1| putative acetyltransferase [Vibrionales bacterium SWAT-3]
 gi|145964046|gb|EDK29304.1| putative acetyltransferase [Vibrionales bacterium SWAT-3]
          Length = 167

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 63/163 (38%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++  +    L+LS +   +   +VG + 
Sbjct: 1   MLIRTEAPADILVIDRLLKSVF--ETDAEANLVMSLRENSHLTLSLVACSDEGEVVGHLM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +PI++         L P+ V   ++N+GI + L+  +       G    V++GD AYY 
Sbjct: 59  FSPITLHGDDHNWQGLAPLAVKEEFRNQGIAKALVEDAFSTLVDFGYPACVVLGDPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+A     L     V       + LV+       G V   
Sbjct: 119 RFGFKAASEFGLSCAWDVPEGAFQAIELVEGALTGHAGEVAYS 161


>gi|319406161|emb|CBI79798.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 194

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 9/163 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F    E ++       +     G  R  +++ +LR        LSF+       +VGSVR
Sbjct: 14  FTLMSEQEADGPHREKLLDLVMGKERKRKSSEILRCGRSPAFGLSFIIKNFLDELVGSVR 73

Query: 90  MTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +  ++      E     LLGP+ V   Y   GIG  L+  +++ A+K G   I LVGD  
Sbjct: 74  LWNVTFHKGQNETQAALLLGPLAVAAEYSGIGIGSVLMRHAIETAKKLGHGAIFLVGDSE 133

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +Y + GF +   ++  +P   + +R   L L+        G++
Sbjct: 134 FYQRFGFSSHLTENFTMPGTYEKDRFQALELIPQYLIECHGVL 176


>gi|313105542|ref|ZP_07791810.1| hypothetical protein PA39016_000060015 [Pseudomonas aeruginosa
           39016]
 gi|310878312|gb|EFQ36906.1| hypothetical protein PA39016_000060015 [Pseudomonas aeruginosa
           39016]
          Length = 168

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 62/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIDAIARLTEAAFRNETHSSHTEQYIIDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q++G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPERQHQGLGSQLVRRLLAELRMLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+     +L+    V             +A+ I
Sbjct: 121 TYYSRFGFRVESGLALL---GVPAEYFQAQSFSGRMARGI 157


>gi|259415924|ref|ZP_05739844.1| acetyltransferase, gnat family [Silicibacter sp. TrichCH4B]
 gi|259347363|gb|EEW59140.1| acetyltransferase, gnat family [Silicibacter sp. TrichCH4B]
          Length = 163

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 69/157 (43%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADS---FG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+H  +   F     G      ++ R +    L LS +  E   I+G 
Sbjct: 1   MHIRQERRGDEVAIHDLTAVAFADHPHGDGSEPIIVKRLRDAGALQLSLVAEEAGEILGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I         LGP+ V P +Q +GIG  LI   ++  E+ G+  +VL+G+ AY
Sbjct: 61  VAFSPVTISGEDLGWLGLGPVSVLPAWQGQGIGSALIRAGLEHLERAGAAGVVLLGEPAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y++ GF       L+LP  V     +   L  ++ Q 
Sbjct: 121 YARFGF--AVRAGLVLPG-VPAAYFMARALRGDIPQG 154


>gi|254293098|ref|YP_003059121.1| GCN5-related N-acetyltransferase [Hirschia baltica ATCC 49814]
 gi|254041629|gb|ACT58424.1| GCN5-related N-acetyltransferase [Hirschia baltica ATCC 49814]
          Length = 180

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 47/148 (31%), Positives = 76/148 (51%), Gaps = 2/148 (1%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPI 93
           LE+ EH   I A++   FG GRF + A  LRE       +S +  +  + +V +VR+ P+
Sbjct: 19  LEQAEHSVGIEALYDRCFGFGRFAKTAERLREGNQLLSDMSLVAVDANENVVAAVRLWPL 78

Query: 94  SIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
            +        +GP+ V  LY+   +G  L    VD A+K G  + +L+GD  Y+SK+GFQ
Sbjct: 79  QVGDAGRAVFVGPVAVDSLYRGSSLGLILTQQCVDLAKKAGWPMAILIGDEPYFSKIGFQ 138

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVA 180
            V  ++   P  +  +R+L + L  N  
Sbjct: 139 QVSTQAYPAPGYIPEHRLLAIELEDNAI 166


>gi|116689934|ref|YP_835557.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia HI2424]
 gi|116648023|gb|ABK08664.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia HI2424]
          Length = 182

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 12/165 (7%)

Query: 36  ERLEHDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER     +I  +   +F     G      ++   +    LS+S +     RIVG V  +P
Sbjct: 17  ERASEADAIGRVIRAAFAGEPQGGEFEQRIVDTLRTDGALSVSLVAERDGRIVGHVAFSP 76

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I          + L P+ V P  Q + IG  L+   +DA  + G++  V++G+ AYY+
Sbjct: 77  VAIGGEPAGSQQWYGLAPLAVRPDCQRQSIGAGLVRTGLDALRRLGARGCVVLGEPAYYT 136

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GF+  P   ++ P  V P   L LP  ++      G VR  +V
Sbjct: 137 RFGFE--PHGDIVFPG-VPPEYFLALPFDESAPLPA-GDVRYHDV 177


>gi|291005984|ref|ZP_06563957.1| acetyltransferase [Saccharopolyspora erythraea NRRL 2338]
          Length = 188

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 61/169 (36%), Gaps = 5/169 (2%)

Query: 25  SRWQKIGAFFLERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHD--LSLSFLCA-E 80
           S        +  R E  + I A+ A +         A ++   +        LS +    
Sbjct: 15  SEEHSRTVQWRTRPETAADIAAIRAVNLAAFPTALEADLVDALRAGPAWIDGLSIVVETA 74

Query: 81  GKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
              I G V +T   ++      LGP  V P +Q  G G   IS  +DAA   G  +++++
Sbjct: 75  AGEIAGHVLLTRSHVDGSPALTLGPCAVLPRHQRAGAGSAGISAGLDAARAMGENLVLVL 134

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           G   YY + GF       + L   V    ++ L L  +      G V  
Sbjct: 135 GHPDYYPRFGFTRASEFGIGLTIEVPDEAMMALALDPHGHVP-SGTVEY 182


>gi|56475690|ref|YP_157279.1| acetyltransferase [Aromatoleum aromaticum EbN1]
 gi|56311733|emb|CAI06378.1| predicted acetyltransferase [Aromatoleum aromaticum EbN1]
          Length = 176

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E      A+ A +    R           +L   +    LS+S +      IVG+
Sbjct: 11  LIIRSEAPEDAAAIEAVTESAFRHAPHSDHNEQFILAALRDAGALSVSLVAEMDGVIVGN 70

Query: 88  VRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P+SI         +GP+ V P  Q +GIG +L+  ++     +G+   V++GD +Y
Sbjct: 71  VVLSPVSISSGAAGWFGVGPVSVIPELQGRGIGAQLMREALARLSAQGASGCVVLGDPSY 130

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y + GF       L+LP  V P   + L   Q +     G V   
Sbjct: 131 YKRFGF--ANEAGLVLP-DVPPEYFMALSFGQPM---ATGTVTYH 169


>gi|262042715|ref|ZP_06015869.1| acetyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259039940|gb|EEW41057.1| acetyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 167

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 67/164 (40%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  GR   A ++   +    ++L  +  +   +++G V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRTF--GRDAEAQLVHDLREDGLITLGVVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIGR+L+   +D+  + G   +V +GD   Y 
Sbjct: 59  FSPVAVEGEELQWVGLAPLAVDERYRGQGIGRQLVYEGLDSLNEFGYAAVVTLGDPDLYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L               L  +    + G V   E
Sbjct: 119 RFGFEPAARFDLRCRWTDSAEAFQVHRLADDALDGVHGQVEYSE 162


>gi|254829258|ref|ZP_05233945.1| acetyltransferase [Listeria monocytogenes FSL N3-165]
 gi|258601670|gb|EEW14995.1| acetyltransferase [Listeria monocytogenes FSL N3-165]
          Length = 172

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRRSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPAPFDVPAEYFMLLELYNGSLENLAGTIHY 164


>gi|218440288|ref|YP_002378617.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424]
 gi|218173016|gb|ACK71749.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424]
          Length = 169

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 67/163 (41%), Gaps = 9/163 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           F  R E+      +  +   +F   R   A ++   +    +SLS +    ++IVG +  
Sbjct: 2   FSIRPENQDDAQGVRFLLEKTFN--RPQEANLVETLRARDMISLSLVAHIDEQIVGYIAF 59

Query: 91  TPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +P+ +E          L P+ + P YQ + +G  L+ + +   +  G + IV++G+  +Y
Sbjct: 60  SPVELESNESSLKILGLAPLAILPQYQRQALGSNLVEIGLQQCQALGYEAIVVLGEPTFY 119

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + GF+     SL     +     +   L+        G++  
Sbjct: 120 HRFGFRPTSLYSLWSSFDIPSEFFMIKELITGSLGGHSGVILY 162


>gi|107028908|ref|YP_626003.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia AU 1054]
 gi|105898072|gb|ABF81030.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia AU 1054]
          Length = 182

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 12/165 (7%)

Query: 36  ERLEHDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER     +I  +   +F     G      ++   +    LS+S +     RIVG V  +P
Sbjct: 17  ERASEADAIGRVIRAAFAGEPQGGEFEQRIVDTLRTDGALSVSLVAERDGRIVGHVAFSP 76

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I          + L P+ V P  Q + IG  L+   +DA  + G++  V++G+ AYY+
Sbjct: 77  VAIGGEPAGSQQWYGLAPLAVRPDCQRQSIGAGLVRTGLDALRRLGARGCVVLGEPAYYT 136

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GF+  P   ++ P  V P   L LP  ++      G VR  +V
Sbjct: 137 RFGFE--PRGDIVFPG-VPPEYFLALPFDESAPLPA-GDVRYHDV 177


>gi|259156550|gb|ACV96493.1| acetyltransferase, gnat family [Vibrio fluvialis Ind1]
          Length = 167

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I     +  + F       A +++  +     +LS +  +    IVG V 
Sbjct: 1   MLIRTEAPADILVVDQLLKNVFA--TEAEADLVMALRENGQRTLSLVACDDEGEIVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+     SL     V       + L +       G++   
Sbjct: 119 RFGFEDAARYSLRCAWDVPLGAFQVVALWERELDGRCGVIEYS 161


>gi|313891282|ref|ZP_07824900.1| acetyltransferase, GNAT family [Streptococcus pseudoporcinus SPIN
           20026]
 gi|313120349|gb|EFR43470.1| acetyltransferase, GNAT family [Streptococcus pseudoporcinus SPIN
           20026]
          Length = 189

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 62/161 (38%), Gaps = 8/161 (4%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLC 78
            +K     + R E      A++        +   +          LRE   +   LS + 
Sbjct: 14  KKKSEIEMIIRQEEKEDFRAIYQLVTEAFAWAEHSDGTEQDLVEALREGDSYIAELSLVL 73

Query: 79  AEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
              K++ G +  T   + +    +L P+ + P YQ +G GR LI      A+  G  +I+
Sbjct: 74  EVDKQLRGHIMFTKAKVGQHEALVLAPLSIAPCYQKQGYGRALIDRGHQVAKNLGYDLIL 133

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNV 179
           ++G   YYS+ G+Q      + LP        + L L  N 
Sbjct: 134 VLGSKGYYSQFGYQPAELFGISLPQGFPSENFMALSLCGNG 174


>gi|299529122|ref|ZP_07042570.1| GCN5-related N-acetyltransferase [Comamonas testosteroni S44]
 gi|298722878|gb|EFI63787.1| GCN5-related N-acetyltransferase [Comamonas testosteroni S44]
          Length = 166

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E  +   A+   +    +           ++   +    L+LS +    ++IVG 
Sbjct: 1   MQIRAELPADAQAIEQVTIQAFKDAQHTDHTEQFIVRELRAAGALALSLVAEIDEQIVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P++          LGPI V P  Q +GIG  L+  ++ A   + ++  VL+GD  Y
Sbjct: 61  VAISPVTISDGSQHWFGLGPISVIPQRQRQGIGSALMQAAISALHAQSARGCVLLGDPDY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+ VP   L+LP  V       L       Q 
Sbjct: 121 YRRFGFRTVP--GLVLPG-VPAEYFQALTFEGLPPQG 154


>gi|295097647|emb|CBK86737.1| Predicted acetyltransferase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 167

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    ++L  +  +   ++VG V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRSFAG--DAEAQLVHDLREDGLITLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V++GD A+Y 
Sbjct: 59  FSPVIVQGEELQWVGMAPLAVDENYRGQGLARQLVYEGLDSLNEFGYAAVVVLGDPAFYE 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P      L  PL  +    + G+V   +
Sbjct: 119 RLGFKPASRYDLRCHWPGTETSFLVHPLADDALDGVTGLVEYHD 162


>gi|254420272|ref|ZP_05033996.1| acetyltransferase, GNAT family [Brevundimonas sp. BAL3]
 gi|196186449|gb|EDX81425.1| acetyltransferase, GNAT family [Brevundimonas sp. BAL3]
          Length = 165

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 7/154 (4%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
            E       + A+   +FGPGRF + A  LRE         F+     RIVGSVR+ P+ 
Sbjct: 17  AEIPADADGVEALVLAAFGPGRFAKTAERLREGSRPAAG--FVARRDGRIVGSVRLWPVL 74

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           I +  G  LGPI V    ++ G+G +L+   +D A       ++LVGD AY+ + GF   
Sbjct: 75  IGQTPGLFLGPIAVDAASRSDGLGAELVQACLDQARTLAVGGVLLVGDRAYFERFGFVGA 134

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           P     +P PVD  RVL+L       + + G VR
Sbjct: 135 PEA--EMPGPVDRRRVLWLA---TGVETVSGPVR 163


>gi|225027223|ref|ZP_03716415.1| hypothetical protein EUBHAL_01479 [Eubacterium hallii DSM 3353]
 gi|224955452|gb|EEG36661.1| hypothetical protein EUBHAL_01479 [Eubacterium hallii DSM 3353]
          Length = 230

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 69/197 (35%), Gaps = 25/197 (12%)

Query: 12  LSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADS-------FGPG---RFVRAA 61
           +    + F+  R+   +   +  + RLE       +           + PG    +V   
Sbjct: 1   MKNQDYRFLFLRKDIKEMEKSNIMIRLEKKEEHQKVENLVRESFWNVYRPGCLEHYVLHQ 60

Query: 62  VLLREQGMHDLSLSFLCAEG-----KRIVGSVRMTPISIEKITG-----HLLGPIVVHPL 111
             LR        L F+          +++G       +I+   G       +GPI + P 
Sbjct: 61  --LRNDLAFVPELDFVMFLNENGKEDKLIGQNMFMRTAIKSDDGRNIPIMTMGPICITPE 118

Query: 112 YQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPA---PVDPN 168
            + +G G+ L+  S+D A K G   +   G+I +Y K GF+     ++         D +
Sbjct: 119 LKRQGYGKALLDYSLDKAAKLGCGAVCFEGNIDFYGKSGFRPASEFNIRYHGLEEGQDAS 178

Query: 169 RVLFLPLVQNVAQNIKG 185
             L   L+      I G
Sbjct: 179 FFLCKELIPGYLNGITG 195


>gi|156975652|ref|YP_001446559.1| hypothetical protein VIBHAR_03385 [Vibrio harveyi ATCC BAA-1116]
 gi|156527246|gb|ABU72332.1| hypothetical protein VIBHAR_03385 [Vibrio harveyi ATCC BAA-1116]
          Length = 167

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 61/161 (37%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   +VG    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTEAEANLVMRLRENGKLTLSLVACTDEGEVVGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GI  +LI    D+    G  V V++GD  YY + 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIAAELIKEGFDSLRDFGYPVCVVLGDPDYYGRQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+A           V         LV+       G +   
Sbjct: 121 GFRASEEMGFDCAWEVPQGAFRVAELVEGQCDGHSGRIDYS 161


>gi|226329661|ref|ZP_03805179.1| hypothetical protein PROPEN_03571 [Proteus penneri ATCC 35198]
 gi|225202847|gb|EEG85201.1| hypothetical protein PROPEN_03571 [Proteus penneri ATCC 35198]
          Length = 168

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 70/161 (43%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLC-AEGKRIVGSVRMT 91
            L R+E    I A+             A ++   +    L+L  +  ++  +++G +  T
Sbjct: 1   MLIRVEIPVDIPAIDNLLRQAFPTSAEADLVGHLREEGLLTLGMVAISDEGQLIGYIGFT 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+ I+        L P+ V P +QN+GIGR+LI+  +D+  + G   +V++G+  YY K 
Sbjct: 61  PVDIDGKDCQWVGLAPLAVAPDFQNQGIGRQLINEGLDSLNEFGYGAVVVLGEPEYYQKS 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF     + L    P   +      L      +I G+V   
Sbjct: 121 GFIPAKSQGLHCKWPDTEDAFQLYALENGNVDDIHGLVNYS 161


>gi|261253854|ref|ZP_05946427.1| acetyltransferase [Vibrio orientalis CIP 102891]
 gi|260937245|gb|EEX93234.1| acetyltransferase [Vibrio orientalis CIP 102891]
          Length = 167

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 66/163 (40%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I A+       F       A ++++ +     +LS +   +   ++G V 
Sbjct: 1   MLIRTEAPADILAIDRLLKSIF--ETEAEANLVMKLRENGRRTLSLVACSDEGEVIGYVL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++I         L P+ VH  Y+N+GI  +L+     +  + G    V++GD AYY 
Sbjct: 59  FSPVTIAGSDLNWQGLAPLAVHQDYRNQGIAAELVKEGFASLLEFGYPACVVLGDPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF++    ++     V       + L         G++   
Sbjct: 119 RFGFESSAKFNMHCQWEVPEGAFQAVALADGELDGHSGLIEYS 161


>gi|163795457|ref|ZP_02189424.1| hypothetical protein BAL199_15102 [alpha proteobacterium BAL199]
 gi|159179443|gb|EDP63974.1| hypothetical protein BAL199_15102 [alpha proteobacterium BAL199]
          Length = 187

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/154 (24%), Positives = 66/154 (42%), Gaps = 9/154 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE--GKRIVGSV 88
           F  R E  S    +  ++   FG  R  R    LR       +LSF+ A+    + + ++
Sbjct: 2   FQIRSEIPSDGAAVETLNDLGFGVERRGRTVYRLRLG---APTLSFIAADPVSDQPLATL 58

Query: 89  RMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           R  P+ +       LLGP+ V P  + +G+GR L+   +  A  +G ++ ++ GD  YY 
Sbjct: 59  RFWPVMVGLDRPALLLGPLAVIPERRGEGLGRALVGHGLSVARDRGWRLCLVSGDRDYYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
             GF+        +P P++  R+    L      
Sbjct: 119 PFGFEPAAPYGFAMPGPIEAGRLQVKALTSEALD 152


>gi|170738790|ref|YP_001767445.1| GCN5-related N-acetyltransferase [Methylobacterium sp. 4-46]
 gi|168193064|gb|ACA15011.1| GCN5-related N-acetyltransferase [Methylobacterium sp. 4-46]
          Length = 187

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 4/145 (2%)

Query: 34  FLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  + I A   +    FG  RF +    LRE  +    L+ +  +  R+VG+V +
Sbjct: 2   IQIRDERATDIAAREQLLDTCFGEARFTKTCERLREGRLPAEGLALVAEQDGRLVGTVCL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             ++   +    +LGP+ V P  Q  G+G  L+  ++  A   G + ++LVGD  YY++ 
Sbjct: 62  WDVAAGPRRPALMLGPLAVEPGLQGLGVGGTLMRAALARAAALGHRAVILVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLP 174
           GF A    +L LP P    R L L 
Sbjct: 122 GFAAGAVGALWLPGPYARERFLGLD 146


>gi|209694200|ref|YP_002262128.1| putative acetyltransferase [Aliivibrio salmonicida LFI1238]
 gi|208008151|emb|CAQ78293.1| putative acetyltransferase [Aliivibrio salmonicida LFI1238]
          Length = 167

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 63/162 (38%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSICAMH---ADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++  +    L+LS +   +   ++G   
Sbjct: 1   MLIRTEAPADILTIDLLVKSVF--DTTAEAKLVMSLRENSHLTLSLVACNDDGELIGHCL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++I         L P+ V   YQ +G+   ++  + +   + G  V V++GD AYY 
Sbjct: 59  FSPVTINGEDIAWQGLAPLCVKKEYQKQGVATAMMKEAFETLTELGYPVCVVLGDPAYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+A    ++     V     +          +  G++  
Sbjct: 119 RFGFEAAEKYNMSCQWEVPEGAFMVKACDAEFLADRSGLIEY 160


>gi|262172268|ref|ZP_06039946.1| predicted acetyltransferase [Vibrio mimicus MB-451]
 gi|261893344|gb|EEY39330.1| predicted acetyltransferase [Vibrio mimicus MB-451]
          Length = 167

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    I+G V 
Sbjct: 1   MLIRTEAPADILAVDELLKTVFA--TEAEANLVMALRENGRRTLSLVACDDEGEIIGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   Y+ +GIG +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTVDGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L     V       + L +      +G+V   
Sbjct: 119 RFGFEDAAQYQLHCAWEVPLGAFRVVALWERELDGRRGLVEYS 161


>gi|160879307|ref|YP_001558275.1| GCN5-related N-acetyltransferase [Clostridium phytofermentans ISDg]
 gi|160427973|gb|ABX41536.1| GCN5-related N-acetyltransferase [Clostridium phytofermentans ISDg]
          Length = 214

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 66/172 (38%), Gaps = 20/172 (11%)

Query: 34  FLERLEHDSSICAMHA---DSFG-PGRFVRAAV----------LLREQGMHDLSLSFLCA 79
              RLE       +      +F  P R  R+ +           LRE       LSF+  
Sbjct: 2   ITIRLEKTQDHRTVEEITKLAFSYPERVERSKIGCCLEHYMVHSLRE-VDGINDLSFVAE 60

Query: 80  EGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
              +IVG +  +   I+K  G        GP+ VHP YQ +G+G  L+  S++ A+  G 
Sbjct: 61  IQGKIVGHIIYSNAYIQKPNGTKVNVLNFGPLSVHPQYQKQGLGTALMKHSIEIAKSLGY 120

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
             I+  G   YY + GF      ++      +    + + L +   + + G 
Sbjct: 121 GAILFFGRPEYYPRFGFVEAKEFNITDCNGYNYPAFMAMELKKGYLKGVSGK 172


>gi|85710023|ref|ZP_01041088.1| acetyltransferase, GNAT family protein [Erythrobacter sp. NAP1]
 gi|85688733|gb|EAQ28737.1| acetyltransferase, GNAT family protein [Erythrobacter sp. NAP1]
          Length = 171

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFV---RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       I A+   +F   +        ++ R +   DL+LS +  +G RIVG 
Sbjct: 8   ITIRPEAPGDEEIIFAITEAAFADMKHSDGDEQHLVDRLRKAGDLTLSLVAEDGTRIVGH 67

Query: 88  VRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           + ++P+  S      + LGP+ V P  Q  GIG  L+  ++      G+  IVL+G   Y
Sbjct: 68  IAISPVKISDGAKGWYGLGPVSVWPEVQRAGIGGALVKRAIADMRAAGAMGIVLLGSPEY 127

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           YS+ GFQ VP   +  P P        L L   +     G V   
Sbjct: 128 YSRFGFQYVP--QITFPGP-PAEYFQTLLLDGEMP---SGEVTYA 166


>gi|15672038|ref|NP_266212.1| hypothetical protein L1005 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12722897|gb|AAK04154.1|AE006244_3 hypothetical protein L1005 [Lactococcus lactis subsp. lactis
           Il1403]
          Length = 173

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 63/166 (37%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
              LE+ + +  +  +SF     G G        +R +  +   L  +  E  +IVG   
Sbjct: 5   TINLENYNEVTELIRESFSQSEHGYGNEAELVDKIRNEEGYIKDLEIVAFEDGKIVGHGL 64

Query: 90  MTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           ++ + I    +K  G +L P+ V   YQ KGIG  ++      A+      I ++G   Y
Sbjct: 65  LSEVEIVSDSQKFKGLVLAPLDVLTTYQGKGIGAAVLLELEKRAKILDYPFISILGHETY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y K G+       +  P  V     +   L     +   G++   E
Sbjct: 125 YPKFGYVPASQYQIKAPFEVPDKNFMIKELTDGGLEGKSGVIHYSE 170


>gi|319407635|emb|CBI81284.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 188

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 9/163 (5%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
           F    E ++       +     G  R  +++ +LR        LSF+       +VGSVR
Sbjct: 14  FTLMSEQEADALHREKLLDLIMGEERKHKSSEILRCGRFPAFGLSFVVKNFLDELVGSVR 73

Query: 90  MTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +  ++  K         LLGP+ V   Y   GIG  L+  S++ A++ G   I LVGD  
Sbjct: 74  LWNVTFHKGQNEIQDALLLGPLAVATEYSGLGIGSVLMQHSIETAKQLGHGAIFLVGDSE 133

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +Y + GF +   K+  +P   + +R   L L+        G++
Sbjct: 134 FYQRFGFSSHLTKNFAMPGAYEKHRFQALELIPQYLIGCHGLL 176


>gi|94313662|ref|YP_586871.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
 gi|93357514|gb|ABF11602.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
          Length = 168

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    +  +   +    R         A ++   +    L+LS +  +   IV
Sbjct: 1   MTISVRTERPEDVETIAQLTEAAFRGETHSSHTEAFIINGLRRAGCLTLSLVAEDESGIV 60

Query: 86  GSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V  +P++I       + +GP+ V P  Q +GIG  L+  ++D   + G++  V++G+ 
Sbjct: 61  GHVAASPVTISSGNSGWYGIGPVSVLPDRQRRGIGSVLMLAALDELRRLGARGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           AYY + GFQA     L+LP  V       L    +V     G VR  +
Sbjct: 121 AYYGRFGFQADSR--LVLPG-VPQEYFQTLAFGPDVP---VGTVRYHD 162


>gi|254719584|ref|ZP_05181395.1| acetyltransferase [Brucella sp. 83/13]
 gi|265984592|ref|ZP_06097327.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837927|ref|ZP_07470787.1| acetyltransferase [Brucella sp. NF 2653]
 gi|264663184|gb|EEZ33445.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306407015|gb|EFM63234.1| acetyltransferase [Brucella sp. NF 2653]
          Length = 164

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  E  +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTETAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I+      + LGP+ V P  Q +GIG KLI   +      G++  VL+GD  Y
Sbjct: 61  IAFSPVLIDGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y   GF+A     L     V P     L    ++ Q 
Sbjct: 121 YGHFGFKADVRLKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|149184979|ref|ZP_01863296.1| acetyltransferase, GNAT family protein [Erythrobacter sp. SD-21]
 gi|148831090|gb|EDL49524.1| acetyltransferase, GNAT family protein [Erythrobacter sp. SD-21]
          Length = 166

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRA------AVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E+ +    +   +      V        A++ R +   DL+LS +  +G+RIVG 
Sbjct: 4   LTIRPENPADHAEIAVVTEAAFAEVEHSDGSEVAIVDRLRAEGDLALSLVAEDGERIVGH 63

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P++          L PI V P  Q +G+G +L+  ++     +G++ IVL+G+ AY
Sbjct: 64  VAVSPVTISDGTTGWFGLSPISVLPSSQCEGVGLRLMQRAIADMRNQGARGIVLLGEPAY 123

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y++ GF+  P   L  P P        L L  +      G V   
Sbjct: 124 YARFGFEHDP--KLAYPGPA-AEYFQRLVLDGDAP---SGTVTYA 162


>gi|332827636|gb|EGK00378.1| hypothetical protein HMPREF9455_03331 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 345

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 64/191 (33%), Gaps = 25/191 (13%)

Query: 4   NNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVL 63
           NN+ +RK       E     ++ ++       +  E D +                    
Sbjct: 174 NNLNIRKIREEEQAEVYNLIKAAFETAKV--KDGDEQDFAQE------------------ 213

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIG 118
           LR    +   +  +     +I G +  T          K    L+ PI V P Y+N GIG
Sbjct: 214 LRHGDNYIPEMDLVAEVNNKIAGQIMFTKTYVTRTDNSKTEALLIAPISVLPEYRNLGIG 273

Query: 119 RKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
             LI      A + G + + L GD AYY + GF+      +          V+   LV  
Sbjct: 274 SALIREGFRIAREMGYKAVFLCGDPAYYHRFGFKPTSAYGIRHILEFTEENVMVYELVDA 333

Query: 179 VAQNIKGIVRC 189
             + + G V  
Sbjct: 334 TLEGMDGTVDF 344


>gi|227511093|ref|ZP_03941142.1| GNAT family acetyltransferase [Lactobacillus buchneri ATCC 11577]
 gi|227085575|gb|EEI20887.1| GNAT family acetyltransferase [Lactobacillus buchneri ATCC 11577]
          Length = 174

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 63/168 (37%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHADSF--------GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R        A+             G G        +R    +  +L  +  +  +I+
Sbjct: 1   MQIRNVRKEDYSAISDLILTAFSKSSNGYGGEAELVEKIRLDPTYHKTLEVVADQSGQII 60

Query: 86  GSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ +      +  TG  L P+ V P +Q +GIG+ +++     A++     I ++G
Sbjct: 61  GHGLLSEVQVKNANKSKTGLCLAPLEVSPSFQKQGIGQVVLAELEQRAKRAKYNFISILG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
              YYS+ G++     ++  P P   +  +   LV    + + G V  
Sbjct: 121 WPDYYSRFGYKKASLFNIKAPFPAPDDAYMIKALVPKGLEGVTGTVNY 168


>gi|210616063|ref|ZP_03290935.1| hypothetical protein CLONEX_03154 [Clostridium nexile DSM 1787]
 gi|210149971|gb|EEA80980.1| hypothetical protein CLONEX_03154 [Clostridium nexile DSM 1787]
          Length = 176

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 61/166 (36%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHAD---SFG-----PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E       +++    +FG      G        LR    +   LS +      IV
Sbjct: 7   MIIRQEETRDYENIYSVVKKAFGSAVQADGNEQDLVNALRNGDAYIPELSLVAEIDGVIV 66

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   +E      L P+ V P YQ +G+G  LI      A++   +  +++G   Y
Sbjct: 67  GHIMFTKAKVEDKVVLALAPLSVLPEYQRQGVGTALIEEGHRIAKELNYEYSIVLGSETY 126

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       +  P  V     +   L    A  I G++R  +
Sbjct: 127 YPRTGYLPANMFGITAPFEVPQENFMAYKLKD-AAGKICGVLRYAK 171


>gi|153835039|ref|ZP_01987706.1| hypothetical acetyltransferase YhbS [Vibrio harveyi HY01]
 gi|148868516|gb|EDL67615.1| hypothetical acetyltransferase YhbS [Vibrio harveyi HY01]
          Length = 167

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 61/161 (37%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   +VG    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTEAEANLVMRLRENGKLTLSLVACTDEGEVVGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GI  +LI    D+    G  V V++GD  YY + 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIAAELIKEGFDSLRDFGYPVCVVLGDPDYYGRQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+A           V         LV+       G +   
Sbjct: 121 GFRASEEMGFDCAWEVPQGAFRVAELVEGQCDGRSGRIDYS 161


>gi|67484300|ref|XP_657370.1| acetyltransferase, GNAT family [Entamoeba histolytica HM-1:IMSS]
 gi|56474624|gb|EAL51986.1| acetyltransferase, GNAT family [Entamoeba histolytica HM-1:IMSS]
          Length = 174

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 66/170 (38%), Gaps = 12/170 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
              R E  S    ++       +    +        V +RE   +  SLS +     +I+
Sbjct: 1   MQIREEQPSDYEEIYQLVQTAFKTAEHSCGTEQNIVVKIRESDNYIKSLSLVGILQGKII 60

Query: 86  GSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G V ++ I    +      + + P+ + P  Q KG G +L+   +  A+K G   + L G
Sbjct: 61  GHVMISKISIINNQNTYNSYAIAPLSIAPDQQRKGYGSQLMKEVISRAQKLGITHLTLFG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           D  +Y   GF+      +    P D N  + + L +     I GI++  +
Sbjct: 121 DDHFYHTFGFETSTKYGIKTDIPCDENNCMVIQLQEQGLTGINGIIKYPD 170


>gi|170751045|ref|YP_001757305.1| GCN5-related N-acetyltransferase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657567|gb|ACB26622.1| GCN5-related N-acetyltransferase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 183

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 70/163 (42%), Gaps = 4/163 (2%)

Query: 34  FLERLEHD---SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R EH     +   +    F   R  + +  LRE  +    L+F      R+VG++R+
Sbjct: 2   IEIRAEHLHHVPARERLLDACFPGNRRAKTSERLREGRLPARGLAFAATRAGRLVGTLRL 61

Query: 91  TPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
             +         LLGP+ V P  Q +G+G  ++  ++  AE  G   ++LVGD  YY++ 
Sbjct: 62  WHVEAGLARPALLLGPLAVDPAIQGQGLGSVMMQAALGRAESLGHGAVLLVGDAPYYARF 121

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           GF       L LP P +  R L L L         G+VR   V
Sbjct: 122 GFDRALADGLTLPGPFERARFLGLELRAGALAGAAGMVRATGV 164


>gi|254507529|ref|ZP_05119663.1| hypothetical acetyltransferase YhbS [Vibrio parahaemolyticus 16]
 gi|219549599|gb|EED26590.1| hypothetical acetyltransferase YhbS [Vibrio parahaemolyticus 16]
          Length = 167

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 64/161 (39%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLC-AEGKRIVGSVRMT 91
            L R E  + I A+             A ++++ +     SLS +   +   +VG +  +
Sbjct: 1   MLIRTEAPADILAVDRLLKSAFDTEAEANLVMKLRENGRRSLSLVASTDEGEVVGYLLFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ V   ++ +GI  +L+     +  + G    V++GD AYYS+ 
Sbjct: 61  PVTLNGEDFNWQGLAPLAVKEEFRGQGIAAQLVKEGFASLFELGYPACVVLGDPAYYSRF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF +    ++     V         L ++      G+V   
Sbjct: 121 GFVSAEQHNMHCKWEVPAGAFQVKTLAEDEFSGRSGLVEYS 161


>gi|311107466|ref|YP_003980319.1| GNAT family acetyltransferase [Achromobacter xylosoxidans A8]
 gi|310762155|gb|ADP17604.1| acetyltransferase, GNAT family protein 21 [Achromobacter
           xylosoxidans A8]
          Length = 165

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 58/148 (39%), Gaps = 11/148 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
                E      A+ A +    +           +    +    L+LS +     RI G 
Sbjct: 1   MHILPEAPGDRDAIFALTQAAFKDHPHSQQTEGYITNALREAGALALSLVARVDGRIAGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++        + LGP+ V P  Q +GIG  L+   ++  +  G+   V++GD AY
Sbjct: 61  VAFSPVTVSDGSADWYGLGPVAVLPELQGQGIGAALVRDGLERLKALGAAGCVVMGDPAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFL 173
           Y + GF  +P   L  P  V P   +  
Sbjct: 121 YGRFGFAQMP--GLTYPG-VPPEYFMAQ 145


>gi|20090553|ref|NP_616628.1| acetyltransferase [Methanosarcina acetivorans C2A]
 gi|19915583|gb|AAM05108.1| acetyltransferase [Methanosarcina acetivorans C2A]
          Length = 217

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 68/175 (38%), Gaps = 13/175 (7%)

Query: 25  SRWQKIGAFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSF 76
            R +K       RLE +     +   +       + PG         +R+       L F
Sbjct: 8   RREEKTTMNISIRLEEEKDFKNVEYMTREAFWDLYKPGCDEHLVLHKIRKVPAFVKELDF 67

Query: 77  LCAEGKRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
           +  +   IVG++  +         ++     +GP  V P  Q +GIG  L++ S++ A +
Sbjct: 68  VACDEDTIVGNIIYSRAKVIDSENKEFEVLCMGPFAVLPSSQKQGIGSLLMNHSIEKARQ 127

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
            G + I++ G+  YY + GF +    ++      + +  + L L     + + G 
Sbjct: 128 LGYKGIIIFGNPDYYHRFGFVSAKEYNIWTSWGDNFDAFMALELYDGSLKGVSGK 182


>gi|306843103|ref|ZP_07475725.1| acetyltransferase [Brucella sp. BO2]
 gi|306286708|gb|EFM58261.1| acetyltransferase [Brucella sp. BO2]
          Length = 164

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 63/157 (40%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E       +   +    R V         ++   +    L+LS +  E  +++G 
Sbjct: 1   MHIRKERPQDAAEIRQVTETAFRPVAYSNQKEGEIVDVLRAAKALTLSLVAEEDGQVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+ I+      + LGP+ V P  Q +GIG KLI   +      G++  VL+G+  Y
Sbjct: 61  IGFSPVLIDGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGEPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+A     L     V P     L    ++ Q 
Sbjct: 121 YGRFGFKADARLKL---PGVPPEYFQCLAFGPDMPQG 154


>gi|86148605|ref|ZP_01066888.1| Predicted acetyltransferase [Vibrio sp. MED222]
 gi|218710433|ref|YP_002418054.1| putative acetyltransferase [Vibrio splendidus LGP32]
 gi|85833596|gb|EAQ51771.1| Predicted acetyltransferase [Vibrio sp. MED222]
 gi|218323452|emb|CAV19629.1| Predicted acetyltransferase [Vibrio splendidus LGP32]
          Length = 167

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 64/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++  +    L+LS +   +   +VG + 
Sbjct: 1   MLIRTEAPADILVIDRLLKSVF--ETDAEANLVMSLRENSHLTLSLVACSDEGEVVGHLM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   ++N+GI + L+  +       G    V++GD AYY 
Sbjct: 59  FSPLTLDGDDHNWQGLAPLAVKEEFRNQGIAKSLVEDAFSTLVDFGYPACVVLGDPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+A     L     V       + LV+       G +   
Sbjct: 119 RFGFKAASEFGLSCVWDVPEGAFQAIELVEGAFAGHSGEIAYS 161


>gi|254504828|ref|ZP_05116979.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
 gi|222440899|gb|EEE47578.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
          Length = 183

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 75/151 (49%), Gaps = 4/151 (2%)

Query: 39  EHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPISIE- 96
            H  +  A+   SFG  R ++ +  LRE  +     +F   +   ++VG+VR+  ++   
Sbjct: 10  THVCAREALLDLSFGLDRHLKTSERLREGRLPV--FAFTALDANGKLVGTVRLWAVADRW 67

Query: 97  KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
           +    LLGP+ V P  +   +G +L+  +++ A   G   ++LVGD+ YY + GF A   
Sbjct: 68  EHQSLLLGPVAVDPQCRGLKVGDRLMQHALNQAALHGHGSVLLVGDLPYYERFGFAAGLL 127

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           + ++LP PVD  R L L L       + G +
Sbjct: 128 EDVMLPGPVDYRRFLGLELAPGHLAGLDGTL 158


>gi|258624696|ref|ZP_05719630.1| putative acetyltransferase [Vibrio mimicus VM603]
 gi|258582983|gb|EEW07798.1| putative acetyltransferase [Vibrio mimicus VM603]
          Length = 167

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 66/163 (40%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    I+G V 
Sbjct: 1   MLIRTEAPADILAVDELLKTVFA--TEAEANLVMALRENGRRTLSLVACDDEGEIIGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   Y+ +GIG +L+   + +  + G    V++GD  YYS
Sbjct: 59  FSPVTVDGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDPVYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L     V       + L +      +G+V   
Sbjct: 119 RFGFEDAAQYQLHCAWEVPQGAFRVVALWERELDGRRGLVEYS 161


>gi|84387273|ref|ZP_00990294.1| Predicted acetyltransferase [Vibrio splendidus 12B01]
 gi|84377920|gb|EAP94782.1| Predicted acetyltransferase [Vibrio splendidus 12B01]
          Length = 167

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 64/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++  +    L+LS +   +   +VG + 
Sbjct: 1   MLIRTEAPADILVIDRLLKSVF--ETDAEANLVMSLRENSHLTLSLVACSDEGEVVGHLM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +PI++         L P+ V   Y+N+GI + L+  +       G    V++GD AYY 
Sbjct: 59  FSPITLHGDDHNWQGLAPLAVKEEYRNQGIAKSLVEDAFSTLVDFGYPACVVLGDPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+A     L     V       + LV+ V     G +   
Sbjct: 119 RFGFKAASEFGLSCVWDVPEGAFQAIELVEGVFAGHSGEIAYS 161


>gi|149189782|ref|ZP_01868063.1| acetyltransferase [Vibrio shilonii AK1]
 gi|148836431|gb|EDL53387.1| acetyltransferase [Vibrio shilonii AK1]
          Length = 171

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 63/166 (37%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I A+       F       A +++  +    L+LS +   +   ++G + 
Sbjct: 1   MLIRTEAPADILAIDRLLKSVF--DTDAEANLVMALRENGRLTLSLVACSDEGEVIGHLL 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP++I+        L P+ V   +Q +G+   L+  +     + G    V++GD +YY 
Sbjct: 59  FTPVTIDGDDLSWQGLAPLAVAKEHQGQGVASALVEEAFTTLPEFGYPACVVLGDPSYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNV----AQNIKGIVRC 189
           +  F A     L     V         L ++         KG+V  
Sbjct: 119 RFQFSAAADYDLHCQWEVPEGAFQVRSLTEDSVAEQLAGRKGLVDY 164


>gi|325838844|ref|ZP_08166691.1| acetyltransferase, GNAT family [Turicibacter sp. HGF1]
 gi|325490707|gb|EGC93016.1| acetyltransferase, GNAT family [Turicibacter sp. HGF1]
          Length = 169

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 64/170 (37%), Gaps = 13/170 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFV------RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R EH+     ++                    +  LR    +   L+ +      
Sbjct: 1   MNLIIRTEHEKEFNQIYDFVRIAFETAQVSDGNEQNFVNELRASENYIPELALVALVDGN 60

Query: 84  IVGSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + +T        +     LL P+ V   Y+ +GIG KL+  S + A K G   +VL
Sbjct: 61  IIGHIMLTKYIVQDLNQNHDVLLLAPLSVDLNYRGQGIGSKLVMKSFELARKMGYTAVVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           VGD AYY + GF++     +     +    +    LV+    N+ G +  
Sbjct: 121 VGDPAYYQRFGFKSSVDFGINCH-EIPAQYIQACELVEGSLDNVFGTLTF 169


>gi|271967131|ref|YP_003341327.1| acetyltransferase [Streptosporangium roseum DSM 43021]
 gi|270510306|gb|ACZ88584.1| putative acetyltransferase [Streptosporangium roseum DSM 43021]
          Length = 169

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 53/145 (36%), Gaps = 4/145 (2%)

Query: 37  RLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMHD--LSLSFLCAE-GKRIVGSVRMTP 92
           R E +  I A+   + G     + A ++   +        LS +       + G   +T 
Sbjct: 8   RPETERDIPAIREVTLGAFPTPLEADLVEALRADPAWLPELSVVATSADGTVAGYALLTR 67

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
             +  +    LGP  V P +Q +G G   I   + AA   G  +++++G   YY + GF 
Sbjct: 68  CHVGDVPALALGPCAVLPRHQRQGAGSAAIRAGLGAARDMGENLVLVLGHPEYYPRFGFT 127

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQ 177
                 +     V    ++ L    
Sbjct: 128 RASSYGIHPSFEVPDEAMMALVFDD 152


>gi|78066683|ref|YP_369452.1| GCN5-related N-acetyltransferase [Burkholderia sp. 383]
 gi|77967428|gb|ABB08808.1| GCN5-related N-acetyltransferase [Burkholderia sp. 383]
          Length = 181

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 37  RLEHDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
           R     +I  +   +F     G      ++   +    LS+S +     R++G V  +P+
Sbjct: 18  RASEGDAIGRVIVAAFAGEPEGGQFERRIVDTLRADGALSVSLVAERDGRLIGHVAFSPV 77

Query: 94  SIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           SI          + L P+ V P  Q + IG  L+   +DA  + G++  VL+G+ AYY++
Sbjct: 78  SIGGELSGSQGWYGLAPLAVLPDCQRQSIGAGLVRTGLDALRRIGARGCVLLGEPAYYTR 137

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
            GF   P   ++ P  V P   L L L  +  +   G VR  +V
Sbjct: 138 FGF--APSGDIVFPG-VPPEYFLALSLDDSAPRP-SGDVRYHDV 177


>gi|134103474|ref|YP_001109135.1| acetyltransferase [Saccharopolyspora erythraea NRRL 2338]
 gi|133916097|emb|CAM06210.1| acetyltransferase [Saccharopolyspora erythraea NRRL 2338]
          Length = 167

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 59/159 (37%), Gaps = 5/159 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHD--LSLSFLCA-EGKRIVGSVRM 90
             R E  + I A+ A +         A ++   +        LS +       I G V +
Sbjct: 4   RTRPETAADIAAIRAVNLAAFPTALEADLVDALRAGPAWIDGLSIVVETAAGEIAGHVLL 63

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T   ++      LGP  V P +Q  G G   IS  +DAA   G  +++++G   YY + G
Sbjct: 64  TRSHVDGSPALTLGPCAVLPRHQRAGAGSAGISAGLDAARAMGENLVLVLGHPDYYPRFG 123

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           F       + L   V    ++ L L  +      G V  
Sbjct: 124 FTRASEFGIGLTIEVPDEAMMALALDPHGHVP-SGTVEY 161


>gi|226942100|ref|YP_002797174.1| acetyltransferase [Laribacter hongkongensis HLHK9]
 gi|226717027|gb|ACO76165.1| Predicted acetyltransferase [Laribacter hongkongensis HLHK9]
          Length = 169

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 12/158 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  S I A+   +                ++   +    L+LS +  E  ++ 
Sbjct: 1   MSLHLRPEQPSDINAISELTREAFLNAPHTSHTEQFIVNALRRSGQLTLSLVALEHGQLA 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG-SQVIVLVGD 142
           G + ++P++        + +GP+ V P  Q +GIG +L+  ++   +++  +   VL+GD
Sbjct: 61  GHIALSPVTLSCGTPGWYGIGPLSVRPDCQQRGIGSQLVRQALSTLQQQTGASGCVLLGD 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
            AYYS+ GF  VP   L LP  + P     L     V 
Sbjct: 121 PAYYSRFGF--VPDTGLTLPG-IPPGYFQALSFGPPVP 155


>gi|147920909|ref|YP_685284.1| GNAT family acetyltransferase [uncultured methanogenic archaeon
           RC-I]
 gi|110620680|emb|CAJ35958.1| putative acetyltransferase (GNAT family) [uncultured methanogenic
           archaeon RC-I]
          Length = 185

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 63/174 (36%), Gaps = 19/174 (10%)

Query: 32  AFFLERLEHDSSICAMHADSF-GPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVG-- 86
                R E      ++    F   G      ++  LR+   +D  LS +      IVG  
Sbjct: 1   MKIEIRAERAGDEASIREVGFLAFGDDGNICIVDVLRKSPSYDRELSLVSVISDSIVGPD 60

Query: 87  --------------SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKK 132
                         +  +      ++    LGPI V P  Q +GIG  L+   ++   +K
Sbjct: 61  SIVGPDSIVGHILFNPMVIRTPDGEVPALYLGPIAVRPELQRQGIGSALMRAGLEKCREK 120

Query: 133 GSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
           G ++++L G   YY + GF     + L  P  +     + L LV      ++G 
Sbjct: 121 GHRIVLLSGHPEYYPRFGFTPARDRGLEAPEWIPDEAFMVLELVPGALNGVRGT 174


>gi|264677515|ref|YP_003277421.1| GCN5-related N-acetyltransferase [Comamonas testosteroni CNB-2]
 gi|262208027|gb|ACY32125.1| GCN5-related N-acetyltransferase [Comamonas testosteroni CNB-2]
          Length = 166

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 67/157 (42%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E  +   A+   +    +           ++   +    L+LS +    ++IVG 
Sbjct: 1   MQIRAELPADAQAIEQVTIQAFKDAPHTNHTEQFIVRELRAAGALALSLVAEIDEQIVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V ++P++     +    LGPI V P  Q +GIG  L+  ++ A + + ++  VL+GD  Y
Sbjct: 61  VAISPVTISDGSLHWFGLGPISVIPQEQRQGIGSALMQAAISAVQAQSARGCVLLGDPEY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+ VP   L+LP  V       L       Q 
Sbjct: 121 YRRFGFRTVP--GLVLPG-VPAEYFQALTFEGLPPQG 154


>gi|269961992|ref|ZP_06176347.1| putative acetyltransferase [Vibrio harveyi 1DA3]
 gi|269833315|gb|EEZ87419.1| putative acetyltransferase [Vibrio harveyi 1DA3]
          Length = 167

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 63/161 (39%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   +VG    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTDAEANLVMRLRENGKLTLSLVACTDEGEVVGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P++++        L P+ VH  Y+ +GI  +LI    D+    G  V V++G+  YY++ 
Sbjct: 61  PVTLDGEDLSWQGLAPLAVHEDYRRQGIAAELIKEGFDSLRDFGYPVCVVLGEPDYYARQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+A           V         LV+       G +   
Sbjct: 121 GFKAAEDMGFDCAWEVPQGAFRVAELVEGQCDGRSGRIDYS 161


>gi|167375930|ref|XP_001733783.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904957|gb|EDR30079.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
          Length = 174

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 66/168 (39%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
              R E  S    ++       +    +        + +RE   +  +LS +     +I+
Sbjct: 1   MQIREEQPSDYNEIYLLVQNAFKTTEHSSGTEQDIVIKIRESNNYIKNLSLVGILQGKII 60

Query: 86  GSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + ++ I    +      + + P+ + P  Q KG G +L+   +  A+K G   + L G
Sbjct: 61  GHIMVSKISIVNNQNTYNSYAIAPLSIAPDQQRKGYGSQLMKEVISRAQKLGLTHLTLFG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           D  +Y + GF+      +    P D    + + L +     IKGI++ 
Sbjct: 121 DDQFYHRFGFETSTKYGIKTDIPCDEKNCMVIQLQEQGLIGIKGIIKY 168


>gi|87310822|ref|ZP_01092949.1| acetyltransferase, GNAT family protein [Blastopirellula marina DSM
           3645]
 gi|87286579|gb|EAQ78486.1| acetyltransferase, GNAT family protein [Blastopirellula marina DSM
           3645]
          Length = 169

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 7/164 (4%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
            + R E    + A+ A             ++ + +      LS +  E  +I+G +  TP
Sbjct: 1   MIIRPETSDDVPAIRALLLAAFPTAIENEIVDQLRDCGCDQLSLVAEEDGQIIGQILFTP 60

Query: 93  ISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            +IEK    + G  L P+ V P  Q +G+G +LI   +      G+  ++++GD  YY K
Sbjct: 61  ATIEKNGRVVRGWGLAPVSVSPKAQRRGVGAQLIETGLAQLRDSGALFVIVLGDFNYYPK 120

Query: 149 LGFQAVPWKSLILP-APVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            GFQ     ++    A V     + +    +   +  GI + R+
Sbjct: 121 FGFQPASQWNVRSELAGVPDEAFMMISYNDDAIAD-GGIAKYRQ 163


>gi|332522343|ref|ZP_08398595.1| acetyltransferase, GNAT family [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313607|gb|EGJ26592.1| acetyltransferase, GNAT family [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 169

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 59/153 (38%), Gaps = 8/153 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
            + R E      A++            +          LRE   +   L+ +    +++ 
Sbjct: 1   MIIRQEEKEDFKAIYQLVTEAFASAEHSDGTEQDLVEALREGDSYIAELALVLEVDQQLR 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   + +    +L P+ V P YQ +G G  LI      A+  G  +I+++G   Y
Sbjct: 61  GHIMFTKAKVGQHEALVLAPLSVAPCYQKQGYGGALIDRGHQVAKDLGYDLILVLGSERY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
           Y K G+Q   +  + LP    P   + L L  N
Sbjct: 121 YPKFGYQPAEFFGISLPEGFPPENFMALSLCGN 153


>gi|296104870|ref|YP_003615016.1| GCN5-related N-acetyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059329|gb|ADF64067.1| GCN5-related N-acetyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 167

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    ++L  +  +   ++VG V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRSFA--SDAEAQLVHDLREDGLITLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A+Y 
Sbjct: 59  FSPVTVQGEELQWVGMAPLAVDEHYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPAFYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P          L  +    + G+V   +
Sbjct: 119 RLGFEPAAQYDLRCHWPGTETAFQVHRLADDALNGVNGLVEYHD 162


>gi|51244095|ref|YP_063979.1| hypothetical protein DP0243 [Desulfotalea psychrophila LSv54]
 gi|50875132|emb|CAG34972.1| hypothetical protein DP0243 [Desulfotalea psychrophila LSv54]
          Length = 172

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 65/166 (39%), Gaps = 8/166 (4%)

Query: 34  FLERLEHDSSICAMHADSFGPG----RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
            + R      + A++A          R + A + +         LS +      ++G + 
Sbjct: 1   MIIRESKSRELEAIYALHMAAFDADERELVAKLAIDLIKAAHPLLSLVAVSDDLVIGHIL 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            +P+SI         +L P+ V P  Q +G+G +LI   +     +G+ V+ ++GD  YY
Sbjct: 61  FSPVSISNNDNLSCFILAPLAVSPARQRQGVGSQLIEHGLRTLTAQGADVVFVLGDPDYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           S+ GF  V   S     P  P       L     Q + G V C  V
Sbjct: 121 SRSGFHPVHDVSPSYSLPY-PEAWQAKELRVGALQGVSGTVECVSV 165


>gi|170733272|ref|YP_001765219.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia MC0-3]
 gi|169816514|gb|ACA91097.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia MC0-3]
          Length = 182

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 12/165 (7%)

Query: 36  ERLEHDSSICAMHADSFGP---GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER     +   +   +F     G      ++   +    LS+S +     RIVG V  +P
Sbjct: 17  ERASEADAFGRVIRAAFADKPQGGEFEQRIVDTLRADGALSVSLVAERDGRIVGHVAFSP 76

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I          + L P+ V P  Q + IG  L+   +DA  + G++  V++G+ AYY+
Sbjct: 77  VAIGGEPAGSQQWYGLAPLAVRPDCQRQSIGAGLVRTGLDALRRLGARGCVVLGEPAYYT 136

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GF+  P   ++ P  V P   L LP  ++      G VR  +V
Sbjct: 137 RFGFE--PHGDIVFPG-VPPEYFLALPFDESAPLPA-GDVRYHDV 177


>gi|293605880|ref|ZP_06688250.1| GNAT family acetyltransferase [Achromobacter piechaudii ATCC 43553]
 gi|292815667|gb|EFF74778.1| GNAT family acetyltransferase [Achromobacter piechaudii ATCC 43553]
          Length = 169

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 71/166 (42%), Gaps = 14/166 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E  + + A+HA +                +L   +    L++S +      +VG+
Sbjct: 4   LILRSETPADVAAIHAVTEAAFLDAPHTSHNEQFILAALRDAGVLTVSLVAEMDGSVVGN 63

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P+S          LGP+ V P  Q +GIG +LI  ++      G+   V++G+ +Y
Sbjct: 64  VAASPVSISDGTSGWFGLGPVSVIPKLQGRGIGSQLIREALARLSDLGASGCVVLGEPSY 123

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + GF  +   +L+LP  V P   + +   Q +     G V   +
Sbjct: 124 YKRFGF--MNEAALVLP-DVPPEYFMAMSFGQPLP---SGTVTYHQ 163


>gi|94498678|ref|ZP_01305229.1| acetyltransferase-like protein [Sphingomonas sp. SKA58]
 gi|94421841|gb|EAT06891.1| acetyltransferase-like protein [Sphingomonas sp. SKA58]
          Length = 179

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 8/157 (5%)

Query: 41  DSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSF-LCAEGKRIVGSVRMTPISIEKIT 99
             +I A+   +FGP R  R A  +RE      +LS  +   G  ++G+++  P+++ +  
Sbjct: 19  SDAIEALLDAAFGPDRHGRTAYRIREGMAIIPALSVAIAGRGGELIGTLQSWPVALTQAD 78

Query: 100 GH-----LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL-GFQA 153
           G      ++GP+ V P +Q  G GR ++   +  A    ++ ++++GD  YY +  GF A
Sbjct: 79  GQQIPLIMIGPVAVAPAHQQDGHGRAMMDAVIGKARALRTEPLMMIGDPEYYGRFWGFTA 138

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
                   P P +  R+L L L        +G++  R
Sbjct: 139 DGTGGWDAPGPFEKRRLLALSL-DGRPVGGEGMLTPR 174


>gi|319781641|ref|YP_004141117.1| GCN5-related N-acetyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167529|gb|ADV11067.1| GCN5-related N-acetyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 189

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 6/161 (3%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVR 89
           F+   E  + +    A+   + GP R  +++  LR        L+F+  +    + G+VR
Sbjct: 14  FMMVAETAADVSAREALLDRAMGPKRRKKSSEKLRRGRRPSEGLAFVARDASGGVAGTVR 73

Query: 90  MTPISIEKITGHLLGPIV--VHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           +  + + +     L      V P  +N GIG  L+  ++  A + G   I+LVGD  YY+
Sbjct: 74  LWDVRLGEGGAAALLLGPLAVDPSLKNAGIGSALMRHAIAEAARLGHAAILLVGDAPYYA 133

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVR 188
           + GF A    SL +P P + +R+L L LV+     + G ++
Sbjct: 134 RFGFSAEKTGSLAMPGPYERHRLLALELVEGALDGVHGTLK 174


>gi|237733418|ref|ZP_04563899.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229383453|gb|EEO33544.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 169

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 63/166 (37%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
            + R E       ++            +        + LR    +   LS +     ++V
Sbjct: 1   MIIRPEEKQDFNEIYTVVKAAFATAEHSDGNEQDLVIALRTGNNYIQKLSLVAKIDNQLV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   +   T  +L P+ + P +Q +GIG  LI+     A++ G +  +++G   Y
Sbjct: 61  GYIMFTTAKVGNDTVLVLAPLAILPAFQKQGIGSALINKGHQIAKELGYEYCLVLGSEHY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       + +P  +     +   L+    + I G V+  +
Sbjct: 121 YPRFGYLPAEQFGIKVPKGIPSINFMAKKLIFRAGK-ISGEVKYAK 165


>gi|182678603|ref|YP_001832749.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634486|gb|ACB95260.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 167

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 65/168 (38%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSS---ICAMHADSF---GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E       I  +   +F           A++   +    L++S +    K +V
Sbjct: 1   MNIEIRAERAGDAQTIRQVTDTAFKLNTHSSGTEGAIIDALREARALTVSLVATVDKEVV 60

Query: 86  GSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V  +P++I+        LGP+ V P +  +GIG  LI   +   ++ G+   +L+GD 
Sbjct: 61  GHVAFSPVTIDGRDLSWFGLGPVSVRPDFHRQGIGGALIREGLVRLKQAGAAGCLLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           A+Y + GF+  P               L LP   +      GIV   E
Sbjct: 121 AFYRRFGFENDPALKFE---DAPAEYFLRLPFGSSTP---SGIVAFHE 162


>gi|320540186|ref|ZP_08039841.1| putative predicted acyltransferase with acyl-CoA N-acyltransferase
           domain [Serratia symbiotica str. Tucson]
 gi|320029852|gb|EFW11876.1| putative predicted acyltransferase with acyl-CoA N-acyltransferase
           domain [Serratia symbiotica str. Tucson]
          Length = 168

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 9/165 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE--GKRIVGSV 88
            L R+E       I  +    F  GR   A ++ + +    L+L  +  +  G  IVG  
Sbjct: 1   MLIRVEIPVDAVGIDVLLHRVF--GRDDEADLVQQLREAGLLTLGIVATDNKGGGIVGYA 58

Query: 89  RMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
             +P+++         L P+VV    + +G+G KLI   +DA  +     +V++GD AYY
Sbjct: 59  AFSPVNVAGEDRQWVGLAPLVVDESLRRQGLGEKLIYEGLDALNEFSYAAVVVLGDPAYY 118

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            + GF+      L              PLV++    + G+V   E
Sbjct: 119 GRFGFKLAAAHGLHCRWSGAETAFQVYPLVEDALSGVNGVVEYSE 163


>gi|153008945|ref|YP_001370160.1| GCN5-like N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560833|gb|ABS14331.1| GCN5-related N-acetyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 164

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 8/153 (5%)

Query: 35  LERLEHDSSICAMHADSF---GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            E  E  + I  +  ++F            ++   +    L+LS +  +   I+G V  +
Sbjct: 5   KETSEDAAEIRHLTDEAFRTVAYSNQKEGEIVDALRATKALTLSLVAEDKGEILGHVAFS 64

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+ I       + LGP+ V P  Q +GIG KLI   +      G++  VL+GD  YY + 
Sbjct: 65  PVLIGGEDKGWYGLGPVSVRPDRQGEGIGGKLIREGLAQLRAAGAKGCVLLGDPGYYGRF 124

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           GF+A     L     V       L    ++ Q 
Sbjct: 125 GFKADARLKL---PGVPAEYFQCLAFGADMPQG 154


>gi|194334357|ref|YP_002016217.1| GCN5-related N-acetyltransferase [Prosthecochloris aestuarii DSM
           271]
 gi|194312175|gb|ACF46570.1| GCN5-related N-acetyltransferase [Prosthecochloris aestuarii DSM
           271]
          Length = 172

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 61/155 (39%), Gaps = 11/155 (7%)

Query: 29  KIGAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGK 82
            +    L R E    +  +   +                V+   +  + L+LS +     
Sbjct: 1   MMTPEILIRDEVPDDVADICDVTVAAFESMEISNHTEQFVIDALRAANALTLSLVAEVNG 60

Query: 83  RIVGSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           ++VG +  +P++        + LGP+ V P+YQ KGIG  LI   +   +  G++   LV
Sbjct: 61  QVVGHIAFSPVTISDGTDNWYGLGPVSVLPVYQRKGIGSALIEKGLSRLKDLGAKGCCLV 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           G   YY + GF +V    L LP  V       L  
Sbjct: 121 GHPLYYRRFGFDSV--VGLGLPG-VPDEAFFVLSF 152


>gi|284802180|ref|YP_003414045.1| hypothetical protein LM5578_1936 [Listeria monocytogenes 08-5578]
 gi|284995322|ref|YP_003417090.1| hypothetical protein LM5923_1887 [Listeria monocytogenes 08-5923]
 gi|284057742|gb|ADB68683.1| hypothetical protein LM5578_1936 [Listeria monocytogenes 08-5578]
 gi|284060789|gb|ADB71728.1| hypothetical protein LM5923_1887 [Listeria monocytogenes 08-5923]
          Length = 172

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +  +LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRRSDYYQPALSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y + GF      ++     V     + L L     +N+ G +  
Sbjct: 121 YPRFGFIPSEQFAIPALFDVPAEYFMLLELYDGSLENLAGTIHY 164


>gi|304311914|ref|YP_003811512.1| Predicted acetyltransferase [gamma proteobacterium HdN1]
 gi|301797647|emb|CBL45868.1| Predicted acetyltransferase [gamma proteobacterium HdN1]
          Length = 170

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 68/164 (41%), Gaps = 14/164 (8%)

Query: 35  LERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
             R E  + I ++ A +                ++   +    L++S +      +VG +
Sbjct: 6   QIRKEVPADIPSIEAIAVAAFLNAPHTSHTEQHIVNALRRSGALTISLVAELDGVLVGHI 65

Query: 89  RMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            ++P+S          LGPI V P YQ  G+G  L++ ++ A  ++G+Q  VL+GD  YY
Sbjct: 66  ALSPVSISDGSAHWFGLGPISVLPEYQGHGVGSALMAAALAALRQRGAQGCVLLGDPGYY 125

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF A P   L     V P     L L        +GIV   
Sbjct: 126 GRFGFCATPDLVLS---GVPPEYFQALHL---GTATARGIVTYH 163


>gi|261212234|ref|ZP_05926520.1| acetyltransferase [Vibrio sp. RC341]
 gi|260838842|gb|EEX65493.1| acetyltransferase [Vibrio sp. RC341]
          Length = 167

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 62/163 (38%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+       F       A +++  +     +LS +  +    I+G V 
Sbjct: 1   MLIRTEAPADILAVDELLKNVFA--TEAEANLVMALRENGKRTLSLVACDDEGAILGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   Y+ +GIG  L+   + +  + G    V++GD  YY+
Sbjct: 59  FSPVTVAGEDLNWQGLAPLAVKEEYRRQGIGADLVKEGLSSLGELGYPACVVLGDPDYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L             + L +       G++   
Sbjct: 119 RFGFEDAASYQLHCAWDAPQGAFRVVALWERELDGRSGLIEYS 161


>gi|260775414|ref|ZP_05884311.1| predicted acetyltransferase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608595|gb|EEX34760.1| predicted acetyltransferase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 167

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 66/161 (40%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I A+             A +++R +     +LS +   +   +VG V  +
Sbjct: 1   MLIRTEAPADILAVDRLLKSAFETETEADLVMRLRENGRRTLSLVACNDEGELVGHVMFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ +   Y+ +G+  +L+   +++ ++ G    V++G+  YYS+ 
Sbjct: 61  PVTLNGEDLNWQCLAPLAIKADYRRQGLAAELVKEGLESLKEFGYPACVVLGEPEYYSRF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+A    S              L L +N   +  G +   
Sbjct: 121 GFEASEKYSFCCQWEASAGAFQVLALAENEFTDRSGRIEFS 161


>gi|227822020|ref|YP_002825991.1| acetyltransferase [Sinorhizobium fredii NGR234]
 gi|227341020|gb|ACP25238.1| acetyltransferase [Sinorhizobium fredii NGR234]
          Length = 150

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 58  VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE--KITGHLLGPIVVHPLYQNK 115
               ++ R +    L+LS +  EG+ ++G +  +P++I       + LGP+ V P  Q +
Sbjct: 15  TEPLIIDRLRVAGALTLSLVAVEGEEVIGHIAFSPVTITPVAAGWYGLGPVAVGPDRQGR 74

Query: 116 GIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           GIG  L+   ++   + G+   VL G+ A+Y + GF+  P   L+ P    P   + L L
Sbjct: 75  GIGSALVREGLEKLRELGAAGCVLAGNPAFYQRFGFRNDPA--LVFPG-CAPQYFMVLAL 131

Query: 176 VQNVAQNIKGIVRCR 190
            +     + G V   
Sbjct: 132 SE---ARVSGTVAYH 143


>gi|319404653|emb|CBI78255.1| Acetyltransferase [Bartonella rochalimae ATCC BAA-1498]
 gi|319404672|emb|CBI78274.1| Acetyltransferase [Bartonella rochalimae ATCC BAA-1498]
          Length = 194

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 71/166 (42%), Gaps = 9/166 (5%)

Query: 31  GAFFLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVG 86
           GA F    E ++       +     G  R  +++ +LR        LSF+       +VG
Sbjct: 11  GARFTLMSEQEADALHREKLLDLVMGEERKHKSSEILRCGRFPAFGLSFVVKNFLDELVG 70

Query: 87  SVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           SVR+  I+  K         LLGP+ V       GIG  L+  S++ A++ G   I LVG
Sbjct: 71  SVRLWNITFHKGQNEIQGALLLGPLAVATECSGLGIGSVLMQHSIETAKQLGHGAIFLVG 130

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           D  +Y + GF +   K+  +P   + +R   L L+        G++
Sbjct: 131 DSEFYQRFGFSSHLTKNFAMPGVYEKHRFQALELIPQYLIGCHGLL 176


>gi|116054466|ref|YP_792583.1| hypothetical protein PA14_55117 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115589687|gb|ABJ15702.1| hypothetical protein PA14_55117 [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 305

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 69/178 (38%), Gaps = 14/178 (7%)

Query: 17  FEFICWRRSRWQ---KIGAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQ 67
           F F C RR + +           R E    I A+   +    R           ++   +
Sbjct: 120 FLFHCPRRDKARVPRSACMNISIRAETPGDIDAIARLTEAALRNETHSSHTEQYIVDALR 179

Query: 68  GMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMS 125
               L+LS +     +++G +  +P++I+      + L P+ V P  Q +G+G +L+   
Sbjct: 180 RAGALTLSLVAEANGQVIGHIAASPVTIDGEAGGWYGLAPLSVAPGRQRQGLGSQLVRRL 239

Query: 126 VDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
           +       +   V++G+  YYS+ GF+      L LP  V             +A+ I
Sbjct: 240 LTELRLLPAGGCVVLGEPTYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMARGI 294


>gi|163802316|ref|ZP_02196210.1| multidrug efflux pump VmrA [Vibrio sp. AND4]
 gi|159173845|gb|EDP58659.1| multidrug efflux pump VmrA [Vibrio sp. AND4]
          Length = 167

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 60/161 (37%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   +VG    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTDAEAKLVMRLRENSKLTLSLVACTDEGEVVGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GI  KLI    D+    G  V V++GD  YY + 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIAAKLIKEGFDSLCDFGYPVCVVLGDPDYYGRH 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+A                     LV+       G +   
Sbjct: 121 GFKASEEMGFDCAWEAPQGAFRIAELVEGQCNGRSGRIDYS 161


>gi|126740784|ref|ZP_01756469.1| GCN5-related N-acetyltransferase [Roseobacter sp. SK209-2-6]
 gi|126718080|gb|EBA14797.1| GCN5-related N-acetyltransferase [Roseobacter sp. SK209-2-6]
          Length = 165

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 59/157 (37%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E +  I A+   +         +      ++   +    L LS +  +   ++G 
Sbjct: 1   MDIRQETEGDIAAIRKVTEAAFALAEHSSGTEAQIVDSLRQSGGLYLSLVAVQEGEVLGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +PI I         LGP+   P  Q KGIG+ LI   +    +KG     ++GD  Y
Sbjct: 61  LAFSPIRIAGQECGWLGLGPVSTRPDQQRKGIGKALIEAGLAKLREKGVAGCTVLGDPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF A         A V P   + L  V +  + 
Sbjct: 121 YGRFGFVADGQLHF---AGVPPEYFMSLSFVGSTPKG 154


>gi|311277874|ref|YP_003940105.1| GCN5-related N-acetyltransferase [Enterobacter cloacae SCF1]
 gi|308747069|gb|ADO46821.1| GCN5-related N-acetyltransferase [Enterobacter cloacae SCF1]
          Length = 167

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 8/162 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I ++   +F  G    A ++   +    ++L  +  +   ++VG V 
Sbjct: 1   MLIRVEIGIDAPGIDSLLRRAF--GGDAEAKLVHDLREDGLITLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+S+E        L P+ V   Y+ +GIGR+L+   +D+  + G   +V +GD A Y 
Sbjct: 59  FSPVSVEGEELQWVGLAPLAVDENYRGQGIGRQLVYEGLDSLNEFGYAAVVTLGDPALYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +LGF+      L    P   +      L  +    + G+V  
Sbjct: 119 RLGFEQASRFDLRCRWPDTGDAFQVHRLADDALNGVHGLVEY 160


>gi|17228816|ref|NP_485364.1| hypothetical protein all1321 [Nostoc sp. PCC 7120]
 gi|17130668|dbj|BAB73278.1| all1321 [Nostoc sp. PCC 7120]
          Length = 173

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 62/148 (41%), Gaps = 6/148 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E D+    I  ++  SFG     +    +R    +   LS +      +V  +  
Sbjct: 6   MNIRCETDADYLAISEVNNLSFGQENETQLIDEIRISEFYIPELSLIYEINHIVVWHILF 65

Query: 91  TPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           + I +          L P+ VHP +Q KGIG  L+   ++ A+ +G  +++++G   +YS
Sbjct: 66  SYIELVGEENLQVLGLAPMAVHPEFQRKGIGSALVKTGLEKADARGESLVIVLGYPQFYS 125

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           + GF       +  P PV  +  +   L
Sbjct: 126 RFGFIPSVNCKIESPFPVPDDVFMVKTL 153


>gi|224499544|ref|ZP_03667893.1| acetyltransferase [Listeria monocytogenes Finland 1988]
          Length = 172

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 61/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            + R E      A+   + ++F           +R    +   LS +   E   IVG + 
Sbjct: 1   MIIRKEQPQDYEAIRRVNEEAFKGTVEADLIESIRTSDYYQPGLSLVAEAEDGLIVGYIM 60

Query: 90  MTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            + IS+E          L P+ V P YQ   +G +L+   +  + +K    I ++G   Y
Sbjct: 61  FSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEEGIRLSREKAYPAIAVLGHADY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y +  F      ++  P  V     + L L     +N+ G +  
Sbjct: 121 YPRFDFIPSEQFAIPAPFDVPAEYFMLLELYDESLENLAGTIHY 164


>gi|315646520|ref|ZP_07899638.1| GCN5-related N-acetyltransferase [Paenibacillus vortex V453]
 gi|315278163|gb|EFU41483.1| GCN5-related N-acetyltransferase [Paenibacillus vortex V453]
          Length = 172

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 56/165 (33%), Gaps = 8/165 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E  +    +H     +F           LR        LS +  E  +I G +  
Sbjct: 1   MNIRTETGADYEKVHTLLTRAFPGQEEAILVQRLRADNSFQQELSIVAEENGKITGHIMF 60

Query: 91  TPIS-IEKITGH---LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +  +  E    H    L P+ V P +Q +GIG KLI          G  ++ L G  +YY
Sbjct: 61  SQAALWEGGHAHSVAALAPLAVLPEFQRQGIGGKLIEEGKRRCRSLGYPLVFLFGHPSYY 120

Query: 147 SKLGFQAVPWKSLIL-PAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF       + +    V     +   L +    ++ G  R  
Sbjct: 121 PRYGFVQARNYGMEMTQFTVSDEVFMVAELQEGALHSLHGEFRFH 165


>gi|241668085|ref|ZP_04755663.1| acetyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876620|ref|ZP_05249330.1| acetyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842641|gb|EET21055.1| acetyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 171

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            +   R E+      ++   S          ++      H   +S +   +   I+G V 
Sbjct: 1   MYVKIRYENLKDQEQIYKLISEAFDTSDEERLVRLLHTDHQSLISLVAETDEGNIIGQVI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ ++ E+      + L P+ V P YQ+KGIG KLI M +  A+K     I ++G  +YY
Sbjct: 61  LSKMTAEETDELKIYGLAPMSVAPKYQHKGIGTKLIEMMIKEAKKNNIDAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+A     +     V  +  + L +  N    +KG  V   E
Sbjct: 121 PKFGFKATIEYKIKCEYDVPEDVFMVLDIS-NKLAKLKGQTVYYAE 165


>gi|329924908|ref|ZP_08279855.1| acetyltransferase, GNAT family [Paenibacillus sp. HGF5]
 gi|328940292|gb|EGG36621.1| acetyltransferase, GNAT family [Paenibacillus sp. HGF5]
          Length = 172

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 59/165 (35%), Gaps = 8/165 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E ++    ++     +F           LRE G  +  LS +  E   I G +  
Sbjct: 1   MNIRTETENDYERVNELLTQAFSSQEEAILVQRLREDGAFERELSMVAEEDGIIKGHIMF 60

Query: 91  TPIS--IEKITG--HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +  S      T     LGP+ V P YQ +GIG KLI          G  ++ L G  +YY
Sbjct: 61  SRASLLHGGHTHRVAALGPLAVLPKYQRQGIGGKLIEEGKRRCLSHGYPLVFLFGHPSYY 120

Query: 147 SKLGFQAVPWKSLIL-PAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF       + +    V     +   L Q    N+ G  R  
Sbjct: 121 PRYGFVQARNHGIDISQFAVSDEVFMVAELQQGALHNLHGEFRFH 165


>gi|167755159|ref|ZP_02427286.1| hypothetical protein CLORAM_00664 [Clostridium ramosum DSM 1402]
 gi|167705209|gb|EDS19788.1| hypothetical protein CLORAM_00664 [Clostridium ramosum DSM 1402]
          Length = 169

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 63/166 (37%), Gaps = 9/166 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA--------VLLREQGMHDLSLSFLCAEGKRIV 85
            + R E       ++            +        + LR    +   LS +     ++V
Sbjct: 1   MIIRPEEKQDFNEIYTVVKAAFATAEHSDGNEQDLVIALRTGNNYIQKLSLVAKIDNQLV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   +   T  +L P+ + P +Q +GIG  LI+     A++ G +  +++G   Y
Sbjct: 61  GYIMFTTAKVGNDTVLVLAPLAILPAFQKQGIGSTLINKGHQIAKELGYEYCLVLGSEHY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y + G+       + +P  +     +   L+    + I G V+  +
Sbjct: 121 YPRFGYLPAEQFGIKVPKGIPSINFMAKKLIFRAGK-ISGEVKYAK 165


>gi|254247978|ref|ZP_04941299.1| hypothetical protein BCPG_02797 [Burkholderia cenocepacia PC184]
 gi|124872754|gb|EAY64470.1| hypothetical protein BCPG_02797 [Burkholderia cenocepacia PC184]
          Length = 198

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 36  ERLEHDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER     +I  +   +F     G      ++   +    LS+S +     RIVG V  +P
Sbjct: 33  ERASEADAIGRVIRAAFAGEPQGGEFEQRIVDTLRTDGALSVSLIAERDGRIVGHVAFSP 92

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I          + L P+ V P  Q + IG  L+   +DA  + G++  V++G+ AYY+
Sbjct: 93  VAIGGEPAGSQQWYGLAPLAVRPDCQRQSIGAGLVRTGLDALRRLGARGCVVLGEPAYYT 152

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GF+  P   ++ P  V     L L   ++      G VR  +V
Sbjct: 153 RFGFE--PRGDIVFPG-VPAEYFLALSFDESAPLPA-GDVRYHDV 193


>gi|262393394|ref|YP_003285248.1| acetyltransferase [Vibrio sp. Ex25]
 gi|262336988|gb|ACY50783.1| acetyltransferase [Vibrio sp. Ex25]
          Length = 167

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 61/161 (37%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +     +LS +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTEAEAKLVMRLRENSKFTLSLVACTDEGEVIGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GI  +LI    D+    G  V V++GD  YY++ 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIAAELIKEGFDSLRDFGYPVCVVLGDPDYYARQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GFQ+           V         LV+       G +   
Sbjct: 121 GFQSCDEMGFECAWDVPKGAFRIAELVEGQCAGRSGRIDYA 161


>gi|91228280|ref|ZP_01262216.1| putative acetyltransferase [Vibrio alginolyticus 12G01]
 gi|269966872|ref|ZP_06180945.1| putative acetyltransferase [Vibrio alginolyticus 40B]
 gi|91188157|gb|EAS74459.1| putative acetyltransferase [Vibrio alginolyticus 12G01]
 gi|269828539|gb|EEZ82800.1| putative acetyltransferase [Vibrio alginolyticus 40B]
          Length = 167

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 61/161 (37%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +     +LS +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTEAEAELVMRLRENSKFTLSLVACTDEGEVIGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GI  +LI    D+    G  V V++GD  YY++ 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIAAELIKEGFDSLRDFGYPVCVVLGDPDYYARQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GFQ+           V         LV+       G +   
Sbjct: 121 GFQSCDEMGFECAWDVPKGAFRVAELVEGQCAGRSGRIDYA 161


>gi|332654339|ref|ZP_08420083.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
 gi|332517425|gb|EGJ47030.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
          Length = 169

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 61/164 (37%), Gaps = 9/164 (5%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E              A     +  G        LR+       LS +  E ++IV
Sbjct: 1   MIIRQERPEDYDTVYHVVKEAFENAEYTDGNEQNLVAALRKSKSFIPELSLVAVEDEKIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   ++ +    L P+ V P YQN+GIG  L+      A K G +  V++G   Y
Sbjct: 61  GHILFTKAVVQGVEVLALAPLSVLPDYQNRGIGLSLMKEGHSIAHKLGYEYSVVLGHSKY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y K G+       +  P  VD    + L L       + G++  
Sbjct: 121 YPKAGYIPASECGIKAPFEVDDESFMALNLN-GSQNKLNGVIEY 163


>gi|37528325|ref|NP_931670.1| hypothetical protein plu4504 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787763|emb|CAE16876.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 167

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 66/163 (40%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   SF       A ++ + +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPVDAAGIDQLLRKSF--DTPAEAELVQQLREDGLLTLGVVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ I         L P+ V   Y+ +GIG KL+   +D+  + G  V+V++GD  YY 
Sbjct: 59  FSPVDINGEDHQWVGLAPLAVAEEYRRQGIGEKLVYEGLDSLNEFGYGVVVVLGDPHYYC 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF       L        +      L  +   + KG+V   
Sbjct: 119 RFGFTLASEHQLHCQWSTCESYFQVYELADSSLADHKGLVTYS 161


>gi|269120826|ref|YP_003309003.1| GCN5-related N-acetyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268614704|gb|ACZ09072.1| GCN5-related N-acetyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 211

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 15/169 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
                + E +     +   +       + PG      ++  LR+       L  +     
Sbjct: 1   MEIQIKNETEKDYREVEELTREAFWNLYVPGA-DEHFIVHNLRKSKNFIKHLDLVAVHQD 59

Query: 83  RIVGSVRMTPISIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
           +IVGS+  T   IE            GP+ + P +QNKGIGRKLI  S+  A     + I
Sbjct: 60  KIVGSIIYTLSYIEDEFNQKHEVITFGPVSILPEFQNKGIGRKLIEYSIKKARDLSYKAI 119

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
           ++ G   YYSK GF++    ++  P       +  L L +N  + I G 
Sbjct: 120 IIYGYPDYYSKYGFKSGKNYNICTPEGTYMKALQVLELQENALKGIHGK 168


>gi|330999386|ref|ZP_08323103.1| acetyltransferase, GNAT family [Parasutterella excrementihominis
           YIT 11859]
 gi|329575244|gb|EGG56795.1| acetyltransferase, GNAT family [Parasutterella excrementihominis
           YIT 11859]
          Length = 180

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 60/168 (35%), Gaps = 12/168 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFG---PGRFVRAAVLLREQGMH--DLSLSFLCAEGKRIV 85
              + +    + A++     +F            ++ R          LS        +V
Sbjct: 6   ITIKQQEAHDLPAIYRLIEEAFASVQESNHREQFLVTRLLSSPGFIPELSLTAWIQNELV 65

Query: 86  GSVRMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G + +T I I      +    L P+ V P +Q +GIG  LI  +   A +   + I+++G
Sbjct: 66  GYILLTEIEILSDSTSMPSLSLAPLAVRPKFQKQGIGAALIKEAHKRACQLNYETILVLG 125

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY + G++      +  P  V P   +   L    A    G V+ 
Sbjct: 126 HKDYYPRFGYKKAENFGITFPFEVQPEFCMVKELTPGAASRAAGQVKY 173


>gi|134301509|ref|YP_001121477.1| acetyltransferase [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134049286|gb|ABO46357.1| acetyltransferase [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 171

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 64/166 (38%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
                R E       ++   S          ++      H   +S +   +   I+G   
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTSDEEKLVRLLHTDHQSLISLVAETDDSSIIGQAI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +YY
Sbjct: 61  ISKMTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAIIKEAKKNNIDAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 121 PKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAE 165


>gi|210614220|ref|ZP_03290115.1| hypothetical protein CLONEX_02328 [Clostridium nexile DSM 1787]
 gi|210150797|gb|EEA81805.1| hypothetical protein CLONEX_02328 [Clostridium nexile DSM 1787]
          Length = 169

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 61/164 (37%), Gaps = 9/164 (5%)

Query: 34  FLERLEHDSSI--------CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            L R E              A     +  G        LR+       LS +  E ++IV
Sbjct: 1   MLIRQERPEDYDTVYHVVKEAFENAEYTDGNEQNLVAALRKSKSFIPELSLVAVEDEKIV 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   ++ +    L P+ V P YQN+GIG  L+      A K G +  V++G   Y
Sbjct: 61  GHILFTKAVVQGVEVLALAPLSVLPDYQNRGIGLSLMKEGHSIAHKLGYEYSVVLGHSKY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           Y K G+       +  P  VD    + L L       + G++  
Sbjct: 121 YPKAGYIPASECGIKAPFEVDDESFMALNLN-GSQNKLNGVIEY 163


>gi|297190565|ref|ZP_06907963.1| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297150536|gb|EDY61787.2| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 381

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 61/160 (38%), Gaps = 6/160 (3%)

Query: 35  LERLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMHD---LSLSFLCA-EGKRIVGSVR 89
             R E  + + A+ A +         AA++   +   +     LS++   E   +     
Sbjct: 217 RTRPETVADVPAVRAVNTAAFPTPGEAALVDSLRQDAEAWLPGLSYVAEAEDGSVAAYAL 276

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   I       L P+   P +Q +G G  ++   +DAA  +G   +V++G   YY + 
Sbjct: 277 LTRCRIGGTPALALAPVATAPGHQRQGAGTAVVRAVLDAARSRGEGPVVVLGHPEYYPRF 336

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF+      +     V    ++ L L        +G VR 
Sbjct: 337 GFEVAAKHGIRTSFEVPEEALMVLTL-DGCDDVPRGTVRY 375


>gi|120602069|ref|YP_966469.1| GCN5-related N-acetyltransferase [Desulfovibrio vulgaris DP4]
 gi|120562298|gb|ABM28042.1| GCN5-related N-acetyltransferase [Desulfovibrio vulgaris DP4]
          Length = 175

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 67/172 (38%), Gaps = 14/172 (8%)

Query: 28  QKIGAFFLERLEHDSSICAMHADS---FGP---GRFVRAAVLLREQGMHDLSLSFLCAEG 81
           + + A  + R E    I ++   +   F            V+   +    LSLS +    
Sbjct: 6   EHMVASMIVRDEVPEDIGSIFEVTAKAFATLDISDKREPYVIEALRHAGALSLSLVAVFD 65

Query: 82  KRIVGSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
            R++G V  +P+  S        LGP+ VHP Y  +G+G  L+   +   +  G+    L
Sbjct: 66  GRVIGHVAFSPVAVSDGTEGWFGLGPLSVHPAYPRRGVGTALVREGLARLQSLGAAGCCL 125

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           VG   YY + GF   P  ++     V P     +P    V    KG+V   E
Sbjct: 126 VGHPTYYVRFGFMNAPGLNVE---GVPPEYFFAMPFKGEVP---KGVVTFHE 171


>gi|146313228|ref|YP_001178302.1| GCN5-related N-acetyltransferase [Enterobacter sp. 638]
 gi|145320104|gb|ABP62251.1| GCN5-related N-acetyltransferase [Enterobacter sp. 638]
          Length = 167

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF   +   A ++   +    ++L  +  +   ++VG V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRSFA--QESEARLVHDLREDGLITLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        + P+ V   Y+ +G+ RKL+   +D+  + G   +V +GD A+Y 
Sbjct: 59  FSPVAVQGEELQWVGMAPLAVDENYRGQGLARKLVYEGLDSLNEFGYAAVVALGDPAFYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P          L  +    + G+V   +
Sbjct: 119 RLGFEPAAPYDLHCRWPNTETAFQVHRLADDALNGVSGLVEYHD 162


>gi|220933339|ref|YP_002512238.1| GCN5-related N-acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994649|gb|ACL71251.1| GCN5-related N-acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 184

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 68/163 (41%), Gaps = 9/163 (5%)

Query: 37  RLEHDSSICAMHADSFGPGRFVRAAVLLREQGMH--DLSLSFLCAEGKRIVGSVRMTPIS 94
           R      +  +   +F  G  V A ++            LS L  +  R VG V  T + 
Sbjct: 15  RPSDLDDVLTVERAAF--GSDVEAGLVRDLLADPSAAPMLSLLAWDAGRAVGHVLFTTVR 72

Query: 95  IEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           +   T      +L P+ V P  Q +GIG  LI   +    ++G  ++ ++G   YY++ G
Sbjct: 73  MGHATAPVSGMILAPLAVVPDVQGRGIGAALIREGLALLGQRGVDLVFVLGHPGYYTRHG 132

Query: 151 FQAVPWKSLILPAPVDPN-RVLFLPLVQNVAQNIKGIVRCREV 192
           F+    + L  P P++P    +   L   +  ++ G V C +V
Sbjct: 133 FEPATPRGLTAPYPIEPEAAWMVRALRPGLLGSVHGRVVCADV 175


>gi|242240738|ref|YP_002988919.1| GCN5-related N-acetyltransferase [Dickeya dadantii Ech703]
 gi|242132795|gb|ACS87097.1| GCN5-related N-acetyltransferase [Dickeya dadantii Ech703]
          Length = 167

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       +      +F  G+   A ++ + +    L+L  + ++    +VG   
Sbjct: 1   MLIRVEIPVDAPGIDNLLRGAFPDGK--EADLVQQLREDGLLTLGVVASDDEGVVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        LGP+ V   Y+ +G+G KL+   +DA  + G   +V++G+ AYYS
Sbjct: 59  FSPVTLDGEDRQWVGLGPLAVEASYRRQGLGEKLVYEGLDALNEFGYTAVVVLGNPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF     + L    P         PLV N  + + G+V    
Sbjct: 119 RFGFVPAIERQLRCRWPKTERAFQIYPLVDNHFEGVSGMVEYAA 162


>gi|328886483|emb|CCA59722.1| acetyltransferase [Streptomyces venezuelae ATCC 10712]
          Length = 414

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 66/191 (34%), Gaps = 12/191 (6%)

Query: 5   NIELRKFLSIAF-FEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGP-GRFVRAAV 62
            I LR+     F +     R +  +        R E    + A+        G    A +
Sbjct: 224 EIALRRAHGSDFGYAGFVLRPADPRW-----RTRQETAEDVPAVRPLVAAAFGSEAEADL 278

Query: 63  LLREQGMH---DLSLSFLCAE-GKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIG 118
           +   +         LS++       +     +T   ++      L P+ V P +Q  G G
Sbjct: 279 VDALRRDPGAWLPGLSYVAEAPDGSVAAHALITRCRVDGAPAAALAPVSVAPAHQRTGAG 338

Query: 119 RKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
           + ++   +DAA   G  +++++G   YY + GF       +     V    ++ L L  +
Sbjct: 339 QAVVRAVLDAARLSGEPLVLVLGHPEYYPRFGFVRASEYGIRPGFEVPDEAMMALVLDDS 398

Query: 179 VAQNIKGIVRC 189
           V     G +  
Sbjct: 399 VPVP-SGTIAY 408


>gi|28899218|ref|NP_798823.1| putative acetyltransferase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838297|ref|ZP_01990964.1| hypothetical acetyltransferase YhbS [Vibrio parahaemolyticus
           AQ3810]
 gi|260362219|ref|ZP_05775203.1| acetyltransferase [Vibrio parahaemolyticus K5030]
 gi|260879087|ref|ZP_05891442.1| acetyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260897758|ref|ZP_05906254.1| acetyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260900814|ref|ZP_05909209.1| acetyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|28807442|dbj|BAC60707.1| putative acetyltransferase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748286|gb|EDM59145.1| hypothetical acetyltransferase YhbS [Vibrio parahaemolyticus
           AQ3810]
 gi|308088984|gb|EFO38679.1| acetyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308089534|gb|EFO39229.1| acetyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308108194|gb|EFO45734.1| acetyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|308111480|gb|EFO49020.1| acetyltransferase [Vibrio parahaemolyticus K5030]
          Length = 167

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 62/161 (38%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTDAEANLVMRLRENGKLTLSLVACTDEGEVIGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GIG +LI    ++    G  V V++G+  YY++ 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIGAELIKEGFESLRDFGYPVCVVLGEPNYYARQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF A           V         LV+       G +   
Sbjct: 121 GFNAGEEMGFECAWEVPEGAFRVAELVEGQCTGRSGRIDYA 161


>gi|126642123|ref|YP_001085107.1| acetyltransferase [Acinetobacter baumannii ATCC 17978]
          Length = 150

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 67/137 (48%), Gaps = 8/137 (5%)

Query: 57  FVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI--SIEKITGHLLGPIVVHPLYQN 114
                ++   +    L++S +  E   IVG V ++P+  S  +   + LGPI V P  Q 
Sbjct: 14  HTEHFIVNNLRKHKQLTVSLVAVEDNTIVGHVAISPVQISSGEKNWYGLGPISVAPNKQG 73

Query: 115 KGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP 174
           +GIG  L++ S++  +K G++  VL+GD  YYS+ GF+A P   L LP  V P     L 
Sbjct: 74  QGIGSLLMNSSLEKLKKLGAKGCVLLGDPKYYSRFGFKAYP--DLKLPG-VPPEYFQALS 130

Query: 175 LVQNVAQNIKGIVRCRE 191
               V    KG V   E
Sbjct: 131 FQNYVP---KGDVSYHE 144


>gi|328474246|gb|EGF45051.1| putative acetyltransferase [Vibrio parahaemolyticus 10329]
          Length = 167

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 62/161 (38%), Gaps = 4/161 (2%)

Query: 34  FLERLEHDSSICAMHADS-FGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++R +    L+LS +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTIDRLLKHAFPTDAEANLVMRLRENGKLTLSLVACTDEGEVIGHALFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ VH  Y+ +GIG +LI    ++    G  V V++G+  YY++ 
Sbjct: 61  PVTLNGEDLSWQGLAPLAVHEDYRRQGIGAELIKEGFESLRDFGYPVCVVLGEPDYYARQ 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF A           V         LV+       G +   
Sbjct: 121 GFNAGEEMGFECAWEVPEGAFRVAELVEGQCAGRSGRIDYA 161


>gi|56708475|ref|YP_170371.1| acetyltransferase [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110670946|ref|YP_667503.1| acetyltransferase [Francisella tularensis subsp. tularensis FSC198]
 gi|224457634|ref|ZP_03666107.1| acetyltransferase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254371098|ref|ZP_04987100.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254875320|ref|ZP_05248030.1| acetyltransferase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|54113185|gb|AAV29226.1| NT02FT2013 [synthetic construct]
 gi|56604967|emb|CAG46061.1| Acetyltransferase [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110321279|emb|CAL09444.1| Acetyltransferase [Francisella tularensis subsp. tularensis FSC198]
 gi|151569338|gb|EDN34992.1| hypothetical protein FTBG_00856 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254841319|gb|EET19755.1| acetyltransferase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159678|gb|ADA79069.1| Acetyltransferase [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 171

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 64/166 (38%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
                R E       ++   S          ++      H   +S +   +   I+G   
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTSNEEKLVRLLHTDHQSLISLVAETDDSSIIGQAI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +YY
Sbjct: 61  ISKMTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAIIKEAKKNNIDAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 121 PKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAE 165


>gi|284031543|ref|YP_003381474.1| GCN5-related N-acetyltransferase [Kribbella flavida DSM 17836]
 gi|283810836|gb|ADB32675.1| GCN5-related N-acetyltransferase [Kribbella flavida DSM 17836]
          Length = 168

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 62/158 (39%), Gaps = 8/158 (5%)

Query: 37  RLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHD---LSLSFLCA-EGKRIVGSVRMT 91
           R E  + + A+ A +    GR   AA++ R +         LS++       +V    +T
Sbjct: 8   RAETAADLAAVEAVNLRAFGRPDEAAIVSRLRRDPVAWLPGLSYVATTATGEVVAHALLT 67

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              ++      LGP  V P YQ  G G  ++   +DA    G   +V++G   YY + GF
Sbjct: 68  RCHVDDAPVLALGPCAVLPEYQRSGAGGAVVRAVLDAGRAAGEHTVVVLGHAEYYPRFGF 127

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +      +           + L LV +     +G +R 
Sbjct: 128 RTATTFGIHSQYDGP--YFMALGLVPDRPLP-RGTIRY 162


>gi|197336136|ref|YP_002155251.1| acetyltransferase, gnat family [Vibrio fischeri MJ11]
 gi|197317626|gb|ACH67073.1| acetyltransferase, gnat family [Vibrio fischeri MJ11]
          Length = 167

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 61/160 (38%), Gaps = 4/160 (2%)

Query: 34  FLERLEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++  +    L+L+ +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTVDRLVRTAFDTEAEAKLVMSLRENSHLTLALVACSDDGEVIGHCLFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ V   +Q +GI  KL+   ++   + G  V V++GD  YY + 
Sbjct: 61  PVTLNGDDLNWQGLAPLCVKKEHQKQGIAEKLVKEGLEMLTELGYPVAVVLGDPNYYQRF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF++     +     V     +         +   G++  
Sbjct: 121 GFESATNYDMHSKWEVPEGAFMIKACSSEFIEGKSGLIEY 160


>gi|183600385|ref|ZP_02961878.1| hypothetical protein PROSTU_03952 [Providencia stuartii ATCC 25827]
 gi|188020177|gb|EDU58217.1| hypothetical protein PROSTU_03952 [Providencia stuartii ATCC 25827]
          Length = 167

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 65/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E       I  +  D+F       A ++ + +    L+L  +   +   ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDKLLRDTF--PTEAEADLVQKLREDGLLTLGVVATNDNGEVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ +         L P+ V   +Q +GIG +LI   +D+  + G   +V++GD  YY 
Sbjct: 59  FTPVDVNNEDVQWVGLAPLAVSKAHQKQGIGGQLIYEGLDSLNEFGYGAVVVLGDSNYYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      +    P      +   L      + KG V   
Sbjct: 119 RFGFEPASKYEVFSQWPELQEHFMICGLENGSLSDHKGRVTYS 161


>gi|15889089|ref|NP_354770.1| acetyltransferase [Agrobacterium tumefaciens str. C58]
 gi|15156891|gb|AAK87555.1| acetyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 167

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 63/160 (39%), Gaps = 11/160 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E      A+   +    R V         ++ R +    L++S +  + + I+G 
Sbjct: 1   MIIRPERQGDEEAIARVTEDAFRNVEHRSGTEQLIVARLRDAGALTVSLVAEDSEGIIGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++    +     L P+ V P  Q +G+G +L    +   E+  +   V+VGD AY
Sbjct: 61  VGFSPVTLSSGETGWFCLAPLSVTPERQGEGVGSRLARDGLAVLERLSAAGCVVVGDPAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           Y + GF+ V    L     +       L L       I G
Sbjct: 121 YGRFGFRPVA--GLSAEG-IPDEYFTVLRLHGGTPSGIVG 157


>gi|296282145|ref|ZP_06860143.1| acetyltransferase, gnat family protein [Citromicrobium
           bathyomarinum JL354]
          Length = 181

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 14/165 (8%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAE-GKRIVGS 87
             R E ++ I A+ A +         +      ++   +   DL+LS +     + ++G 
Sbjct: 5   TIREEVENDIPAIRALTRAAFAHAEHSQGNEQDIIDTLRRDGDLTLSLVATNMDEAVIGH 64

Query: 88  VRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+S+       +  GPI V P  Q  GIG +L   S+      G++ IVL+G+  Y
Sbjct: 65  IAFSPVSMSDGTRDWYAAGPISVMPTRQRTGIGSQLAEESLSRMRALGAKGIVLLGEPDY 124

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           Y++ GF+  P   L+LP    P       LV        GIV   
Sbjct: 125 YARYGFRPDP--GLVLPG-APPEHFQVRMLVSGP--RPAGIVTYA 164


>gi|330447367|ref|ZP_08311016.1| acetyltransferase family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491558|dbj|GAA05513.1| acetyltransferase family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 167

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I     +    F       A +++  +     +LS +   +   +VG+  
Sbjct: 1   MLIRSEAPADILPIDTLLKAVF--PSEEEANLVMTLRENGCRTLSLVACNDEGEVVGNAF 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++I+        L P+ V   YQ +GIG  LI  +       G   IV++G+ AYYS
Sbjct: 59  FSPVTIDGEDHNWQGLAPLAVREDYQGQGIGLALIEEAKSVLGDFGYPAIVVLGEPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           K GF+      L  P P      +   +        +G+V+  
Sbjct: 119 KAGFEKALDHQLTCPWPNTEEAFMVCDVFPGTVAQHQGMVKYS 161


>gi|15595908|ref|NP_249402.1| hypothetical protein PA0711 [Pseudomonas aeruginosa PAO1]
 gi|9946594|gb|AAG04100.1|AE004506_10 hypothetical protein PA0711 [Pseudomonas aeruginosa PAO1]
          Length = 168

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 62/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+LS +     +++
Sbjct: 1   MNISIRAETPGDIDAIAHLTEAAFRNETHSSHTEQYIVDALRRAGALTLSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPGRQRQGLGSQLVRRLLTELRLLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+      L LP  V             +AQ I
Sbjct: 121 TYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMAQGI 157


>gi|49081376|gb|AAT50123.1| PA0711 [synthetic construct]
          Length = 169

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 62/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+LS +     +++
Sbjct: 1   MNISIRAETPGDIDAIAHLTEAAFRNETHSSHTEQYIVDALRRAGALTLSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPGRQRQGLGSQLVRRLLTELRLLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+      L LP  V             +AQ I
Sbjct: 121 TYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMAQGI 157


>gi|71909049|ref|YP_286636.1| GCN5-related N-acetyltransferase [Dechloromonas aromatica RCB]
 gi|71848670|gb|AAZ48166.1| GCN5-related N-acetyltransferase [Dechloromonas aromatica RCB]
          Length = 168

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 67/168 (39%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  S   A+   +                ++   +    LS+S +  E  RIV
Sbjct: 1   MTTTIRPEKPSDEAAIEQVTRRAFLSHPYSHQTEQFIIRALRADDALSVSLVAEEAGRIV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++        + LGPI V P  Q +GIGR L+   +    K G+   VLVGD 
Sbjct: 61  GHIALSPVTISDGSAGWYGLGPISVEPELQRRGIGRALMERGIVELRKIGAAGCVLVGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           A+Y + GF   P   L     V P   L L L      +  G V+  +
Sbjct: 121 AFYVRFGFANNPALVLE---GVPPEFFLCLLL---GTASAHGSVQFHQ 162


>gi|291616021|ref|YP_003518763.1| YhbS [Pantoea ananatis LMG 20103]
 gi|291151051|gb|ADD75635.1| YhbS [Pantoea ananatis LMG 20103]
 gi|327396273|dbj|BAK13695.1| acetyltransferase YhbS [Pantoea ananatis AJ13355]
          Length = 168

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     + I A+    F           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGVDAAGIDALLRRCFPTSAEAELTQALRE--DGLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V    + +GI ++L+   +D   + G   +V+ GD A YS
Sbjct: 59  FSPVTLQGEDRNWVGLAPLAVDESLRGQGIAKQLVYEGLDTLNEFGYSAVVVRGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            LGF+      L    P      L  PL  N     +G +    
Sbjct: 119 HLGFEPAARHGLHCRWPDSEASFLVYPLADNAFDGAEGRIEYSA 162


>gi|262401646|ref|ZP_06078212.1| acetyltransferase [Vibrio sp. RC586]
 gi|262352063|gb|EEZ01193.1| acetyltransferase [Vibrio sp. RC586]
          Length = 167

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 66/163 (40%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E  + I A+ A     F       A +++  +     +LS +  +    I+G V 
Sbjct: 1   MLIRTEAPADILAVDALLKTVF--PTEAEANLVMALRENGRRTLSLVACDDEGEIIGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++E        L P+ V   Y+ +GI  +L+   + +  + G    V++GD AYYS
Sbjct: 59  FSPVTLEGEDLNWQGLAPLSVKEEYRRQGIAAELVKEGLSSLGELGYPACVVLGDPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L     V       + L +       G++   
Sbjct: 119 RFGFEDAAQYQLNCVWDVPQGAFRVVALWERELDGRCGLIEFS 161


>gi|78060379|ref|YP_366954.1| GCN5-related N-acetyltransferase [Burkholderia sp. 383]
 gi|77964929|gb|ABB06310.1| GCN5-related N-acetyltransferase [Burkholderia sp. 383]
          Length = 168

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 64/168 (38%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAA------VLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I  +   +         +      ++   +    L++S +  E  RIV
Sbjct: 1   MNLTIRNERIEDIDTITQLTTAAFEHEEHSSHTEQFIVNALRHSEQLTISLVAIEDGRIV 60

Query: 86  GSVRMT--PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++   +S        LGPI V P  Q +GIG  L+  ++   ++ G    V++GD 
Sbjct: 61  GHVTVSPVHVSSGAAGWFGLGPISVWPDRQGQGIGSVLMKAALSELQRIGGTGCVVLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY + GF+A P   L LP  V            +V     G V+   
Sbjct: 121 GYYGRFGFKAYP--GLELPG-VPHAYFQAQAFAGDVP---LGTVQYHA 162


>gi|213418010|ref|ZP_03351088.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 171

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   +
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQVHRLAEDALEGVTGLVEYHD 162


>gi|332678689|gb|AEE87818.1| acetyltransferase [Francisella cf. novicida Fx1]
          Length = 171

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 66/168 (39%), Gaps = 11/168 (6%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGS 87
                R E       ++     +F  G      V L     H   +S +   +   I+G 
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTGDE-EKLVRL-LHTDHQSLISLVAETDDSSIIGQ 58

Query: 88  VRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +
Sbjct: 59  AIISKMTAEKDQTLKIYALAPMSVAPKYQHQGIGSKLIEAMIKEAKKNNIDAIFVLGHPS 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
           YY K GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 119 YYPKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAE 165


>gi|325293171|ref|YP_004279035.1| acetyltransferase [Agrobacterium sp. H13-3]
 gi|325061024|gb|ADY64715.1| acetyltransferase [Agrobacterium sp. H13-3]
          Length = 167

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 61/160 (38%), Gaps = 11/160 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            + R E      A+   +    R           ++ R +    L++S +  + + I+G 
Sbjct: 1   MIIRPERQGDEEAIARVTEDAFRNVDYSDKTEHVIIERLRKAGALTVSLVAEDSEGIIGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P+++         L P+ V P  Q +G+G  L+   + A ++  +   V+ GD  Y
Sbjct: 61  IGFSPVTLSGGETGWFCLAPLSVAPDRQRQGVGSGLVREGLAALDRLSASGAVVAGDPDY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           Y + GF+ V   S      +       L L       I G
Sbjct: 121 YGRFGFRHVEGLSGKA---IPDEYFTVLRLHGGTPSGIVG 157


>gi|187932084|ref|YP_001892069.1| acetyltransferase [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|187712993|gb|ACD31290.1| acetyltransferase [Francisella tularensis subsp. mediasiatica
           FSC147]
          Length = 171

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 64/166 (38%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
                R E       ++   S          ++      H   +S +   +   I+G   
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTSDEEKLVRLLHTDHQSLISLVAETDDSSIIGQAI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +YY
Sbjct: 61  ISKMTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAIIKEAKKNNINAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 121 PKFGFKPATEYQIKCEYDVPADVFMILDLSAK-LASLKGQTVYYAE 165


>gi|225571043|ref|ZP_03780060.1| hypothetical protein CLOHYLEM_07141 [Clostridium hylemonae DSM
           15053]
 gi|225160124|gb|EEG72743.1| hypothetical protein CLOHYLEM_07141 [Clostridium hylemonae DSM
           15053]
          Length = 202

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 67/167 (40%), Gaps = 14/167 (8%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGR-FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + RLE       +   +       + PG         LRE       L F+ AE  +IV
Sbjct: 1   MIFRLEEQIDHNDVEQLTREAFWNVYQPGCCEHLVLHKLRESEAFIRELDFVAAEDGKIV 60

Query: 86  GSVRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            ++  + +  +     +    GP+ VHP +Q KGIG K+I+ ++  A++ G + +++ G 
Sbjct: 61  ANIVYSRMYKDGRMCSSIAAFGPVSVHPDHQGKGIGGKIITYTLQKAKETGIKAVMITGS 120

Query: 143 IAYYSKLGFQAVPWKSLILPA---PVDPNRVLFLPLVQNVAQNIKGI 186
             YY + GF       + LP      +    +   L +   +   G 
Sbjct: 121 PQYYCRFGFVPASKYDIYLPGADRDKENEFFMVNELEEGYLKACAGT 167


>gi|261406143|ref|YP_003242384.1| GCN5-like N-acetyltransferase [Paenibacillus sp. Y412MC10]
 gi|261282606|gb|ACX64577.1| GCN5-related N-acetyltransferase [Paenibacillus sp. Y412MC10]
          Length = 172

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 57/165 (34%), Gaps = 8/165 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R E ++    ++     +F           LRE G  +  LS +  E   I G +  
Sbjct: 1   MNIRTETENDYEQVNELLIQAFSGQEEAILVQRLREDGAFERELSMVAEEDGIIKGHIMF 60

Query: 91  TPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +  S            LGP+ V P YQ +GIG +LI          G  ++ L G   YY
Sbjct: 61  SRGSLLDGDHTHRVAALGPLAVLPKYQRQGIGGQLIEEGKRRCLSHGYPLVFLFGHPLYY 120

Query: 147 SKLGFQAVPWKSL-ILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF       + +    V     +   L Q    N+ G  R  
Sbjct: 121 PRYGFVQARNHGIDVSQFAVSDEVFMVAELQQGALHNLHGEFRFH 165


>gi|313637454|gb|EFS02905.1| acetyltransferase [Listeria seeligeri FSL S4-171]
          Length = 162

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 65/155 (41%), Gaps = 5/155 (3%)

Query: 42  SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMTPISIEKIT- 99
            +I  ++  +F           +R+   +   LS +   E   +VG +  + IS+E    
Sbjct: 2   QAIRQVNEAAFKGSVEADLIENIRQSDYYQPGLSLVAEAEDGLVVGYIMFSEISLETENK 61

Query: 100 ---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V P +Q + IG +L+   +  + +K    I ++G   YY + GF +   
Sbjct: 62  SRFILGLAPLAVLPEFQKQRIGSRLMEEGIRLSREKAYPAIAVLGHADYYPRFGFISSEA 121

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            ++  P  V     + L L     +N++GI+   E
Sbjct: 122 FNIPAPFDVPAEYYMLLELYDASLENLQGIIHYPE 156


>gi|326330353|ref|ZP_08196663.1| acetyltransferase, GNAT family protein [Nocardioidaceae bacterium
           Broad-1]
 gi|325951890|gb|EGD43920.1| acetyltransferase, GNAT family protein [Nocardioidaceae bacterium
           Broad-1]
          Length = 178

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 14/170 (8%)

Query: 35  LERLEHDSSICAMHADSF------GP-----GRFVRAAVL--LREQGMHDLSLSFLCAEG 81
            ER E  + I A+ A +F       P     G    A ++  LRE       LS +    
Sbjct: 5   RERPEDVADIRAVTAAAFSGVEHSAPPIEPDGAPGEATLVGWLREDPGWVPELSLVAEVD 64

Query: 82  KRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
             +VG    T   +       LGP+ V P  Q  G+G  L+   +  A+  G  V+VL+G
Sbjct: 65  GEVVGHAVATRGELAGRPALGLGPVSVSPERQRDGVGSALMHAILGGADALGEPVVVLLG 124

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             AYY++ GF A     +  P P   +     PL       ++G  R   
Sbjct: 125 SPAYYARFGFVAASSLGIEAPDPAWGDYFQARPLAAYEP-GLRGSFRYAA 173


>gi|322703432|gb|EFY95041.1| putative acetyltransferase [Metarhizium anisopliae ARSEF 23]
          Length = 174

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 65/150 (43%), Gaps = 13/150 (8%)

Query: 34  FLERLEHDSSICAMH---ADSFGPGRFV---RAAVLLREQGMHDLSLSFLCAEG--KRIV 85
              R E +S   A+    + +F            ++   +  + LS+S +  +     +V
Sbjct: 7   ICIRPERESDTQAIDLVISVAFTNAEHSDHNEHHIVRGLREANCLSISLVAEDEATHAVV 66

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P++          LGPI V P YQ +G+G  L+  ++   + + S   V++G+ 
Sbjct: 67  GHVAVSPVNISDGSEDWCGLGPIAVLPQYQGRGVGSLLMERALANLQARHSAGCVVLGNP 126

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFL 173
            YY++ GF+  P   L     V P   + L
Sbjct: 127 KYYTRFGFRPEPSLRLQ---GVPPEYFMAL 153


>gi|150403702|ref|YP_001330996.1| GCN5-like N-acetyltransferase [Methanococcus maripaludis C7]
 gi|150034732|gb|ABR66845.1| GCN5-related N-acetyltransferase [Methanococcus maripaludis C7]
          Length = 212

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 70/174 (40%), Gaps = 15/174 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
              + R E+      +   +       + PG      V+  +R+       LSF+     
Sbjct: 1   MDIIIRNENPKDYRIVEEIAREAFWNLYFPGCH-EHFVIHNMRKHVDFIKELSFVIEVNG 59

Query: 83  RIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            IVG +  T          +      GP+ + P +  KG+GRKLI+ S+  A++ G + I
Sbjct: 60  EIVGGIFYTHSKIVSKDNNEYKTISFGPVFISPKFHGKGLGRKLITYSIKIAKEMGYRAI 119

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + +G   +Y   GF +    +L +P       +L LPL +    NI G V   E
Sbjct: 120 LTLGYPYHYEPYGFLSGKKYNLSMPDGKFHKGLLALPLYEGALDNISGYVVFSE 173


>gi|271499185|ref|YP_003332210.1| GCN5-like N-acetyltransferase [Dickeya dadantii Ech586]
 gi|270342740|gb|ACZ75505.1| GCN5-related N-acetyltransferase [Dickeya dadantii Ech586]
          Length = 167

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 66/164 (40%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF           LRE     L+L  +  +    ++G   
Sbjct: 1   MLIRVEIPVDAPGIDALLRRSFPTSAEAELVHQLRE--DGQLTLGIVATDDEGGVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIG KL+   +DA  + G   +V++G+  YY+
Sbjct: 59  FSPVTLGGEDLQWVALAPMAVDENHRCQGIGEKLVYEGLDALNEFGYTAVVVLGNPRYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF     + L        +     PL  N  Q   G+V   E
Sbjct: 119 RFGFVPAAAQQLYCRWLGYESDFQVYPLADNHFQGASGLVEYAE 162


>gi|59711103|ref|YP_203879.1| acyltransferase [Vibrio fischeri ES114]
 gi|59479204|gb|AAW84991.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Vibrio fischeri ES114]
          Length = 167

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 61/160 (38%), Gaps = 4/160 (2%)

Query: 34  FLERLEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMT 91
            L R E  + I  +             A +++  +    L+L+ +   +   ++G    +
Sbjct: 1   MLIRTEAPADILTVDRLVRSAFDTEAEAKLVMSLRENSHLTLALVACSDDGEVIGHCLFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+++         L P+ V   +Q +GI   L+   ++   + G  V+V++GD  YY + 
Sbjct: 61  PVTLNGDDLNWQGLAPLCVKKEHQKQGIAEALVKEGLEMLTELGYPVVVVLGDSNYYQRF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF++     +     V     +         +   G++  
Sbjct: 121 GFESATNYDMHSKWEVPEGAFMIKACSSEFLEGRSGLIEY 160


>gi|307129396|ref|YP_003881412.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Dickeya dadantii 3937]
 gi|306526925|gb|ADM96855.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Dickeya dadantii 3937]
          Length = 167

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 66/164 (40%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F           LRE     L+L  +  +    +VG   
Sbjct: 1   MLIRVEIPVDAPGIDALLRHAFPTSAEAELVHQLRE--DGQLTLGIVATDDNGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIG KL+   +DA  + G   +V++G+  YY+
Sbjct: 59  FSPVTLGGEDLQWVALAPLAVDENHRCQGIGEKLVYEGLDALNEFGYTAVVVLGNPRYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF     + L        +     PL  N  Q   G+V   E
Sbjct: 119 RFGFVPAAEQQLYCRWLGCESDFQVYPLADNHFQGASGLVEYAE 162


>gi|293375149|ref|ZP_06621437.1| acetyltransferase, GNAT family [Turicibacter sanguinis PC909]
 gi|292646255|gb|EFF64277.1| acetyltransferase, GNAT family [Turicibacter sanguinis PC909]
          Length = 169

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 63/170 (37%), Gaps = 13/170 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFV------RAAVL--LREQGMHDLSLSFLCAEGKR 83
              + R EH+     ++                    +  LR    +   L+ +      
Sbjct: 1   MNLIIRTEHEKEFNQIYDFVRIAFETAQVSDGNEQNFVNELRASENYIPELALVALVDGN 60

Query: 84  IVGSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           I+G + +T        +     LL P+ V   Y+ +GIG KL+  S + A K G   +VL
Sbjct: 61  IIGHIMLTKYIVQDLNQNHDVLLLAPLSVDLNYRGQGIGSKLVMKSFELARKMGYTAVVL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           VGD AYY +  F++     +     +    +    LV+    N+ G +  
Sbjct: 121 VGDPAYYQRFSFKSSVDFGINCH-EIPAQYIQACELVEGSLDNVFGTLTF 169


>gi|281180200|dbj|BAI56530.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 167

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   E
Sbjct: 119 RFGFELAAHHDLHCRWPGTESAFQVHRLADDALNGVTGLVEYHE 162


>gi|206560349|ref|YP_002231113.1| putative acetyltransferase [Burkholderia cenocepacia J2315]
 gi|198036390|emb|CAR52286.1| putative acetyltransferase [Burkholderia cenocepacia J2315]
          Length = 180

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 36  ERLEHDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER     +I  +   +F     G      ++   +    LS+S +     RIVG V  +P
Sbjct: 16  ERASEADAIGRVIRAAFAGEPQGGAFEQRIVDTLRADGALSVSLVAERDGRIVGYVAFSP 75

Query: 93  ISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++I          + L P+ V P  Q + IG  L+   +DA  + G++  V++G+ AYY+
Sbjct: 76  VAIGGEPAGSQQWYGLAPLAVRPDCQRQSIGAGLVRTGLDALRRLGARGCVVLGEPAYYA 135

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GF+  P   ++  A V     L L L  +      G VR  +V
Sbjct: 136 RFGFE--PHGDIVF-AGVPAEYFLALSLDDSAPLPA-GDVRYHDV 176


>gi|193213666|ref|YP_001999619.1| GCN5-related N-acetyltransferase [Chlorobaculum parvum NCIB 8327]
 gi|193087143|gb|ACF12419.1| GCN5-related N-acetyltransferase [Chlorobaculum parvum NCIB 8327]
          Length = 173

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 65/170 (38%), Gaps = 14/170 (8%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
           + +  + R E    + A+ A +                V+   +    L++S +     R
Sbjct: 1   MHSSLVIRPEMPGDVEAITALTIAAFATLEVSNHTAQFVIEALRNAGALTISLVAELDGR 60

Query: 84  IVGSVRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           +VG +  +P+ +       + LGP+ V P +Q +GIG+ LI   ++  +  G+    LVG
Sbjct: 61  VVGHIAFSPVVMSDGTAGWYGLGPVSVLPDFQRQGIGKALIREGLERLQAIGATGCCLVG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
              YY + GF  V  + L     V P     L           G V   E
Sbjct: 121 HPEYYRQFGF--VNPEGLGHEG-VPPEVFFALVFDGPEP---TGTVSFHE 164


>gi|290473467|ref|YP_003466334.1| putative acyl-CoA N-acyltransferase [Xenorhabdus bovienii SS-2004]
 gi|289172767|emb|CBJ79538.1| putative acyl-CoA N-acyltransferase [Xenorhabdus bovienii SS-2004]
          Length = 167

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 64/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   SF           LRE     L+L  +  +    ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDRLLRQSFETSAEAELVYRLRE--DGLLTLGIVATDDEGYVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            T + +         L P+ V   Y+ +GIG KL+   +D+  + G   +V++G+ AYY 
Sbjct: 59  FTSVDVNGQDHQWVGLAPLAVAEPYRRQGIGEKLVYEGLDSLNEFGYGAVVVLGEPAYYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L     ++  G++   +
Sbjct: 119 RFGFRLAKEYQLHCQWPECEDHFQIYTLADVSLEDCHGLITYSD 162


>gi|118497972|ref|YP_899022.1| acetyltransferase [Francisella tularensis subsp. novicida U112]
 gi|194323195|ref|ZP_03056979.1| acetyltransferase, gnat family [Francisella tularensis subsp.
           novicida FTE]
 gi|208779620|ref|ZP_03246965.1| acetyltransferase, gnat family [Francisella novicida FTG]
 gi|118423878|gb|ABK90268.1| acetyltransferase [Francisella novicida U112]
 gi|194322559|gb|EDX20039.1| acetyltransferase, gnat family [Francisella tularensis subsp.
           novicida FTE]
 gi|208744581|gb|EDZ90880.1| acetyltransferase, gnat family [Francisella novicida FTG]
          Length = 171

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 65/168 (38%), Gaps = 11/168 (6%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGS 87
                R E       ++      F  G      V L     H   +S +   +   I+G 
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEVFDTGDE-EKLVRL-LHTDHQSLISLVAETDDSSIIGQ 58

Query: 88  VRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +
Sbjct: 59  AIISKMTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAMIKEAKKNNIDAIFVLGHPS 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
           YY K GF+      +     V  +  + L L      ++KG  V   +
Sbjct: 119 YYPKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAD 165


>gi|332184502|gb|AEE26756.1| acetyltransferase [Francisella cf. novicida 3523]
          Length = 171

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 64/166 (38%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
                R E       ++   S          ++      H   +S +   +   I+G   
Sbjct: 1   MHVKIRHEKLKDQELIYKLISEAFDTSDEEKLVRLLHTDHQSLISLVAETDDGSIIGQAI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ +++EK      + LGP+ V P YQ++GIG KLI   +  A K     I ++G  +YY
Sbjct: 61  ISKMTVEKNDKLKIYALGPMCVAPKYQHQGIGSKLIEAIIKEATKNNIDAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+      +     V  +  + L L       +KG  V   E
Sbjct: 121 PKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LSQLKGQTVYYAE 165


>gi|21228656|ref|NP_634578.1| acetyltransferase [Methanosarcina mazei Go1]
 gi|20907157|gb|AAM32250.1| Acetyltransferase [Methanosarcina mazei Go1]
          Length = 217

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 66/175 (37%), Gaps = 13/175 (7%)

Query: 25  SRWQKIGAFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSF 76
              +K       R+E +     +   +       + PG         +R+       L F
Sbjct: 8   RSEEKTIMNISIRVEEEKDFKIVEYTTREAFWDLYKPGCDEHLVLHKIRKVPAFVKELDF 67

Query: 77  LCAEGKRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
           +  +   IVG++  +         ++     +GP+ V P YQ +GIG  L++ S++ A +
Sbjct: 68  VACDEDTIVGNIIYSRAKVLNEENKEFEVLCMGPLTVLPSYQKQGIGSLLMNYSIEKARQ 127

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
              + +++ G+  YY + GF       +      + +  + L L     + I G 
Sbjct: 128 LAYKGVIIFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALELYDGSLRGISGK 182


>gi|260752499|ref|YP_003225392.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551862|gb|ACV74808.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 177

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 71/157 (45%), Gaps = 10/157 (6%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE--- 96
               I  +    FG  R  R A  LR+       LSF   +G  + G ++  PI +    
Sbjct: 11  DSQKIEDLLDIGFGKDRHGRTAYRLRQGVSAIPELSFAAVDGDILQGIIQCWPIRLSCLN 70

Query: 97  --KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG---SQVIVLVGDIAYYSK-LG 150
             K+   LLGP+ VHP YQ  GIG+ L+  S+D A+         ++L+GD  YY++  G
Sbjct: 71  GKKLPMILLGPVAVHPDYQGHGIGQSLVQHSLDVADSSDITGHDAVMLIGDPEYYNRFFG 130

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F         LP PV+  R+L   L     ++  G+V
Sbjct: 131 FSDEETGDWRLPGPVEKRRLLAR-LTSPRLRDRAGMV 166


>gi|21229413|ref|NP_635335.1| acetyltransferase [Methanosarcina mazei Go1]
 gi|20908007|gb|AAM33007.1| Acetyltransferase [Methanosarcina mazei Go1]
          Length = 210

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 75/175 (42%), Gaps = 15/175 (8%)

Query: 26  RWQKIGAFFLERLEHDSS-------ICAMHADSFGPGRFVRAAVL--LREQGMHDLSLSF 76
           + +KI      R E ++        I     D + PG  V   +   +R+       L +
Sbjct: 2   KKRKIIMNISIRPEEENDFKNVEHMIREAFWDLYQPG-CVEHLIAHNMRKSPDFVKELDY 60

Query: 77  LCAEGKRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
           +  +G  IVG++  +         ++     +GP+ V P YQ KGIG  L++ +++ A +
Sbjct: 61  VACDGDMIVGNIIYSRAKVINDENKEFEVLCMGPLGVLPSYQKKGIGSLLMNNTIEKARQ 120

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
            G + I + G+  YY++ GF+     ++   +  + +  + L L     + + G 
Sbjct: 121 LGYKAIFIFGNPEYYNRFGFRNTREYNIQTSSGENFDAFMALELYSGSLKQVSGK 175


>gi|317484556|ref|ZP_07943463.1| acetyltransferase [Bilophila wadsworthia 3_1_6]
 gi|316924182|gb|EFV45361.1| acetyltransferase [Bilophila wadsworthia 3_1_6]
          Length = 167

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 64/165 (38%), Gaps = 14/165 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQ-GMHDLSLSFLCAEGKRIVG 86
              R        A+++      +            +L+ + G +   L  +  E   ++G
Sbjct: 1   MTIRQATPKDFDAIYSLVKTAFQTAKVSDGGEQDFVLKLRKGSYIPELELVAEEDGVLIG 60

Query: 87  SVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            + +T  SI +  G     LL P+ V   ++ KGIG  LI  ++  A   G    VL+GD
Sbjct: 61  HIMLTGASIRENGGCFGTLLLAPLSVTLEWRAKGIGAALIREALAKAAALGHSSAVLIGD 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             YY + GF +    S+  P  V     L   L     +NI G +
Sbjct: 121 PGYYGRFGFHSAA--SISYPG-VPGEYTLACELTPGALRNISGAI 162


>gi|56551953|ref|YP_162792.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761960|ref|ZP_04760045.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543527|gb|AAV89681.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373640|gb|EER63212.1| GCN5-related N-acetyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 177

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 71/157 (45%), Gaps = 10/157 (6%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE--- 96
               I  +    FG  R  R A  LR+       LSF   +G  + G ++  PI +    
Sbjct: 11  DSQKIEDLLDIGFGKDRHGRTAYRLRQGVSAIPELSFAAVDGDILQGIIQCWPIRLSCLN 70

Query: 97  --KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG---SQVIVLVGDIAYYSK-LG 150
             K+   LLGP+ VHP YQ  GIG+ L+  S+D A+         ++L+GD  YY++  G
Sbjct: 71  GKKLPMILLGPVAVHPDYQGHGIGQTLVQHSLDVADSSDITGHDAVMLIGDPEYYNRFFG 130

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           F         LP PV+  R+L   L     ++  G+V
Sbjct: 131 FSDEETGDWRLPGPVEKRRLLAR-LTSPRLRDRAGMV 166


>gi|24114447|ref|NP_708957.1| hypothetical protein SF3197 [Shigella flexneri 2a str. 301]
 gi|30064496|ref|NP_838667.1| hypothetical protein S3414 [Shigella flexneri 2a str. 2457T]
 gi|110807025|ref|YP_690545.1| hypothetical protein SFV_3186 [Shigella flexneri 5 str. 8401]
 gi|24053626|gb|AAN44664.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042755|gb|AAP18478.1| hypothetical protein S3414 [Shigella flexneri 2a str. 2457T]
 gi|110616573|gb|ABF05240.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602539|gb|ADA75523.1| putative acetyltransferase yhbS [Shigella flexneri 2002017]
 gi|313648604|gb|EFS13046.1| acetyltransferase, GNAT family [Shigella flexneri 2a str. 2457T]
 gi|332752315|gb|EGJ82705.1| acetyltransferase family protein [Shigella flexneri 4343-70]
 gi|332752842|gb|EGJ83227.1| acetyltransferase family protein [Shigella flexneri K-671]
 gi|332754723|gb|EGJ85089.1| acetyltransferase family protein [Shigella flexneri 2747-71]
 gi|332765152|gb|EGJ95379.1| acetyltransferase family protein [Shigella flexneri 2930-71]
 gi|332999934|gb|EGK19517.1| acetyltransferase family protein [Shigella flexneri K-218]
 gi|333014612|gb|EGK33959.1| acetyltransferase family protein [Shigella flexneri K-304]
          Length = 167

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +  L   L  +    + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFLVHRLADDALNGVTGLVEYHE 162


>gi|254462877|ref|ZP_05076293.1| acetyltransferase, gnat family [Rhodobacterales bacterium HTCC2083]
 gi|206679466|gb|EDZ43953.1| acetyltransferase, gnat family [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 164

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 70/167 (41%), Gaps = 17/167 (10%)

Query: 34  FLERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            + R E  + I A++A +        F  G      ++ R +    L  SF+     +I+
Sbjct: 1   MIIRTETPADIDAIYALTATAFAHQPFSDG--SEPDIINRLRDAGGLRFSFVAERDGQIL 58

Query: 86  GSVRMTPISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           G V ++P++I+       LGPI V P  Q  GIG  L+  ++   ++  +   VLVG+  
Sbjct: 59  GHVALSPVAIKGQSNWFGLGPIAVIPERQKLGIGTALMKRALAGLQQITASGCVLVGNPD 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +YS+ GF  +   +L          V F  L        +G +   +
Sbjct: 119 FYSRFGF--ISNGALTY-FDTPTQYVQFTQLTG---SEPRGEITYHD 159


>gi|254373323|ref|ZP_04988811.1| hypothetical protein FTCG_00910 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151571049|gb|EDN36703.1| hypothetical protein FTCG_00910 [Francisella novicida GA99-3549]
          Length = 171

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 66/168 (39%), Gaps = 11/168 (6%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGS 87
                R E       ++     +F  G      V L     H   +S +   +   I+G 
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTGDE-EKLVRL-LHTDHQSLISLVAETDDSSIIGQ 58

Query: 88  VRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             ++ ++ EK      + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +
Sbjct: 59  AIISKMTAEKDQTLKIYALAPMSVAPKYQHQGIGSKLIEAMIKEAKKNNIDAIFVLGHPS 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
           YY K GF+      +     V  +  + L L      ++KG  V   +
Sbjct: 119 YYPKFGFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAD 165


>gi|218893331|ref|YP_002442200.1| hypothetical protein PLES_46191 [Pseudomonas aeruginosa LESB58]
 gi|218773559|emb|CAW29373.1| hypothetical protein PLES_46191 [Pseudomonas aeruginosa LESB58]
          Length = 168

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIDAIARLTEAAFRNETHSSHTEQYIVDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPERQRQGLGSQLVRRLLTELRLLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+      L LP  V             +A+ I
Sbjct: 121 TYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMARGI 157


>gi|16762039|ref|NP_457656.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16766570|ref|NP_462185.1| transport protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29143528|ref|NP_806870.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56415207|ref|YP_152282.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62181783|ref|YP_218200.1| ABC transporter membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|167552078|ref|ZP_02345831.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167990163|ref|ZP_02571263.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231881|ref|ZP_02656939.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237975|ref|ZP_02663033.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243108|ref|ZP_02668040.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168262715|ref|ZP_02684688.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463503|ref|ZP_02697420.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168819657|ref|ZP_02831657.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445070|ref|YP_002042532.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447647|ref|YP_002047304.1| GNAT family acetyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194470993|ref|ZP_03076977.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735744|ref|YP_002116224.1| GNAT family acetyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247393|ref|YP_002148199.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197263194|ref|ZP_03163268.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364137|ref|YP_002143774.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198241909|ref|YP_002217246.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388988|ref|ZP_03215600.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204928239|ref|ZP_03219439.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205354176|ref|YP_002227977.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858522|ref|YP_002245173.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213163534|ref|ZP_03349244.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425446|ref|ZP_03358196.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213584886|ref|ZP_03366712.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213646158|ref|ZP_03376211.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855694|ref|ZP_03383934.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224585070|ref|YP_002638869.1| acetyltransferase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238910069|ref|ZP_04653906.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289812175|ref|ZP_06542804.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289825788|ref|ZP_06544956.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25364689|pir||AD0900 probable acetyltransferase STY3455 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421830|gb|AAL22144.1| putative ABC superfamily transport protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16504342|emb|CAD07794.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139162|gb|AAO70730.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129464|gb|AAV78970.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62129416|gb|AAX67119.1| putative ABC superfamily (membrane) transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|194403733|gb|ACF63955.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194405951|gb|ACF66170.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457357|gb|EDX46196.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194711246|gb|ACF90467.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633345|gb|EDX51759.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197095614|emb|CAR61181.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197211096|gb|ACH48493.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197241449|gb|EDY24069.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289118|gb|EDY28487.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197936425|gb|ACH73758.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199606086|gb|EDZ04631.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322561|gb|EDZ07758.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273957|emb|CAR38962.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205323208|gb|EDZ11047.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205331158|gb|EDZ17922.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333729|gb|EDZ20493.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337870|gb|EDZ24634.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343372|gb|EDZ30136.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205348609|gb|EDZ35240.1| acetyltransferase, GNAT family [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710325|emb|CAR34683.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224469598|gb|ACN47428.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261248438|emb|CBG26275.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995468|gb|ACY90353.1| putative transport protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159822|emb|CBW19341.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914298|dbj|BAJ38272.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320087721|emb|CBY97485.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322615279|gb|EFY12200.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618362|gb|EFY15253.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622833|gb|EFY19677.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626845|gb|EFY23642.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631414|gb|EFY28174.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635319|gb|EFY32033.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643454|gb|EFY40017.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647110|gb|EFY43611.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648913|gb|EFY45358.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655105|gb|EFY51416.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657708|gb|EFY53976.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664204|gb|EFY60402.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667487|gb|EFY63649.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674735|gb|EFY70827.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675632|gb|EFY71705.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682268|gb|EFY78291.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684871|gb|EFY80869.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716270|gb|EFZ07841.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323131632|gb|ADX19062.1| putative transport protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323191734|gb|EFZ76986.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199041|gb|EFZ84138.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204259|gb|EFZ89268.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207606|gb|EFZ92553.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211341|gb|EFZ96185.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214717|gb|EFZ99466.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221196|gb|EGA05622.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224063|gb|EGA08356.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230289|gb|EGA14408.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233265|gb|EGA17359.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239302|gb|EGA23352.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242447|gb|EGA26473.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246957|gb|EGA30923.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254110|gb|EGA37930.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255227|gb|EGA39004.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262690|gb|EGA46246.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264000|gb|EGA47508.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269386|gb|EGA52841.1| acetyltransferase, GNAT family protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326629297|gb|EGE35640.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332990130|gb|AEF09113.1| putative transport protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 167

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   +
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQVHRLAEDALEGVTGLVEYHD 162


>gi|254244948|ref|ZP_04938270.1| hypothetical protein PA2G_05827 [Pseudomonas aeruginosa 2192]
 gi|126198326|gb|EAZ62389.1| hypothetical protein PA2G_05827 [Pseudomonas aeruginosa 2192]
          Length = 168

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 61/160 (38%), Gaps = 11/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIDAIARLTEAAFRNETHSSHTEQYIIDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +       +   V++G+ 
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPGRQRQGLGSQLVRRLLTELRLLPAGGCVVLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
            YYS+ GF+      L LP  V             +AQ I
Sbjct: 121 TYYSRFGFRV--ESGLALPG-VPAEYFQAQSFSGRMAQGI 157


>gi|323173584|gb|EFZ59213.1| acetyltransferase family protein [Escherichia coli LT-68]
          Length = 167

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRSSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHE 162


>gi|15803698|ref|NP_289732.1| hypothetical protein Z4517 [Escherichia coli O157:H7 EDL933]
 gi|15833291|ref|NP_312064.1| hypothetical protein ECs4037 [Escherichia coli O157:H7 str. Sakai]
 gi|16131048|ref|NP_417625.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli str. K-12 substr. MG1655]
 gi|26249736|ref|NP_755776.1| acetyltransferase YhbS [Escherichia coli CFT073]
 gi|74313693|ref|YP_312112.1| hypothetical protein SSON_3302 [Shigella sonnei Ss046]
 gi|82545604|ref|YP_409551.1| hypothetical protein SBO_3226 [Shigella boydii Sb227]
 gi|82778470|ref|YP_404819.1| hypothetical protein SDY_3335 [Shigella dysenteriae Sd197]
 gi|89109921|ref|AP_003701.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli str. K-12 substr. W3110]
 gi|91212574|ref|YP_542560.1| acetyltransferase YhbS [Escherichia coli UTI89]
 gi|110643397|ref|YP_671127.1| acetyltransferase YhbS [Escherichia coli 536]
 gi|117625452|ref|YP_858775.1| acyltransferase [Escherichia coli APEC O1]
 gi|157155251|ref|YP_001464630.1| acetyltransferase [Escherichia coli E24377A]
 gi|157162641|ref|YP_001459959.1| acetyltransferase [Escherichia coli HS]
 gi|168749250|ref|ZP_02774272.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754135|ref|ZP_02779142.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762120|ref|ZP_02787127.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769572|ref|ZP_02794579.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773179|ref|ZP_02798186.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781298|ref|ZP_02806305.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786039|ref|ZP_02811046.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC869]
 gi|168797755|ref|ZP_02822762.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC508]
 gi|170018592|ref|YP_001723546.1| GCN5-related N-acetyltransferase [Escherichia coli ATCC 8739]
 gi|170082693|ref|YP_001732013.1| acyltransferase [Escherichia coli str. K-12 substr. DH10B]
 gi|170682653|ref|YP_001745429.1| acetyltransferase [Escherichia coli SMS-3-5]
 gi|188495959|ref|ZP_03003229.1| acetyltransferase, GNAT family [Escherichia coli 53638]
 gi|191168061|ref|ZP_03029861.1| acetyltransferase, GNAT family [Escherichia coli B7A]
 gi|191172182|ref|ZP_03033725.1| acetyltransferase, GNAT family [Escherichia coli F11]
 gi|193062027|ref|ZP_03043123.1| acetyltransferase, GNAT family [Escherichia coli E22]
 gi|193067382|ref|ZP_03048350.1| acetyltransferase, GNAT family [Escherichia coli E110019]
 gi|194427777|ref|ZP_03060324.1| acetyltransferase, GNAT family [Escherichia coli B171]
 gi|194433731|ref|ZP_03066006.1| acetyltransferase, GNAT family [Shigella dysenteriae 1012]
 gi|194438837|ref|ZP_03070923.1| acetyltransferase, GNAT family [Escherichia coli 101-1]
 gi|195938376|ref|ZP_03083758.1| acyltransferase [Escherichia coli O157:H7 str. EC4024]
 gi|208806048|ref|ZP_03248385.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813356|ref|ZP_03254685.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819165|ref|ZP_03259485.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400093|ref|YP_002272627.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920633|ref|YP_002294717.1| hypothetical protein ECSE_3442 [Escherichia coli SE11]
 gi|215488474|ref|YP_002330905.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217326799|ref|ZP_03442882.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           TW14588]
 gi|218550425|ref|YP_002384216.1| acyltransferase [Escherichia fergusonii ATCC 35469]
 gi|218555728|ref|YP_002388641.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli IAI1]
 gi|218560228|ref|YP_002393141.1| acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia
           coli S88]
 gi|218691448|ref|YP_002399660.1| putative acyl-CoA N-acyltransferase domain-containing
           acyltransferase [Escherichia coli ED1a]
 gi|218696863|ref|YP_002404530.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli 55989]
 gi|218701927|ref|YP_002409556.1| putative acyl-CoA N-acyltransferase domain-containing
           acyltransferase [Escherichia coli IAI39]
 gi|218706776|ref|YP_002414295.1| putative acyltransferase [Escherichia coli UMN026]
 gi|227887879|ref|ZP_04005684.1| GNAT family acetyltransferase [Escherichia coli 83972]
 gi|237706091|ref|ZP_04536572.1| acetyltransferase YhbS [Escherichia sp. 3_2_53FAA]
 gi|238902260|ref|YP_002928056.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli BW2952]
 gi|253772008|ref|YP_003034839.1| GCN5-related N-acetyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038321|ref|ZP_04872379.1| acetyltransferase [Escherichia sp. 1_1_43]
 gi|254163100|ref|YP_003046208.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli B str. REL606]
 gi|254795107|ref|YP_003079944.1| putative acyl-CoA N-acyltransferase domain-containing
           acyltransferase [Escherichia coli O157:H7 str. TW14359]
 gi|256018924|ref|ZP_05432789.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Shigella sp. D9]
 gi|256024268|ref|ZP_05438133.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia sp. 4_1_40B]
 gi|260845971|ref|YP_003223749.1| putative acyltransferase [Escherichia coli O103:H2 str. 12009]
 gi|260857284|ref|YP_003231175.1| putative acyltransferase [Escherichia coli O26:H11 str. 11368]
 gi|260869908|ref|YP_003236310.1| putative acyltransferase [Escherichia coli O111:H- str. 11128]
 gi|261228168|ref|ZP_05942449.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255024|ref|ZP_05947557.1| putative acyltransferase [Escherichia coli O157:H7 str. FRIK966]
 gi|291284532|ref|YP_003501350.1| hypothetical protein G2583_3880 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406766|ref|ZP_06650692.1| acetyltransferase [Escherichia coli FVEC1412]
 gi|293412531|ref|ZP_06655254.1| N-acetyltransferase yhbS [Escherichia coli B354]
 gi|293416590|ref|ZP_06659229.1| acetyltransferase [Escherichia coli B185]
 gi|293449493|ref|ZP_06663914.1| N-acetyltransferase yhbS [Escherichia coli B088]
 gi|297517551|ref|ZP_06935937.1| hypothetical protein EcolOP_07917 [Escherichia coli OP50]
 gi|298382506|ref|ZP_06992103.1| acetyltransferase [Escherichia coli FVEC1302]
 gi|300817592|ref|ZP_07097808.1| acetyltransferase, GNAT family [Escherichia coli MS 107-1]
 gi|300823881|ref|ZP_07104005.1| acetyltransferase, GNAT family [Escherichia coli MS 119-7]
 gi|300897917|ref|ZP_07116296.1| acetyltransferase, GNAT family [Escherichia coli MS 198-1]
 gi|300918911|ref|ZP_07135470.1| acetyltransferase, GNAT family [Escherichia coli MS 115-1]
 gi|300923497|ref|ZP_07139534.1| acetyltransferase, GNAT family [Escherichia coli MS 182-1]
 gi|300929846|ref|ZP_07145292.1| acetyltransferase, GNAT family [Escherichia coli MS 187-1]
 gi|300938065|ref|ZP_07152843.1| acetyltransferase, GNAT family [Escherichia coli MS 21-1]
 gi|300948804|ref|ZP_07162872.1| acetyltransferase, GNAT family [Escherichia coli MS 116-1]
 gi|300955742|ref|ZP_07168087.1| acetyltransferase, GNAT family [Escherichia coli MS 175-1]
 gi|300977822|ref|ZP_07174062.1| acetyltransferase, GNAT family [Escherichia coli MS 200-1]
 gi|300990754|ref|ZP_07179326.1| acetyltransferase, GNAT family [Escherichia coli MS 45-1]
 gi|301022009|ref|ZP_07185952.1| acetyltransferase, GNAT family [Escherichia coli MS 69-1]
 gi|301026000|ref|ZP_07189482.1| acetyltransferase, GNAT family [Escherichia coli MS 196-1]
 gi|301048003|ref|ZP_07195045.1| acetyltransferase, GNAT family [Escherichia coli MS 185-1]
 gi|301301788|ref|ZP_07207922.1| acetyltransferase, GNAT family [Escherichia coli MS 124-1]
 gi|301326818|ref|ZP_07220122.1| acetyltransferase, GNAT family [Escherichia coli MS 78-1]
 gi|301644867|ref|ZP_07244839.1| acetyltransferase, GNAT family [Escherichia coli MS 146-1]
 gi|306816500|ref|ZP_07450632.1| hypothetical protein ECNC101_07779 [Escherichia coli NC101]
 gi|307139843|ref|ZP_07499199.1| hypothetical protein EcolH7_17148 [Escherichia coli H736]
 gi|307313137|ref|ZP_07592763.1| GCN5-related N-acetyltransferase [Escherichia coli W]
 gi|309785483|ref|ZP_07680114.1| acetyltransferase, GNAT family [Shigella dysenteriae 1617]
 gi|309793734|ref|ZP_07688160.1| acetyltransferase, GNAT family [Escherichia coli MS 145-7]
 gi|312968506|ref|ZP_07782715.1| acetyltransferase, GNAT family [Escherichia coli 2362-75]
 gi|312972573|ref|ZP_07786746.1| acetyltransferase family protein [Escherichia coli 1827-70]
 gi|331643856|ref|ZP_08344987.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H736]
 gi|331648955|ref|ZP_08350043.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli M605]
 gi|331654761|ref|ZP_08355761.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli M718]
 gi|331659445|ref|ZP_08360387.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA206]
 gi|331669815|ref|ZP_08370660.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA271]
 gi|331674694|ref|ZP_08375453.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA280]
 gi|331679237|ref|ZP_08379909.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H591]
 gi|331684804|ref|ZP_08385396.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H299]
 gi|332280015|ref|ZP_08392428.1| acyltransferase [Shigella sp. D9]
 gi|54040222|sp|P63418|YHBS_ECOL6 RecName: Full=Uncharacterized N-acetyltransferase YhbS
 gi|54040223|sp|P63419|YHBS_ECO57 RecName: Full=Uncharacterized N-acetyltransferase YhbS
 gi|54042349|sp|P63417|YHBS_ECOLI RecName: Full=Uncharacterized N-acetyltransferase YhbS
 gi|12517764|gb|AAG58292.1|AE005544_6 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26110164|gb|AAN82350.1|AE016767_110 Hypothetical acetyltransferase yhbS [Escherichia coli CFT073]
 gi|606096|gb|AAA57959.1| ORF_f167; end overlaps end of o100 by 14 bases; start overlaps
           f174, other starts possible [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789546|gb|AAC76190.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13363510|dbj|BAB37460.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|73857170|gb|AAZ89877.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242618|gb|ABB63328.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81247015|gb|ABB67723.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85675952|dbj|BAE77202.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli str. K12 substr. W3110]
 gi|91074148|gb|ABE09029.1| Hypothetical acetyltransferase YhbS [Escherichia coli UTI89]
 gi|110344989|gb|ABG71226.1| hypothetical acetyltransferase YhbS [Escherichia coli 536]
 gi|115514576|gb|ABJ02651.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli APEC O1]
 gi|157068321|gb|ABV07576.1| acetyltransferase, GNAT family [Escherichia coli HS]
 gi|157077281|gb|ABV16989.1| acetyltransferase, GNAT family [Escherichia coli E24377A]
 gi|169753520|gb|ACA76219.1| GCN5-related N-acetyltransferase [Escherichia coli ATCC 8739]
 gi|169890528|gb|ACB04235.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170520371|gb|ACB18549.1| acetyltransferase, GNAT family [Escherichia coli SMS-3-5]
 gi|187770855|gb|EDU34699.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016376|gb|EDU54498.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4113]
 gi|188491158|gb|EDU66261.1| acetyltransferase, GNAT family [Escherichia coli 53638]
 gi|189001081|gb|EDU70067.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358480|gb|EDU76899.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361431|gb|EDU79850.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367566|gb|EDU85982.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373901|gb|EDU92317.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC869]
 gi|189379808|gb|EDU98224.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC508]
 gi|190901930|gb|EDV61679.1| acetyltransferase, GNAT family [Escherichia coli B7A]
 gi|190907492|gb|EDV67088.1| acetyltransferase, GNAT family [Escherichia coli F11]
 gi|192932247|gb|EDV84845.1| acetyltransferase, GNAT family [Escherichia coli E22]
 gi|192959339|gb|EDV89774.1| acetyltransferase, GNAT family [Escherichia coli E110019]
 gi|194414285|gb|EDX30560.1| acetyltransferase, GNAT family [Escherichia coli B171]
 gi|194417994|gb|EDX34088.1| acetyltransferase, GNAT family [Shigella dysenteriae 1012]
 gi|194422309|gb|EDX38310.1| acetyltransferase, GNAT family [Escherichia coli 101-1]
 gi|208725849|gb|EDZ75450.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734633|gb|EDZ83320.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739288|gb|EDZ86970.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161493|gb|ACI38926.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           EC4115]
 gi|209758458|gb|ACI77541.1| hypothetical protein ECs4037 [Escherichia coli]
 gi|209758460|gb|ACI77542.1| hypothetical protein ECs4037 [Escherichia coli]
 gi|209758462|gb|ACI77543.1| hypothetical protein ECs4037 [Escherichia coli]
 gi|209758464|gb|ACI77544.1| hypothetical protein ECs4037 [Escherichia coli]
 gi|209758466|gb|ACI77545.1| hypothetical protein ECs4037 [Escherichia coli]
 gi|209913892|dbj|BAG78966.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266546|emb|CAS10985.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217319166|gb|EEC27591.1| acetyltransferase, GNAT family [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353595|emb|CAU99777.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli 55989]
 gi|218357966|emb|CAQ90612.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia fergusonii ATCC 35469]
 gi|218362496|emb|CAR00120.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli IAI1]
 gi|218366997|emb|CAR04768.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli S88]
 gi|218371913|emb|CAR19769.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli IAI39]
 gi|218429012|emb|CAR09959.2| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli ED1a]
 gi|218433873|emb|CAR14790.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli UMN026]
 gi|222034875|emb|CAP77618.1| Uncharacterized acetyltransferase yhbS [Escherichia coli LF82]
 gi|226839945|gb|EEH71966.1| acetyltransferase [Escherichia sp. 1_1_43]
 gi|226899131|gb|EEH85390.1| acetyltransferase YhbS [Escherichia sp. 3_2_53FAA]
 gi|227835275|gb|EEJ45741.1| GNAT family acetyltransferase [Escherichia coli 83972]
 gi|238862128|gb|ACR64126.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli BW2952]
 gi|242378701|emb|CAQ33491.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli BL21(DE3)]
 gi|253323052|gb|ACT27654.1| GCN5-related N-acetyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975001|gb|ACT40672.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli B str. REL606]
 gi|253979157|gb|ACT44827.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli BL21(DE3)]
 gi|254594507|gb|ACT73868.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli O157:H7 str. TW14359]
 gi|257755933|dbj|BAI27435.1| predicted acyltransferase [Escherichia coli O26:H11 str. 11368]
 gi|257761118|dbj|BAI32615.1| predicted acyltransferase [Escherichia coli O103:H2 str. 12009]
 gi|257766264|dbj|BAI37759.1| predicted acyltransferase [Escherichia coli O111:H- str. 11128]
 gi|260447815|gb|ACX38237.1| GCN5-related N-acetyltransferase [Escherichia coli DH1]
 gi|284923178|emb|CBG36272.1| putative acetyltransferase [Escherichia coli 042]
 gi|290764405|gb|ADD58366.1| Uncharacterized acetyltransferase yhbS [Escherichia coli O55:H7
           str. CB9615]
 gi|291322583|gb|EFE62012.1| N-acetyltransferase yhbS [Escherichia coli B088]
 gi|291426772|gb|EFE99804.1| acetyltransferase [Escherichia coli FVEC1412]
 gi|291431946|gb|EFF04929.1| acetyltransferase [Escherichia coli B185]
 gi|291469302|gb|EFF11793.1| N-acetyltransferase yhbS [Escherichia coli B354]
 gi|294493644|gb|ADE92400.1| acetyltransferase, GNAT family [Escherichia coli IHE3034]
 gi|298277646|gb|EFI19162.1| acetyltransferase [Escherichia coli FVEC1302]
 gi|299879895|gb|EFI88106.1| acetyltransferase, GNAT family [Escherichia coli MS 196-1]
 gi|300300146|gb|EFJ56531.1| acetyltransferase, GNAT family [Escherichia coli MS 185-1]
 gi|300308199|gb|EFJ62719.1| acetyltransferase, GNAT family [Escherichia coli MS 200-1]
 gi|300317375|gb|EFJ67159.1| acetyltransferase, GNAT family [Escherichia coli MS 175-1]
 gi|300358347|gb|EFJ74217.1| acetyltransferase, GNAT family [Escherichia coli MS 198-1]
 gi|300397724|gb|EFJ81262.1| acetyltransferase, GNAT family [Escherichia coli MS 69-1]
 gi|300407062|gb|EFJ90600.1| acetyltransferase, GNAT family [Escherichia coli MS 45-1]
 gi|300413937|gb|EFJ97247.1| acetyltransferase, GNAT family [Escherichia coli MS 115-1]
 gi|300420238|gb|EFK03549.1| acetyltransferase, GNAT family [Escherichia coli MS 182-1]
 gi|300451693|gb|EFK15313.1| acetyltransferase, GNAT family [Escherichia coli MS 116-1]
 gi|300456925|gb|EFK20418.1| acetyltransferase, GNAT family [Escherichia coli MS 21-1]
 gi|300462208|gb|EFK25701.1| acetyltransferase, GNAT family [Escherichia coli MS 187-1]
 gi|300523649|gb|EFK44718.1| acetyltransferase, GNAT family [Escherichia coli MS 119-7]
 gi|300529890|gb|EFK50952.1| acetyltransferase, GNAT family [Escherichia coli MS 107-1]
 gi|300842769|gb|EFK70529.1| acetyltransferase, GNAT family [Escherichia coli MS 124-1]
 gi|300846543|gb|EFK74303.1| acetyltransferase, GNAT family [Escherichia coli MS 78-1]
 gi|301076812|gb|EFK91618.1| acetyltransferase, GNAT family [Escherichia coli MS 146-1]
 gi|305850065|gb|EFM50524.1| hypothetical protein ECNC101_07779 [Escherichia coli NC101]
 gi|306907048|gb|EFN37556.1| GCN5-related N-acetyltransferase [Escherichia coli W]
 gi|307555252|gb|ADN48027.1| acetyltransferase [Escherichia coli ABU 83972]
 gi|307625243|gb|ADN69547.1| hypothetical protein UM146_00590 [Escherichia coli UM146]
 gi|308122691|gb|EFO59953.1| acetyltransferase, GNAT family [Escherichia coli MS 145-7]
 gi|308926603|gb|EFP72079.1| acetyltransferase, GNAT family [Shigella dysenteriae 1617]
 gi|309703584|emb|CBJ02924.1| putative acetyltransferase [Escherichia coli ETEC H10407]
 gi|310332515|gb|EFP99728.1| acetyltransferase family protein [Escherichia coli 1827-70]
 gi|312286724|gb|EFR14635.1| acetyltransferase, GNAT family [Escherichia coli 2362-75]
 gi|312947715|gb|ADR28542.1| putative acyltransferase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315062464|gb|ADT76791.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Escherichia coli W]
 gi|315137744|dbj|BAJ44903.1| hypothetical protein ECDH1ME8569_3047 [Escherichia coli DH1]
 gi|315257082|gb|EFU37050.1| acetyltransferase, GNAT family [Escherichia coli MS 85-1]
 gi|315288942|gb|EFU48340.1| acetyltransferase, GNAT family [Escherichia coli MS 110-3]
 gi|315294900|gb|EFU54239.1| acetyltransferase, GNAT family [Escherichia coli MS 153-1]
 gi|315297858|gb|EFU57132.1| acetyltransferase, GNAT family [Escherichia coli MS 16-3]
 gi|315617239|gb|EFU97848.1| acetyltransferase family protein [Escherichia coli 3431]
 gi|320640228|gb|EFX09800.1| hypothetical protein ECO5101_09731 [Escherichia coli O157:H7 str.
           G5101]
 gi|320645525|gb|EFX14534.1| hypothetical protein ECO9389_07867 [Escherichia coli O157:H- str.
           493-89]
 gi|320650835|gb|EFX19292.1| hypothetical protein ECO2687_14119 [Escherichia coli O157:H- str. H
           2687]
 gi|320656216|gb|EFX24128.1| hypothetical protein ECO7815_18709 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661906|gb|EFX29314.1| hypothetical protein ECO5905_12553 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666741|gb|EFX33720.1| hypothetical protein ECOSU61_06400 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323154366|gb|EFZ40567.1| acetyltransferase family protein [Escherichia coli EPECa14]
 gi|323162850|gb|EFZ48685.1| acetyltransferase family protein [Escherichia coli E128010]
 gi|323165112|gb|EFZ50902.1| acetyltransferase family protein [Shigella sonnei 53G]
 gi|323178868|gb|EFZ64444.1| acetyltransferase family protein [Escherichia coli 1180]
 gi|323183111|gb|EFZ68509.1| acetyltransferase family protein [Escherichia coli 1357]
 gi|323189222|gb|EFZ74506.1| acetyltransferase family protein [Escherichia coli RN587/1]
 gi|323376948|gb|ADX49216.1| GCN5-related N-acetyltransferase [Escherichia coli KO11]
 gi|323936148|gb|EGB32442.1| acetyltransferase [Escherichia coli E1520]
 gi|323941742|gb|EGB37921.1| acetyltransferase [Escherichia coli E482]
 gi|323946880|gb|EGB42897.1| acetyltransferase [Escherichia coli H120]
 gi|323951324|gb|EGB47199.1| acetyltransferase [Escherichia coli H252]
 gi|323957695|gb|EGB53409.1| acetyltransferase [Escherichia coli H263]
 gi|323966338|gb|EGB61772.1| acetyltransferase [Escherichia coli M863]
 gi|323970279|gb|EGB65550.1| acetyltransferase [Escherichia coli TA007]
 gi|323979125|gb|EGB74203.1| acetyltransferase [Escherichia coli TW10509]
 gi|324008754|gb|EGB77973.1| acetyltransferase, GNAT family [Escherichia coli MS 57-2]
 gi|324012119|gb|EGB81338.1| acetyltransferase, GNAT family [Escherichia coli MS 60-1]
 gi|324018320|gb|EGB87539.1| acetyltransferase, GNAT family [Escherichia coli MS 117-3]
 gi|324115252|gb|EGC09216.1| acetyltransferase [Escherichia fergusonii B253]
 gi|324119523|gb|EGC13405.1| acetyltransferase [Escherichia coli E1167]
 gi|325498725|gb|EGC96584.1| hypothetical protein ECD227_2822 [Escherichia fergusonii ECD227]
 gi|327251937|gb|EGE63623.1| acetyltransferase family protein [Escherichia coli STEC_7v]
 gi|330909214|gb|EGH37728.1| acetyltransferase [Escherichia coli AA86]
 gi|331037327|gb|EGI09551.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H736]
 gi|331042702|gb|EGI14844.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli M605]
 gi|331048143|gb|EGI20220.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli M718]
 gi|331054027|gb|EGI26056.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA206]
 gi|331062728|gb|EGI34642.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA271]
 gi|331068133|gb|EGI39529.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA280]
 gi|331073302|gb|EGI44625.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H591]
 gi|331078419|gb|EGI49625.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli H299]
 gi|332086113|gb|EGI91275.1| acetyltransferase family protein [Shigella boydii 5216-82]
 gi|332086384|gb|EGI91531.1| acetyltransferase family protein [Shigella dysenteriae 155-74]
 gi|332090705|gb|EGI95799.1| acetyltransferase family protein [Shigella boydii 3594-74]
 gi|332102367|gb|EGJ05713.1| acyltransferase [Shigella sp. D9]
 gi|332345113|gb|AEE58447.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332998798|gb|EGK18394.1| acetyltransferase family protein [Shigella flexneri VA-6]
 gi|332999235|gb|EGK18821.1| acetyltransferase family protein [Shigella flexneri K-272]
 gi|333014956|gb|EGK34300.1| acetyltransferase family protein [Shigella flexneri K-227]
          Length = 167

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHE 162


>gi|283788216|ref|YP_003368081.1| acetyltransferase [Citrobacter rodentium ICC168]
 gi|282951670|emb|CBG91370.1| putative acetyltransferase [Citrobacter rodentium ICC168]
          Length = 167

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDENYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   E
Sbjct: 119 RFGFELAAHYDLRCRWPGTESAFQVHRLAEDALKGVTGLVEYHE 162


>gi|157148722|ref|YP_001456040.1| hypothetical protein CKO_04551 [Citrobacter koseri ATCC BAA-895]
 gi|157085927|gb|ABV15605.1| hypothetical protein CKO_04551 [Citrobacter koseri ATCC BAA-895]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRTF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +G+ A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDENYRGQGLARQLVYEGLDSLNEFGYAAVVTLGEPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++    + G+V   +
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQVHRLAEDALDGVTGLVEYHD 162


>gi|326625023|gb|EGE31368.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDALGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   +
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQVHRLAEDALEGVTGLVEYHD 162


>gi|331664767|ref|ZP_08365672.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA143]
 gi|331058015|gb|EGI29997.1| putative ABC superfamily (membrane) transport protein [Escherichia
           coli TA143]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +  + + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALKGVTGLVEYHE 162


>gi|261342602|ref|ZP_05970460.1| acetyltransferase [Enterobacter cancerogenus ATCC 35316]
 gi|288315249|gb|EFC54187.1| acetyltransferase [Enterobacter cancerogenus ATCC 35316]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    ++L  +  +   ++VG V 
Sbjct: 1   MLIRVEIGIDAPGIDALLRRSF--ESDAEAQLVQDLREDGLITLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+++   +D+  + G   +V +GD A+Y 
Sbjct: 59  FSPVVVQGEELQWVGMAPLAVDERYRGQGLARQMVYEGLDSLNEFGYAAVVTLGDPAFYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +LGF+      L    P   +      L  +    + G+V   +
Sbjct: 119 RLGFEQAAHYDLRCRWPGTESAFQVHRLADDALNGVNGLVEYHD 162


>gi|283836298|ref|ZP_06356039.1| acetyltransferase [Citrobacter youngae ATCC 29220]
 gi|291067661|gb|EFE05770.1| acetyltransferase [Citrobacter youngae ATCC 29220]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDENYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +  + + G+V   +
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALEGVSGLVEYHD 162


>gi|170766016|ref|ZP_02900827.1| acetyltransferase, GNAT family [Escherichia albertii TW07627]
 gi|170125162|gb|EDS94093.1| acetyltransferase, GNAT family [Escherichia albertii TW07627]
          Length = 167

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +  L   L  +    + G+V   +
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFLVHRLADDALNGVTGLVEYHD 162


>gi|300904342|ref|ZP_07122195.1| acetyltransferase, GNAT family [Escherichia coli MS 84-1]
 gi|300403693|gb|EFJ87231.1| acetyltransferase, GNAT family [Escherichia coli MS 84-1]
          Length = 170

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   +
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHD 162


>gi|193215708|ref|YP_001996907.1| GCN5-related N-acetyltransferase [Chloroherpeton thalassium ATCC
           35110]
 gi|193089185|gb|ACF14460.1| GCN5-related N-acetyltransferase [Chloroherpeton thalassium ATCC
           35110]
          Length = 166

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E  +   A+   +    +           V++  +    L++S +      +VG 
Sbjct: 1   MQIRKETAADSDAITTVTVEAFKTLEVSDQTEQFVIIALRKAGALTISLVAEMSGEVVGH 60

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P++        + LGP+ V P +Q +GIG  LI+  +   ++ G+    LVG   Y
Sbjct: 61  IAFSPVTLSDGTQNWYGLGPVSVLPKFQKQGIGAALINEGLSMLKEIGAAGCALVGHPGY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF+     +L     V       +P  + + Q 
Sbjct: 121 YKRFGFKNSTDLTL---DGVPQEAFFVMPFNERIPQG 154


>gi|209549698|ref|YP_002281615.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535454|gb|ACI55389.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 168

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 8/126 (6%)

Query: 34  FLERLEHDSSICAMHADS---FGPGRF---VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E  + I A+H  +   F P  +     A ++ R +   DL++S +  + + I+G 
Sbjct: 1   MLIRYETPADIDAIHDLTSVAFKPMPYSDGTEAEIVSRLRASGDLTISLVAEDDEEILGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P++I  +      LGPI V P  Q +GIG+ LI   ++  + +G+    L+G+   
Sbjct: 61  IAFSPVTINGVHGGWFGLGPISVKPERQRQGIGKALIVRGLELLKDRGATGCALIGNPDI 120

Query: 146 YSKLGF 151
           YS++GF
Sbjct: 121 YSRVGF 126


>gi|237730076|ref|ZP_04560557.1| acetyltransferase YhbS [Citrobacter sp. 30_2]
 gi|226908682|gb|EEH94600.1| acetyltransferase YhbS [Citrobacter sp. 30_2]
          Length = 167

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDENYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   +
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALDGVTGLVEYHD 162


>gi|187734054|ref|YP_001881927.1| acetyltransferase, GNAT family [Shigella boydii CDC 3083-94]
 gi|187431046|gb|ACD10320.1| acetyltransferase, GNAT family [Shigella boydii CDC 3083-94]
          Length = 167

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ RKL+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARKLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +    + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHE 162


>gi|123507187|ref|XP_001329365.1| acetyltransferase, GNAT family protein [Trichomonas vaginalis G3]
 gi|121912319|gb|EAY17142.1| acetyltransferase, GNAT family protein [Trichomonas vaginalis G3]
          Length = 177

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 9/167 (5%)

Query: 34  FLERLEHDSSICAMH---ADSFGPGRFVRAAVL-----LREQGMHDLSLSFLCAEGKRIV 85
              R         +     ++F                LR    +   L  +     +I+
Sbjct: 2   LKIREVSQEDFDPIFHVVEEAFRNADHASHKEQYIVTKLRASKEYIPGLELVGEIDGKII 61

Query: 86  GSVRMTPISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           G + +T   +++     +LGP  + P +QNKG GR LI+ +   A + G + IVLVG   
Sbjct: 62  GHILLTKAFVDEKYETLILGPFSILPNFQNKGYGRLLINAAHQKAIELGHKTIVLVGHSW 121

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            Y K G++ +   ++ +P P     V  + LV      I GI+R  +
Sbjct: 122 LYPKFGYKRLSTYNIKMPFPCPDENVFGIELVPGGFDGITGILRFSD 168


>gi|84494794|ref|ZP_00993913.1| GCN5-related N-acetyltransferase [Janibacter sp. HTCC2649]
 gi|84384287|gb|EAQ00167.1| GCN5-related N-acetyltransferase [Janibacter sp. HTCC2649]
          Length = 177

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/148 (31%), Positives = 73/148 (49%), Gaps = 6/148 (4%)

Query: 35  LERLEHDSSICAMHADSF----GPGRFVRAAVLLREQGMHD--LSLSFLCAEGKRIVGSV 88
            ERLE  ++I A+H D+F    G  R V +A++   +G  D    L+F+      ++G V
Sbjct: 9   RERLEDHAAIAALHDDAFPRVDGAARSVESALIDELRGDGDVIEELTFVAELDGEVIGHV 68

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
             +  ++ +     LGPI V P  Q +GIG  LI+  + +AE++G   IVL+GD AYY+ 
Sbjct: 69  MCSAATLGEEPSVGLGPIAVAPALQQQGIGAALIASVIASAEQRGDAAIVLLGDPAYYAH 128

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLV 176
            GF A     +  P   +        L 
Sbjct: 129 FGFVAASQHHVRSPGAWEDQYFQIKTLR 156


>gi|323698022|ref|ZP_08109934.1| GCN5-related N-acetyltransferase [Desulfovibrio sp. ND132]
 gi|323457954|gb|EGB13819.1| GCN5-related N-acetyltransferase [Desulfovibrio desulfuricans
           ND132]
          Length = 184

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 76/178 (42%), Gaps = 30/178 (16%)

Query: 34  FLERLEHDSSICAMHADSFGPGR----------FVRAAVLLREQGMHDLSLSFLCAEGKR 83
            L RLE D+   A+ A  +   R               ++   +    LSLS +  +G  
Sbjct: 1   MLIRLETDNDEAAIRAVEYAAFRNHPQHAPGAEPTEHLIVDALRASGRLSLSLVAEDGGA 60

Query: 84  IVGSVRMTP--------------ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAA 129
           +VG V ++P              +       +LLGP+ V P  Q +GIG  LI  +++  
Sbjct: 61  VVGHVALSPALLGNAPEDAPEVAMKDGNQGWYLLGPVGVTPERQGRGIGSALIREALEVM 120

Query: 130 EKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
             +G++ +VLVG+  YY++ GF A P   L +   V    VL L L       ++G +
Sbjct: 121 RDRGARGVVLVGEPGYYARFGFSARP--GLTM-DGVPGRYVLGLSLDDG---EVRGRI 172


>gi|293393136|ref|ZP_06637451.1| GNAT family acetyltransferase [Serratia odorifera DSM 4582]
 gi|291424282|gb|EFE97496.1| GNAT family acetyltransferase [Serratia odorifera DSM 4582]
          Length = 167

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 61/162 (37%), Gaps = 4/162 (2%)

Query: 34  FLERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMT 91
            L R+E       +        G    A ++ + +    L+L  +  +    +VG    +
Sbjct: 1   MLIRVEIPVDAAGIDNLLRRAFGGDDEADLVQQLREDGLLTLGIVATDDEGGVVGYAAFS 60

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           P+ +         L P+ V    + +G+G KL+   +DA  +     +V++G+  YY + 
Sbjct: 61  PVEVAGEDRQWVGLAPLAVDESLRRQGLGEKLVYEGLDALNEFSYAAVVVLGEPEYYGRF 120

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           GF+      L    P         PL ++    + G+V    
Sbjct: 121 GFKRAADYDLHCRWPETEQAFQVYPLGEDALTGVNGLVAYAA 162


>gi|154496516|ref|ZP_02035212.1| hypothetical protein BACCAP_00808 [Bacteroides capillosus ATCC
           29799]
 gi|150274149|gb|EDN01240.1| hypothetical protein BACCAP_00808 [Bacteroides capillosus ATCC
           29799]
          Length = 208

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 66/175 (37%), Gaps = 18/175 (10%)

Query: 29  KIGAFFLERLEHDSSICAMHADS-------FGPGRFVRA--AVLLREQGMHDLSLSFLCA 79
                 + R E  S   A+   +       + PG         +LR+       L  +  
Sbjct: 1   MKSDDIIIRRETPSDYDAVEHLTREAFWNVYRPG-CTEHYVVHVLRKDPAFVPELDLVME 59

Query: 80  EGKRIVGSVRMTPISIEKITGHLL-----GPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
              +++G V      I    G  L     GPI +HP +Q +G+G++L+  S++ A + G+
Sbjct: 60  RNGQLIGHVMYMRAKITADDGRELPVMTFGPISIHPDFQRRGLGKRLLDESMERARELGA 119

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPN---RVLFLPLVQNVAQNIKGI 186
             + + G+IA+Y K GF     K +      +       L   L       + G+
Sbjct: 120 GALCIEGNIAFYGKSGFVVAGTKGIRYHGEPEQEMVPYFLMKELRPGFLDGVTGV 174


>gi|171058529|ref|YP_001790878.1| GCN5-like N-acetyltransferase [Leptothrix cholodnii SP-6]
 gi|170775974|gb|ACB34113.1| GCN5-related N-acetyltransferase [Leptothrix cholodnii SP-6]
          Length = 175

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 69/167 (41%), Gaps = 14/167 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E  S   ++   +                ++   +  H LS+S +  +  RIV
Sbjct: 1   MTITIRPEAPSDEDSIEQVTRRAFLTHPYSHQTEQFIIRALRADHALSVSLVAEDAGRIV 60

Query: 86  GSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V ++P+S++  +   + LGPI V P  Q +GIGR L+   +    K G+   VLVGD 
Sbjct: 61  GHVAISPVSVDDGSGGWYGLGPISVEPNLQRRGIGRSLMEKGLAELRKFGANGCVLVGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           A+YS+ GF   P   L     +     L L        +  G V+  
Sbjct: 121 AFYSRFGFANDPALVLE---GIPKEFFLSLSF---GTSSAHGNVQFH 161


>gi|254374786|ref|ZP_04990267.1| acetyltransferase [Francisella novicida GA99-3548]
 gi|151572505|gb|EDN38159.1| acetyltransferase [Francisella novicida GA99-3548]
          Length = 171

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 68/168 (40%), Gaps = 11/168 (6%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGS 87
                R E       ++     +F  G      V L     H   +S +   +G  I+G 
Sbjct: 1   MHVKIRYEKLKDQELIYKLISEAFDTGDE-EKLVRL-LHTDHQSLISLVAETDGSSIIGQ 58

Query: 88  VRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             ++ ++ EK      + L P+ V P YQ++GIG KLI   ++ A+K     I ++G  +
Sbjct: 59  AIISKMTAEKDQTLKIYALAPMSVAPKYQHQGIGSKLIEAMINEAKKNNIDAIFVLGHPS 118

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
           YY K GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 119 YYPKFGFKPATEYQIKCEYDVPVDVFMVLDLSAK-LASLKGQTVYYAE 165


>gi|116252552|ref|YP_768390.1| acetyltransferase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257200|emb|CAK08295.1| putative acetyltransferase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 164

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E    I A+H  +    +         A ++ R +   DL +S +  +G  I+G 
Sbjct: 1   MLIRDETPDDIDAIHDLTSTAFKPMPYSDGTEAEIVRRLRAAGDLKISLVAEQGGEILGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I+        LGPI V P  Q +GIG+ +I+  ++  ++ G+    L+G+   
Sbjct: 61  VAFSPVTIDGAHEGWFGLGPISVKPERQRQGIGKAMIARGLELLKEMGASGCALIGNPEI 120

Query: 146 YSKLGFQAVPWKS 158
           YS++GF +     
Sbjct: 121 YSRVGFSSDGQLK 133


>gi|150400242|ref|YP_001324009.1| GCN5-like N-acetyltransferase [Methanococcus vannielii SB]
 gi|150012945|gb|ABR55397.1| GCN5-related N-acetyltransferase [Methanococcus vannielii SB]
          Length = 201

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 14/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
                R+E+ +    +   +       + PG      +L  LR+       LSF+  +G 
Sbjct: 1   MNISVRVENQNDYNEVENITREAFWDVYKPG-CDEHLILHKLRQSSEFIKELSFVAVDGN 59

Query: 83  RIVGSVRMTPI----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
            I+G +  +      +  +     +GPI V P YQ KGIG  L++ S++AA+      IV
Sbjct: 60  NILGHIIYSKAKVINNNIEHEVLCMGPISVVPNYQCKGIGSLLLNHSINAAKMLNYSCIV 119

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
             G+  YY   GF+      +     ++    + L L Q+  + I G 
Sbjct: 120 TFGNPKYYHNFGFENAQKYGITTSNGMNFEEFMVLCLNQDSLEKISGK 167


>gi|161506159|ref|YP_001573271.1| hypothetical protein SARI_04350 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867506|gb|ABX24129.1| hypothetical protein SARI_04350 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 167

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEARLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEQYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   +
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQIHRLAEDALEGVTGLVEYHD 162


>gi|73663588|ref|YP_302369.1| acetyltransferase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72496103|dbj|BAE19424.1| putative acetyltransferase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 176

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 72/174 (41%), Gaps = 13/174 (7%)

Query: 30  IGAFFLERLEHDSS--ICAMHADSFG---PGRFVRAAVLLREQGMHDL--SLSFLCAE-G 81
           +  +     E+D    + A+ A +F            ++ + +   +    L  +     
Sbjct: 1   MQIYLSTLTENDYDTSLKAIEA-AFADVTESNHDEQNLVAKLRNAPEYNYELEVVAKNND 59

Query: 82  KRIVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
             +VG + ++ I+     ++ T   L P+ V P Y+NKG+G+ LI    + A+ +    I
Sbjct: 60  GDVVGHIMLSEITVINGTKRYTVLALAPLSVLPEYRNKGLGKALIQAVEERAKTQDYTTI 119

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +++GD  YY++ G++      +  P  V     +   L   + +  +G V   E
Sbjct: 120 IVLGDPKYYNQFGYEPAADYDITCPFDVPSEYFMVKFLWDQLLEQPQGDVVYSE 173


>gi|315498158|ref|YP_004086962.1| gcn5-related n-acetyltransferase [Asticcacaulis excentricus CB 48]
 gi|315416170|gb|ADU12811.1| GCN5-related N-acetyltransferase [Asticcacaulis excentricus CB 48]
          Length = 177

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 76/150 (50%), Gaps = 16/150 (10%)

Query: 37  RLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC---AEGKR----IVGSVR 89
           + E +++  A+    FGPGR+ + A  LRE      SLSF+     +G      I+GSVR
Sbjct: 15  QAEREAA-DALVNRVFGPGRYAKTAERLREGNQPFPSLSFVMHRIEQGGHNETAIIGSVR 73

Query: 90  MTPISIEKITGHL------LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           + P+ +      L      LGPI V   +Q+ GIGR LI  ++ AA   G   I+LVG  
Sbjct: 74  LWPVKVRDADQALKGEMAFLGPIAVDEDHQSLGIGRALIRTAIKAAFDAGVTAILLVGTP 133

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFL 173
           +Y+   GF     + L LP PVD  R++ L
Sbjct: 134 SYFQNFGF--AKAEGLSLPGPVDSRRLMVL 161


>gi|161616278|ref|YP_001590243.1| hypothetical protein SPAB_04083 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365642|gb|ABX69410.1| hypothetical protein SPAB_04083 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 167

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L ++  + + G+V   +
Sbjct: 119 RFGFELAAHCDLHCRWPGTESAFQVHRLAEDALEGVTGLVEYHD 162


>gi|46580622|ref|YP_011430.1| acetyltransferase [Desulfovibrio vulgaris str. Hildenborough]
 gi|46450041|gb|AAS96690.1| acetyltransferase, GNAT family [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234355|gb|ADP87209.1| GCN5-related N-acetyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 168

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 67/170 (39%), Gaps = 14/170 (8%)

Query: 30  IGAFFLERLEHDSSICAMHADS---FGP---GRFVRAAVLLREQGMHDLSLSFLCAEGKR 83
           + A  + R E    I ++   +   F            V+   +    LSLS +     R
Sbjct: 1   MVASMIVREEVPEDIGSIFEVTAKAFATLDISDKREPYVIEALRHAGALSLSLVAVFDGR 60

Query: 84  IVGSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           ++G V  +P+  S        LGP+ VHP Y  +G+G  L+   +   +  G+    LVG
Sbjct: 61  VIGHVAFSPVAVSDGTEGWFGLGPLSVHPAYPRRGVGTALVREGLARLQSLGAAGCCLVG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
              YY + GF   P  ++     V P  +  +P    V    KG+V   E
Sbjct: 121 HPTYYVRFGFMNAPGLNVE---GVPPEYLFAMPFKGEVP---KGVVTFHE 164


>gi|323961072|gb|EGB56687.1| acetyltransferase [Escherichia coli H489]
          Length = 167

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P   +      L  +V   + G+V   E
Sbjct: 119 RFGFELAAHHDLRCRWPGTESAFQVHRLADDVLNGVTGLVEYHE 162


>gi|32476998|ref|NP_869992.1| acetyltransferase [Rhodopirellula baltica SH 1]
 gi|32447546|emb|CAD79145.1| conserved hypothetical protein-putative acetyltransferase
           [Rhodopirellula baltica SH 1]
          Length = 196

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/170 (19%), Positives = 63/170 (37%), Gaps = 13/170 (7%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLRE------QGMHDLSLSFLCAEGKRIVGSV 88
             R+  +    A+ A            V+++              LS +      ++G +
Sbjct: 17  RIRVATEQDRDAIPAVHMNAFGEDEGPVIVKLVDEMLDDASGKPMLSLVADTDDGLIGHL 76

Query: 89  RMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             T + IE         +L P+ V    Q +GIG +LI   +      G  ++ ++G   
Sbjct: 77  LFTSVRIEPDDSTVSARILAPLAVVQNRQRQGIGGRLIQAGLSQLADSGVDLVFVLGYPD 136

Query: 145 YYSKLGFQAVPWKSLILPAPVDP---NRVLFLPLVQNVAQNIKGIVRCRE 191
           YY + GF+    + L    P+ P   +  +   L     +N +G +RC +
Sbjct: 137 YYFRFGFKPAGIQGLQATYPIPPQNADAWMVAELTPGTIENCEGTIRCSK 186


>gi|253991480|ref|YP_003042836.1| hypothetical protein PAU_04007 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638358|emb|CAR66980.1| similar to hypothetical acetyltransferase yhbs of escherichia coli
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782930|emb|CAQ86095.1| similar to hypothetical acetyltransferase yhbs of escherichia coli
           [Photorhabdus asymbiotica]
          Length = 167

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 65/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   SF     V A ++ + +    L+L  +  +   +++G V 
Sbjct: 1   MLIRVEIPVDAVGIDRLLRKSF--DTPVEAELVQQLREDGLLTLGMVATDDEGQVIGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ I         L P+ V   Y+ +GIG +L+   +D+  + G   +V++GD  YY 
Sbjct: 59  FSPVDINGEDHQWVGLAPLAVAEEYRRQGIGERLVYEGLDSLNEFGYGAVVVLGDPRYYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF       L    P          L  +   +  G+V   
Sbjct: 119 RFGFMLASQHQLRSQWPAFEPYFQVYELADSFLADHTGLVTYS 161


>gi|162452806|ref|YP_001615173.1| putative acetyltransferase [Sorangium cellulosum 'So ce 56']
 gi|161163388|emb|CAN94693.1| Putative acetyltransferase [Sorangium cellulosum 'So ce 56']
          Length = 170

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 58/162 (35%), Gaps = 6/162 (3%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
              R E       + A           A ++ R +     ++S +      IVG V  +P
Sbjct: 2   MDVRPERAGDEAGIRAVHLAAFPSALEADLVDRLRDAGRAAVSLVAETDTGIVGHVLFSP 61

Query: 93  ISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           ++I        G  L P+ V P    +GIG  L    + A    G    V++G   YY++
Sbjct: 62  VTIAGDGVPGKGLGLAPLAVSPGLAGRGIGSALARRGIAACRDAGFAFAVVLGAPEYYAR 121

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            GF+      L      D    L + L Q   +  +G++   
Sbjct: 122 FGFEKASLYGLGNEYAAD-EAFLVIELAQGALERARGVIIYS 162


>gi|51594849|ref|YP_069040.1| acetyltransferase [Yersinia pseudotuberculosis IP 32953]
 gi|153947340|ref|YP_001402533.1| acetyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|170025928|ref|YP_001722433.1| GCN5-related N-acetyltransferase [Yersinia pseudotuberculosis
           YPIII]
 gi|186893858|ref|YP_001870970.1| GCN5-related N-acetyltransferase [Yersinia pseudotuberculosis
           PB1/+]
 gi|51588131|emb|CAH19737.1| putative acetyltransferase [Yersinia pseudotuberculosis IP 32953]
 gi|152958835|gb|ABS46296.1| acetyltransferase, GNAT family [Yersinia pseudotuberculosis IP
           31758]
 gi|169752462|gb|ACA69980.1| GCN5-related N-acetyltransferase [Yersinia pseudotuberculosis
           YPIII]
 gi|186696884|gb|ACC87513.1| GCN5-related N-acetyltransferase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 167

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  G        LRE     L+L  +  +    ++G   
Sbjct: 1   MLIRVEIPVDAPGIDALLRRAFQQGDEAELVQQLRE--DGLLTLGIVATDDEGVVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V    + +G+G KL+   +DA  + G   +V++G  AYYS
Sbjct: 59  FSPVEVGGEDRQWVALAPLAVEEGLRRQGLGEKLVYEGLDALNEFGYAAVVVLGAPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF       L    P          L ++   N KG V    
Sbjct: 119 RFGFVPAARHQLTCRWPGSEEAFQVYALAEDTLVNTKGEVVFSA 162


>gi|254525233|ref|ZP_05137288.1| acetyltransferase, gnat family [Stenotrophomonas sp. SKA14]
 gi|219722824|gb|EED41349.1| acetyltransferase, gnat family [Stenotrophomonas sp. SKA14]
          Length = 168

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 57  FVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI--SIEKITGHLLGPIVVHPLYQN 114
                ++   +   +L++S +       VG V ++P+  S        LGPI V P +Q 
Sbjct: 32  HTEHFIVDALRSRGELAVSLVAEVDGERVGHVAVSPVAISDGSSGWFGLGPISVLPGWQG 91

Query: 115 KGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP 174
           +GIG  L+  +++   ++G++  VL+G+  YY + GF+A P   LILP  V       L 
Sbjct: 92  QGIGAGLMRAALETLRQQGARGCVLLGEPGYYGRFGFRAEP--GLILPG-VPAEYFQALC 148

Query: 175 LVQNVAQNIKGIVRCR 190
           L   +AQ   G V+  
Sbjct: 149 LRPPMAQ---GEVQYS 161


>gi|322412687|gb|EFY03595.1| hypothetical protein SDD27957_10030 [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 178

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 59/167 (35%), Gaps = 9/167 (5%)

Query: 31  GAFFLERLEHDSSICAMHADSFGP--------GRFVRAAVLLREQGMHDLSLSFLCAEGK 82
                 R        A++A             G      + L         LS L  E  
Sbjct: 6   ETLMKIRKAEVQDAKAIYAVVTAAFAGVEHTDGNEADLVMALTASRSFIPELSLLAEEDG 65

Query: 83  RIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            I+G +  T   +       L P+ V P YQ +G+G  LIS     A + G    +++G 
Sbjct: 66  DIIGHIMFTKAKVGTTEVLALAPLSVLPEYQRRGVGAALISEGHHIARQLGYPYAIVLGS 125

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
             YY + G+       + +P       V+  PLV+N    I G++R 
Sbjct: 126 DTYYPRHGYVLADTVGIRIPFDAPRENVIAYPLVENA-SPIHGVMRY 171


>gi|323139282|ref|ZP_08074335.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
 gi|322395430|gb|EFX97978.1| GCN5-related N-acetyltransferase [Methylocystis sp. ATCC 49242]
          Length = 166

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/156 (26%), Positives = 65/156 (41%), Gaps = 11/156 (7%)

Query: 34  FLERLEHDSSICAMHADS------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E    I A+                  A ++ R +    L+LS +  +  +++G 
Sbjct: 1   MLIRNETIDDIPAISRVVTEALKILAQSTGTEAGIVERLRAEGALTLSLVAEDEGKVIGY 60

Query: 88  VRMTPISIEKITGHLL-GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           +  +   I    G  L GP+ V P    +GIG  L++ ++       S+   LVGD AYY
Sbjct: 61  LAGSAARIGSQDGWGLIGPLAVLPTRHRQGIGTALMAEALKRLRA-TSKGAALVGDPAYY 119

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           S+ GF+A P   +   A V P  V  LP   N  + 
Sbjct: 120 SRFGFRAFPELGV---AGVPPEVVQALPFDGNEPRG 152


>gi|167627516|ref|YP_001678016.1| acetyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|167597517|gb|ABZ87515.1| acetyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
          Length = 171

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 67/166 (40%), Gaps = 7/166 (4%)

Query: 32  AFFLERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
                R E+      ++   S          ++      H   +S +       I+G V 
Sbjct: 1   MHVKIRYENLKDQEQIYKLISEAFDTSDEERLVRLLHTDHQSLISLVAETNDGNIIGQVI 60

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           ++ ++ E+      + L P+ V P YQ+KGIG KLI M +  AEK     I ++G  +YY
Sbjct: 61  LSKMTAEEADELKIYGLAPMSVAPKYQHKGIGTKLIEMMIKEAEKNKIDAIFVLGHPSYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
            K GF+A     +     V  +  + L + +     +KG  V   E
Sbjct: 121 PKFGFKATIEYKIKCEYDVPEDVFMVLDISKK-LAKLKGQTVYYAE 165


>gi|300721549|ref|YP_003710824.1| putative acyl-CoA N-acyltransferase [Xenorhabdus nematophila ATCC
           19061]
 gi|297628041|emb|CBJ88590.1| putative acyl-CoA N-acyltransferase [Xenorhabdus nematophila ATCC
           19061]
          Length = 172

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   SF       A V+ + +    L+L  +  +    ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDRLLRQSF--ETSAEAEVVSQLREDGLLTLGIVATDDEGHVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ I         LGP+ +   Y++ G+  KL+   +D+  + G + +V +GD  YYS
Sbjct: 59  FTPVDINGEDHQWVSLGPLAIAEPYRHHGLSEKLVYEGLDSLNEFGYRAVVALGDPEYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GFQ      L  P P   +  L  PL     +  +G+V  
Sbjct: 119 RFGFQFANEYQLYCPWPDCEDYFLIYPLADVSLEGCQGLVTY 160


>gi|182417686|ref|ZP_02949005.1| acetyltransferase [Clostridium butyricum 5521]
 gi|237667472|ref|ZP_04527456.1| acetyltransferase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182378410|gb|EDT75941.1| acetyltransferase [Clostridium butyricum 5521]
 gi|237655820|gb|EEP53376.1| acetyltransferase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 204

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 71/169 (42%), Gaps = 16/169 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              RLE++     +   +       + PG         LR        L ++  +  +I+
Sbjct: 1   MEFRLENEKDFFEVENLTREAFWDVYRPGCNEHLVLHKLRNAESFIKELDYVALKDDKII 60

Query: 86  GSVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           GS+  + +               GPI +HP YQ  GIG+KLI+ ++  A++ G + +++ 
Sbjct: 61  GSIVYSRMFFGTDKKMCEDIICFGPISIHPEYQKSGIGKKLINYTMAKAKELGFKAVLIT 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPA---PVDPNRVLFLPLVQNVAQNIKGI 186
           GD  YY+K GF+      ++LP      +    +   L     +N+ GI
Sbjct: 121 GDSNYYNKFGFECASKYKILLPGMSEEDEAEFFMVKELEDGYLKNMCGI 169


>gi|241205062|ref|YP_002976158.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858952|gb|ACS56619.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 164

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 61/131 (46%), Gaps = 8/131 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E    I A+H  +    +         A ++ R +   DL +S +  +G  I+G 
Sbjct: 1   MLIRDETPDDIDAIHDLTSTAFKPMPYSDGTEAEIVRRLRAAGDLKISLVAEQGGEILGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I         LGPI V P  Q +GIG+ +I+  ++   + G+    L+G+   
Sbjct: 61  VAFSPVTINGAHDGWFGLGPISVKPERQRQGIGKAMIARGLELLNEMGASGCALIGNPEI 120

Query: 146 YSKLGFQAVPW 156
           YS++GF +   
Sbjct: 121 YSRVGFSSDGQ 131


>gi|83593705|ref|YP_427457.1| GCN5-related N-acetyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83576619|gb|ABC23170.1| GCN5-related N-acetyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 190

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 42  SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI------ 95
            SI  +   +FGPGR  + +   R+       L F       + G+VR  P+++      
Sbjct: 13  PSIETLLDRAFGPGRTAKVSYRYRQGVAPLPELCFTAFTDGALSGTVRHWPVTLSGGHGL 72

Query: 96  --------EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
                     ++  LLGPI V P  +  GIG +L+  ++  A   G  +IVLVGD AYY 
Sbjct: 73  GLGGTGLAPALSVVLLGPIAVDPALRIGGIGGRLMRHAIVEAAAGGVDMIVLVGDPAYYR 132

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNV 179
           + GF+A     +++P   +  RV  LPL    
Sbjct: 133 RFGFRAASAFGIVMP-EENAARVQALPLTARA 163


>gi|27365076|ref|NP_760604.1| acetyltransferase [Vibrio vulnificus CMCP6]
 gi|27361222|gb|AAO10131.1| Acetyltransferase [Vibrio vulnificus CMCP6]
          Length = 167

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 59/163 (36%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  + +     F       A +++  +    L+LS +   +   +VG V 
Sbjct: 1   MLIRTEAPADILVIDSLLKQVF--PTDAEANLVMTLRENGRLTLSLVACTDEGEVVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+++         L P+ V   YQ +GI   L+   + +  + G     ++GD  YY 
Sbjct: 59  FTPMTLNGEENGWQGLAPLAVKAEYQKQGIAASLVKEGLTSLLEFGYPACFVLGDPQYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF A          PV         +        +G V   
Sbjct: 119 RFGFTAASEMGFECQWPVPEGAFQAFAMAAGEFDAKQGRVEYA 161


>gi|126642685|ref|YP_001085669.1| GCN5-related N-acetyltransferase [Acinetobacter baumannii ATCC
           17978]
          Length = 150

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 57  FVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI--EKITGHLLGPIVVHPLYQN 114
                ++   +    L++S +  E   IVG V ++P++I       + LGPI V P  Q 
Sbjct: 14  HTEQFIVNSLRKHKQLTISLVAIEDDLIVGHVAISPVTITSGDTGWYGLGPISVCPKKQG 73

Query: 115 KGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP 174
            GIG  L++ ++   ++ G +  VL+GD  YYS+ GF++ P  +L     V       L 
Sbjct: 74  IGIGSLLMNAALQKLKELGGKGCVLLGDPNYYSRFGFKSYPDLNL---PDVPNEYFQALS 130

Query: 175 LVQNVAQNIKGIVRCRE 191
            + ++     G V   +
Sbjct: 131 FINHIP---SGEVTYHD 144


>gi|291544603|emb|CBL17712.1| Predicted acetyltransferase [Ruminococcus sp. 18P13]
          Length = 218

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 60/173 (34%), Gaps = 21/173 (12%)

Query: 29  KIGAFFLERLEHDSSICAMHADSFGPGRFV----------RAAVL--LREQGMHDLSLSF 76
                ++ R E  +    +   +    R                +  +R+       L  
Sbjct: 1   MKERDYIIRQETKADHQTVETLT----REAFWNQSVPGCNEHYFVHTMRQHPDFVPELDL 56

Query: 77  LCAEGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
           +     +I+ SV  T   +E   G        GP+ VHP  Q KG G+ L+  S   A+ 
Sbjct: 57  VLEREGKIIASVLYTHSWLEDQAGNRHRILTFGPLSVHPACQRKGYGKALLEESFRRAKA 116

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G  VIV+ G+   Y   GF++    ++ L   + P  +L   L        K
Sbjct: 117 LGYDVIVIFGNPDNYVSRGFRSCKRYNVCLEGDIFPTALLVKELTPGTLDGRK 169


>gi|271969327|ref|YP_003343523.1| acetyltransferase-like protein [Streptosporangium roseum DSM 43021]
 gi|270512502|gb|ACZ90780.1| acetyltransferase-like protein [Streptosporangium roseum DSM 43021]
          Length = 464

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 66/160 (41%), Gaps = 6/160 (3%)

Query: 35  LERLEHDSSICAMHAD---SFGPGRFVRAAVLLR-EQGMHDLSLSFLCAE-GKRIVGSVR 89
           + R E  + +  +      +F           LR ++     SLS++       I G   
Sbjct: 300 ITRPETAADLAQIREVNLAAFPTSHEADLVEALRADRQAWIPSLSWVAEAPDGSIAGFAL 359

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   ++      LGP  V P +Q +G G   I  ++DAA ++G  +++++G   YY + 
Sbjct: 360 LTRCHVDGSPALTLGPCAVRPEHQQRGAGSAAIRAALDAAREQGENLVLVLGHADYYPRF 419

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF      S+  P  V+   ++ L L   V     G +R 
Sbjct: 420 GFTPASGHSIRPPFDVEDKYMMALVLDPAVPVPP-GTIRY 458


>gi|212709926|ref|ZP_03318054.1| hypothetical protein PROVALCAL_00976 [Providencia alcalifaciens DSM
           30120]
 gi|212687438|gb|EEB46966.1| hypothetical protein PROVALCAL_00976 [Providencia alcalifaciens DSM
           30120]
          Length = 167

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E       I  +  ++F       A ++   +    L+L  +   +   ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDTLLRETF--PTEGEADLVQHLREDGLLTLGVVATNDDGEVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ +         L P+ V   YQ++GI  KL+   +D+  + G   +V++GD  YY 
Sbjct: 59  FTPVDVNGEDVQWVGLAPLAVKKEYQSQGIAEKLVYEGLDSLNEFGYGAVVVLGDEGYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L    P      L   L        KG V   
Sbjct: 119 RFGFEPASNHDLRCQWPSLQKHFLVYGLENGAIDQHKGEVTYS 161


>gi|297158348|gb|ADI08060.1| acetyltransferase [Streptomyces bingchenggensis BCW-1]
          Length = 171

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 60/162 (37%), Gaps = 7/162 (4%)

Query: 35  LERLEHDSSICAMHADSFGPGR-FVRAAVLLREQGMH--DLSLSFLCA-EGKRIVGSVRM 90
           + R E ++ I A+             A ++   +        LS +        VG   +
Sbjct: 8   ITRAETEADIQAVRGIVLAAFDTPYEADLVDALRADVSWIEGLSVVSTGANGTPVGHALL 67

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T   I       L P+ V P +Q  G G  +I  ++ AA+  G   + ++G  AYY + G
Sbjct: 68  TRCHIGDTPALCLAPVSVLPEHQKTGAGSAVIRAALSAAKGLGEYYVTVLGHPAYYPRFG 127

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQ-NVAQNIKGIVRCRE 191
           F       + +   V    ++ L L + +   N  G VR   
Sbjct: 128 FGRASAHGIGVTLDVPDEAMMALTLDKTHPLPN--GTVRYAA 167


>gi|319934875|ref|ZP_08009320.1| hypothetical protein HMPREF9488_00151 [Coprobacillus sp. 29_1]
 gi|319810252|gb|EFW06614.1| hypothetical protein HMPREF9488_00151 [Coprobacillus sp. 29_1]
          Length = 169

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 67/166 (40%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP--------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R    S    ++              G        LR++  +  SL  +  E   +V
Sbjct: 1   MKIREAKTSDYNEIYNLVKTAFLTAQVSDGSEQDFVYELRKREGYIPSLELVMEEQNELV 60

Query: 86  GSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G V +T   I  I G     L+ P+ V   Y+N+ +G +L+  ++  A + G   + LVG
Sbjct: 61  GHVMLTKQVIHGIDGISHGLLVAPLCVKKEYRNQKVGSRLMEEAMKRALQLGYTSLFLVG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           +  YY + GF++     +   + +    V+ + LV+NV     G V
Sbjct: 121 NPEYYHRFGFRSTRSYGIENRSEIPDEFVMAVELVENVLTKCGGYV 166


>gi|261345140|ref|ZP_05972784.1| acetyltransferase, GNAT family [Providencia rustigianii DSM 4541]
 gi|282566830|gb|EFB72365.1| acetyltransferase, GNAT family [Providencia rustigianii DSM 4541]
          Length = 167

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 64/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E       I  +  ++F       A ++   +    L+L  +   +   ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDRLLRETF--PTEGEADLVQHLREDGLLTLGVVATNDDGEVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ +         L P+ V   YQ++GI  KL+   +D+  + G   +V++GD  YYS
Sbjct: 59  FTPVDVNGEDVQWVGLAPLAVKKEYQSQGIAEKLVYEGLDSLNEFGYGAVVVLGDEGYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      L    P      L   L        KG V   
Sbjct: 119 RFGFEPATNHGLSCQWPTLQKHFLVCGLENGAINEHKGEVAYS 161


>gi|251791024|ref|YP_003005745.1| GCN5-related N-acetyltransferase [Dickeya zeae Ech1591]
 gi|247539645|gb|ACT08266.1| GCN5-related N-acetyltransferase [Dickeya zeae Ech1591]
          Length = 167

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 65/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F           LRE     L+L  +  +    ++    
Sbjct: 1   MLIRVEIPVDAPGIDALLRRAFPTSAEAELVHQLRE--DGQLTLGIVATDDEGGVIAYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ +GIG +L+   +DA  + G   +V++G+  YY+
Sbjct: 59  FSPVTLGGEDLQWVALAPMAVDESHRRQGIGEQLVYAGLDALNEFGYTAVVVLGNRHYYA 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF     + L        +     PL  N  Q   G+V   E
Sbjct: 119 RFGFVPAAEQQLYCRWLGCESDFQVYPLADNHFQGASGLVEYAE 162


>gi|257060551|ref|YP_003138439.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8802]
 gi|256590717|gb|ACV01604.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8802]
          Length = 176

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 10/167 (5%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
                 R E  S    I  +H  +F  G    A ++      +   LS +     + +  
Sbjct: 4   SYNLSFRAEQPSDRLGIRQIHQAAF--GSNTEANIVGDLIERNCPRLSLVAVLDNQAIAH 61

Query: 88  VRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  TP  IE       G  L P+ V P +Q +GIG  L  + ++  + +G   ++++GD 
Sbjct: 62  ILFTPAIIETRDRLIEGMGLAPLAVLPEFQRQGIGSHLTKLGLETLKNRGEAFVIVLGDP 121

Query: 144 AYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
            +YS+ GF A     +I     +           Q +  +I G+ + 
Sbjct: 122 DFYSRFGFIAASSYGIISEFDNIPDEAFRIKIFNQELLNSILGVAKY 168


>gi|291543575|emb|CBL16684.1| Predicted acetyltransferase [Ruminococcus sp. 18P13]
          Length = 208

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 62/173 (35%), Gaps = 17/173 (9%)

Query: 29  KIGAFFLERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLC 78
                    LE +    A+   +       + PG    +V               L F+ 
Sbjct: 1   MSQKNITICLETEGDYKAVENLTREAFWNVYRPGCMEHYVLHCYRN--DPAFVPELDFVM 58

Query: 79  AEGKRIVGSVRM--TPISIEK---ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133
                ++G +    + I  +    +     GPI + P Y+ +G G++L+  S++ A + G
Sbjct: 59  ELDGELIGQIIYVRSEIDCDDGRKVPIMTFGPIGIAPAYKRQGFGKQLLDYSMEKAREMG 118

Query: 134 SQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI 186
           +  + + G+I +Y K GF     K +      + +  L   L     + I G 
Sbjct: 119 AGALAITGNILFYGKSGFVPAKTKGVRYADDPEADYFLIKELTPGFLEGISGT 171


>gi|225574147|ref|ZP_03782757.1| hypothetical protein RUMHYD_02211 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038643|gb|EEG48889.1| hypothetical protein RUMHYD_02211 [Blautia hydrogenotrophica DSM
           10507]
          Length = 211

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 62/165 (37%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
           F  R E  +    +   +       + PG  V   ++  +RE       L F+      +
Sbjct: 2   FQIRNEKRTDYKTVEEITRKAFYNLYVPG-CVEHYLVHIMREHEDFLPELDFVAELDGEV 60

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T         E       GP+ + P YQ KG G+ LI  S   A   G +VIV+
Sbjct: 61  IGNIMYTKAKLRDEAGETKEILTFGPVSILPEYQRKGYGKALIEYSFGKAAALGYEVIVI 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G+   Y   GF++    ++ L     P  ++   L +      K
Sbjct: 121 FGNPGNYVSRGFRSCKKYNVCLEGGSYPAAMMVKELKEGALDGRK 165


>gi|268592806|ref|ZP_06127027.1| acetyltransferase, GNAT family [Providencia rettgeri DSM 1131]
 gi|291311590|gb|EFE52043.1| acetyltransferase, GNAT family [Providencia rettgeri DSM 1131]
          Length = 167

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 64/163 (39%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R+E       I  +  ++F       A ++   +    L+L  +   +   ++G V 
Sbjct: 1   MLIRVEIPVDAMGIDKLLRETF--PTEAEANLVQHLREDGLLTLGVVATNDDGEVIGYVG 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+ +         L P+ V   +Q +GI  KL+   +D+  + G   +V++GD  YYS
Sbjct: 59  FTPVDVNDEDVQWVGLAPLAVSKAHQGQGIAEKLVYEGLDSLNEFGYGAVVVLGDERYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF+      +    P      L   L        +G+V   
Sbjct: 119 RFGFEPASSHGVSCQWPEQQAHFLVCGLENGEIGEHQGLVTYS 161


>gi|312112923|ref|YP_004010519.1| GCN5-related N-acetyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218052|gb|ADP69420.1| GCN5-related N-acetyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 170

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 63/156 (40%), Gaps = 11/156 (7%)

Query: 35  LERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
             R E       + + +          +   AA++   +    L++S +  +   IVG +
Sbjct: 5   TIRDEATGDEGTIRSITTAAFVTVPYSQGTEAAIIDALRRDEALTVSLVALDEGEIVGHI 64

Query: 89  RMTPISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
             +P +I+        +GP+ V P  QN+GIG  L+   ++     G++  VLVG   YY
Sbjct: 65  AFSPATIDGEQRGWFGVGPLSVRPDRQNRGIGGSLVRAGLERLRALGAKGCVLVGKPNYY 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            + GF+A    +L     V P     L     + + 
Sbjct: 125 ERFGFKADARLTL---DGVPPQYFQALSFGGELPRG 157


>gi|317046754|ref|YP_004114402.1| GCN5-like N-acetyltransferase [Pantoea sp. At-9b]
 gi|316948371|gb|ADU67846.1| GCN5-related N-acetyltransferase [Pantoea sp. At-9b]
          Length = 168

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 65/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI ++    F           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGVDAASIDSLLKRCFASAAEAELVQQLRE--DGLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V    + +GIG++L+   +DA  + G   +V++GD AYY+
Sbjct: 59  FSPVTLQGEDRGWVALAPLAVDETVRKQGIGKQLVYEGLDALNEFGYSAVVVLGDPAYYN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             GF+      L               L  +     +G +   E
Sbjct: 119 AFGFEPAARHGLHCRWTGSEAAFQVYKLADDAFVGAEGQIDFAE 162


>gi|150391105|ref|YP_001321154.1| GCN5-related N-acetyltransferase [Alkaliphilus metalliredigens
           QYMF]
 gi|149950967|gb|ABR49495.1| GCN5-related N-acetyltransferase [Alkaliphilus metalliredigens
           QYMF]
          Length = 172

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADS---FG---PGRFVRAAVL--LREQGMHDLSLSFLCA-EGKRI 84
              R E  +    ++      F             L  LR++      LS +   E  ++
Sbjct: 1   MKVRQEQPADYTEVYKLVKKSFATSPHADGTEQDYLNELRKKDTFIPELSLVAENEDGKL 60

Query: 85  VGSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           VG + +   +I      IT  +L PI V+P Y N+GI R ++  +   A+K G + + L 
Sbjct: 61  VGQIVLYKTTITSFEKKITELVLSPICVYPDYFNRGIARSMMEKAFQIAKKMGYKAVFLC 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAP--VDPNRVLFLPLVQNVAQNIKGIV 187
           GD  +Y K+GF+     ++        +    +   L      NI GIV
Sbjct: 121 GDPTFYQKVGFRPSYEYNVFHIDDKSKNAEYCMVRELFDGALNNISGIV 169


>gi|292486845|ref|YP_003529715.1| putative acetyltransferase [Erwinia amylovora CFBP1430]
 gi|292900757|ref|YP_003540126.1| acetyltransferase [Erwinia amylovora ATCC 49946]
 gi|291200605|emb|CBJ47737.1| putative acetyltransferase [Erwinia amylovora ATCC 49946]
 gi|291552262|emb|CBA19299.1| putative acetyltransferase [Erwinia amylovora CFBP1430]
 gi|312170913|emb|CBX79172.1| putative acetyltransferase [Erwinia amylovora ATCC BAA-2158]
          Length = 167

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 64/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI A+   SF           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGIDAASIDALLRRSFPTSAEAELVKQLRE--DGLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+VV    + +GIG +LI   +D   + G   +V++GD AYY 
Sbjct: 59  FSPVTLNGEDQQWVGLAPLVVDESVRKQGIGSRLIYEGLDTLNEFGYAAVVVLGDPAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L               L  +  + I G +    
Sbjct: 119 RCGFKTAADCQLRCHLEGTQQVFQVYKLADDAFKGIAGNIEYSA 162


>gi|329295916|ref|ZP_08253252.1| GCN5-like N-acetyltransferase [Plautia stali symbiont]
          Length = 168

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 65/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     + I ++   SF           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGVDAAGIDSLLKRSFATAAEAELVQQLRE--DGLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V    +++GI ++L+   +D+  +     +V++GD  +Y+
Sbjct: 59  FSPVTLQGEDRNWVALAPLAVDASVRSQGIAKQLVYEGLDSLNEFSYSAVVVLGDPQFYN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            LGF+      L    P          L  +     +G++    
Sbjct: 119 PLGFEPAACHGLHCRWPGSEAAFQVYKLADDAFDGAEGLIAFSA 162


>gi|37680872|ref|NP_935481.1| acetyltransferase [Vibrio vulnificus YJ016]
 gi|320155459|ref|YP_004187838.1| acetyltransferase [Vibrio vulnificus MO6-24/O]
 gi|37199621|dbj|BAC95452.1| predicted acetyltransferase [Vibrio vulnificus YJ016]
 gi|319930771|gb|ADV85635.1| acetyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 167

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 58/163 (35%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I  +       F       A +++  +    L+LS +   +   +VG V 
Sbjct: 1   MLIRTEAPADILVIDGLLKQVF--PTDAEANLVMTLRENGRLTLSLVACTDEGEVVGHVM 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            TP+++         L P+ V   YQ +GI   L+   + +  + G     ++GD  YY 
Sbjct: 59  FTPMTLNGEENGWQGLAPLAVKAEYQKQGIAASLVKEGLTSLLEFGYPACFVLGDPQYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF A          PV         +        +G V   
Sbjct: 119 RFGFTAASEMGFECQWPVPEGAFQAFAMAAGEFDAKQGRVEYA 161


>gi|218248118|ref|YP_002373489.1| GCN5-like N-acetyltransferase [Cyanothece sp. PCC 8801]
 gi|218168596|gb|ACK67333.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8801]
          Length = 176

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 66/167 (39%), Gaps = 10/167 (5%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
                 R E  S    I  +H  +F  G    A ++      +   LS +     + +  
Sbjct: 4   SYNLSFRAEQPSDRLGIRQIHQAAF--GSNTEANIVGDLIERNCPRLSLVAVLDNQAIAH 61

Query: 88  VRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  TP  IE       G  L P+ V P +Q +GIG  L ++ ++  + +G   ++++GD 
Sbjct: 62  ILFTPAIIETRDRLIEGMGLAPLAVLPEFQRQGIGSHLTTLGLETLKNRGEAFVIVLGDP 121

Query: 144 AYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
            +YS+ GF A     +I     +           Q +  +I G+ + 
Sbjct: 122 DFYSRFGFIAASSYGIISEFDNIPDEAFRIRIFNQELLNSILGVAKY 168


>gi|255505723|ref|ZP_05347797.3| acetyltransferase [Bryantella formatexigens DSM 14469]
 gi|255266315|gb|EET59520.1| acetyltransferase [Bryantella formatexigens DSM 14469]
          Length = 241

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 71/191 (37%), Gaps = 14/191 (7%)

Query: 10  KFLSIAFFEFICWRRSRWQKIGAFFL-ERLEHDSSICAMHADS-------FGPG-RFVRA 60
           +     F E I  + SR Q  G+  L  R E  S                + PG      
Sbjct: 2   REPKQIFAESITVKNSRKQWKGSSMLEIRTEKISEQRETENVVREAFWNVYTPGCVEPYL 61

Query: 61  AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNK 115
           A  +R        L  + AE  +I+G V      I    G       LGPI V P YQ +
Sbjct: 62  AHQMRGCAGFLPELDLVAAEDGKIIGQVMNVKSCISGDDGECFEVVTLGPIAVLPQYQKR 121

Query: 116 GIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           GIG  LI+     A + G + I+L G+  YY+K GF+      +     +  + +    L
Sbjct: 122 GIGAGLIAEVKKLAGRMGCRAIILCGNPEYYAKQGFEPAERYGIRNAENMFADALQVYGL 181

Query: 176 VQNVAQNIKGI 186
            +   + I G 
Sbjct: 182 YEGALEGIAGK 192


>gi|254444164|ref|ZP_05057640.1| acetyltransferase, GNAT family [Verrucomicrobiae bacterium DG1235]
 gi|198258472|gb|EDY82780.1| acetyltransferase, GNAT family [Verrucomicrobiae bacterium DG1235]
          Length = 181

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 13/172 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGR-FVRAAVLLREQGMH--DLSLSFLCAEGKRIVGS 87
              R   DS +  +      SFGP    +   ++ +          +S    E +R+ G 
Sbjct: 1   MEIRASSDSDLTRISDLETTSFGPSEGPIITVLVNKLLDDPTAQPRISLAACEIERLTGH 60

Query: 88  VRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  T   IE         +L P+ V P  Q  GIG++L++  +    ++ + ++ ++G  
Sbjct: 61  ILFTNAKIEGAPQEISASILAPLAVLPERQRAGIGKRLVTQGLKRLAEEHTDLVFVLGHP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVD---PNRVLFLPLVQNVAQNIKGIVRCREV 192
            YY + GF     + L  P P+     +  + L L   +A  I+G V C  V
Sbjct: 121 GYYPRFGFSPAGSQGLEAPYPIPRKNADAWMVLFLNSKLAGKIQGRVLCSNV 172


>gi|258513955|ref|YP_003190177.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777660|gb|ACV61554.1| GCN5-related N-acetyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 214

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 63/164 (38%), Gaps = 13/164 (7%)

Query: 34  FLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E ++    +   +       + PG        ++R        L  +     +I+
Sbjct: 5   IKIRNEEETDYEKVEEITRKAFWNLYIPGCIEHYLVHVMRPHKDFLRELDLVIEVDNQII 64

Query: 86  GSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G++  T       S E+      GP+ + P YQ KG G+KL+  S + A   G  VIV+ 
Sbjct: 65  GNIMYTKTKLIDESGEEKDTLTFGPVCILPEYQRKGYGKKLMEYSFEQAGALGYDVIVIF 124

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           G+   Y   GF++    ++ L     P  ++   L  +V    K
Sbjct: 125 GNPNNYVSCGFKSCKKYNVCLENGTYPAAMMVKELKPDVLDGRK 168


>gi|254994431|ref|ZP_05276621.1| hypothetical protein LmonocytoFSL_16722 [Listeria monocytogenes FSL
           J2-064]
          Length = 134

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 70  HDLSLSFLCA-EGKRIVGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISM 124
           +   LS +   E   IVG +  + IS+E          L P+ V P YQ   +G +L+  
Sbjct: 2   YQPGLSLVAEAEDGLIVGYIMFSEISLEAAGRSRFILALAPLAVLPAYQGTRVGSRLMEE 61

Query: 125 SVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            +  + +K    I ++G   YY + GF      ++  P  V     + L L     +N+ 
Sbjct: 62  GIRLSREKAYPAIAVLGHADYYPRFGFIPSEQFAIPAPFDVPAEYFMLLELYDGSLENLA 121

Query: 185 GIVRC 189
           G +  
Sbjct: 122 GTIHY 126


>gi|239625953|ref|ZP_04668984.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520183|gb|EEQ60049.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 211

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 59/165 (35%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRA--AVLLREQGMHDLSLSFLCAEGKRI 84
              R E  +    +   +       + PG         ++R        L F+  +  +I
Sbjct: 2   IKIRNEEAADYRTVEELTRKAFYNIYIPG-CAEHYLVHVMRSHEDFLPELDFVIEDNHQI 60

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           VG++  T         E+      GP+ + P YQ  G G+ L+  S   A + G  VIV+
Sbjct: 61  VGNIMYTKSWLTDEAGEEKEILTFGPVSILPEYQRMGYGKSLMEHSFKKAVELGYDVIVI 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G+   Y   GF++    ++       P  ++   L  N     K
Sbjct: 121 FGNPGNYVGRGFKSCKKYNICAENGTYPAAMMAKELKPNALDGRK 165


>gi|270265079|ref|ZP_06193342.1| hypothetical protein SOD_k01170 [Serratia odorifera 4Rx13]
 gi|270041013|gb|EFA14114.1| hypothetical protein SOD_k01170 [Serratia odorifera 4Rx13]
          Length = 137

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 3/131 (2%)

Query: 64  LREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRK 120
            + +    L+L  +  +    +VG    +P+ +         L P+ V    + +G+G K
Sbjct: 2   QQLREDGLLTLGIVATDDEGGVVGYAAFSPVDVAGEDRQWVGLAPLAVDESLRRQGLGEK 61

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           LI   +D+  +     +V++GD AYY + GF+      L    P         PL ++  
Sbjct: 62  LIYEGLDSLNEFSYAAVVVLGDPAYYGRFGFKPAAAYGLHCRWPGAEAAFQVYPLAEDAL 121

Query: 181 QNIKGIVRCRE 191
            ++ G V   E
Sbjct: 122 NDVSGAVEYSE 132


>gi|302383758|ref|YP_003819581.1| GCN5-related N-acetyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194386|gb|ADL01958.1| GCN5-related N-acetyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 163

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/149 (30%), Positives = 75/149 (50%), Gaps = 4/149 (2%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
           E     + +  +  D+FGPGRF + A  +RE         ++  E  R+VGSVR+  I+I
Sbjct: 16  ETPADAAEVDRLVLDAFGPGRFAKTAERIRETARLAAG--YVAREDGRLVGSVRLWSITI 73

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
             +    LGPI V    +++G+G  L+   +  A+  G   ++LVGD+ Y+S+ GF    
Sbjct: 74  GGVDAVFLGPIAVAAEARDRGLGADLVGACLGQAQALGVAGVLLVGDLPYFSRFGFAVAS 133

Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
              + +P P D  RVL+L +     Q + 
Sbjct: 134 --DVRMPGPADRRRVLWLGITSAAPQGLA 160


>gi|126726379|ref|ZP_01742220.1| GCN5-related N-acetyltransferase [Rhodobacterales bacterium
           HTCC2150]
 gi|126704242|gb|EBA03334.1| GCN5-related N-acetyltransferase [Rhodobacterales bacterium
           HTCC2150]
          Length = 176

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 61/158 (38%), Gaps = 11/158 (6%)

Query: 34  FLERLEHDSSICAMHADS---FGPGRF---VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              RLE       +   +   F P  +       V+   +   DL+LS +  +  +I G 
Sbjct: 13  IEIRLEKTGDEKEIFDLTAVAFEPMAYSDGTEPQVVNDLRADGDLTLSIVAVKNGKIFGH 72

Query: 88  VRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  + I  S   I    LGPI V P  Q  GIG  +I+  +   ++KG+    L+GD  Y
Sbjct: 73  VAFSQIAISDNDINWFGLGPISVLPELQRTGIGSAIINKGLSLLKEKGAAGCALIGDPNY 132

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
           Y + GF  +    L     +    V  L       + +
Sbjct: 133 YGRFGF--IGDGRLKYQQ-LPDALVQGLSFNDFYPEGV 167


>gi|268607894|ref|ZP_06141625.1| GCN5-related N-acetyltransferase [Ruminococcus flavefaciens FD-1]
          Length = 218

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 64/170 (37%), Gaps = 15/170 (8%)

Query: 29  KIGAFFLERLEHDSSICAMHAD---SF----GPGRFVRA--AVLLREQGMHDLSLSFLCA 79
              + ++ R E  +    +      +F     PG         ++R+       L+ +  
Sbjct: 1   MNKSDYIIRKETKNDYREVENLNREAFWNLSVPG-CSEHYFVHVMRDHKDFIPELAHVLE 59

Query: 80  EGKRIVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
            G +IVG V             + T   +GP+ VHP YQ +GIG+ L+  +     K G 
Sbjct: 60  IGGKIVGCVMYCKGLLKDEEGNEKTVLTMGPLCVHPDYQRQGIGKALLEYTFALGRKMGY 119

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
             ++  G+   Y   G+++    ++ L   V P  +L   L +      K
Sbjct: 120 DTVINFGNPDNYVARGYKSCKKYNVCLEGEVFPAALLVKELTEGALDGRK 169


>gi|218508125|ref|ZP_03506003.1| putative acetyltransferase protein [Rhizobium etli Brasil 5]
          Length = 144

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 7/126 (5%)

Query: 72  LSLSFLCAE-GKRIVGSVRMTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISM 124
             L+ +  +    ++GSVR+  I          I   LLGP+ V   +  KGIG  L+  
Sbjct: 6   RGLALVARDRDGHVIGSVRLWNIEAGVNDEGTPINALLLGPLAVDSRHGGKGIGAALMRA 65

Query: 125 SVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           ++  A+ +G   ++LVGD AYY + GF A   + L++P P + +R L L L +       
Sbjct: 66  AILEAKNRGHGAVLLVGDAAYYERFGFFAEKARHLVMPGPFERSRFLALELTEGWLDGAA 125

Query: 185 GIVRCR 190
           G++   
Sbjct: 126 GMIVPS 131


>gi|255023496|ref|ZP_05295482.1| acetyltransferase [Listeria monocytogenes FSL J1-208]
          Length = 184

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 7/140 (5%)

Query: 59  RAAVL--LREQGMHDLSLSFLCAEGKRIVGSVRMTPISI-----EKITGHLLGPIVVHPL 111
              ++  LR+       L+F+      I+GS+  +   I      +      GP+ + P 
Sbjct: 2   EHFIVHNLRKHEDFIEELAFVIMIDDEIIGSIHYSKSKIIAKDGNEYEAITFGPVSILPK 61

Query: 112 YQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVL 171
              +G GR LI  S+ AA   G + I++ G   +Y   GF       L LP       ++
Sbjct: 62  LHRQGFGRLLIEHSIQAARNLGYKSIIIGGYPYHYETYGFVGAKKYGLSLPDGNFYTGIM 121

Query: 172 FLPLVQNVAQNIKGIVRCRE 191
            LPL +     I G+V   E
Sbjct: 122 ALPLEEGALDGISGMVYFSE 141


>gi|330997923|ref|ZP_08321757.1| acetyltransferase, GNAT family [Paraprevotella xylaniphila YIT
           11841]
 gi|329569527|gb|EGG51297.1| acetyltransferase, GNAT family [Paraprevotella xylaniphila YIT
           11841]
          Length = 178

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHD--LSLSFLCAEG 81
           +   +  R E +     +        R           ++ R +        LS +    
Sbjct: 1   MKTDYEIRQETEKDYPQVFKLVEEAFRDMEESDHREQFLVGRLRHSPAFVPELSLVADGD 60

Query: 82  KRIVGSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
             +VG   MT +SI           L P+ V P  Q+ GIG  LI      A + G +  
Sbjct: 61  GGVVGYGLMTRVSIRSGKLEAESLALAPVAVRPDRQSMGIGSALIRELHARAARLGYKSA 120

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           V++G   +Y + G++      +  P  V     +   LV    +  +G+V   E
Sbjct: 121 VVLGHEGFYPRFGYRKASDYGIAFPFDVPAECCMAAELVAGGLRGTQGMVCYPE 174


>gi|209917460|ref|YP_002291544.1| hypothetical protein ECSE_0269 [Escherichia coli SE11]
 gi|209910719|dbj|BAG75793.1| hypothetical phage protein [Escherichia coli SE11]
          Length = 183

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 64/168 (38%), Gaps = 9/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F +      S I  +   +FG  +       L E      +LS L     + VG +  T
Sbjct: 7   TFHITDESDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARHEGKAVGHILFT 66

Query: 92  PISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             + +        H+L P+ V P YQ  G+G  LI   ++   + G Q + ++G   YY 
Sbjct: 67  LATFKGEMDSPLMHILAPLAVIPEYQGMGVGGLLIRTGIEHLRQMGCQTVFVLGHATYYP 126

Query: 148 KLGFQA-VPWKSLILPAPVDPNR---VLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     K    P P+        +   L      N+ G ++C +
Sbjct: 127 RHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTAQPM-NVTGHIQCAQ 173


>gi|304396361|ref|ZP_07378242.1| GCN5-related N-acetyltransferase [Pantoea sp. aB]
 gi|304355870|gb|EFM20236.1| GCN5-related N-acetyltransferase [Pantoea sp. aB]
          Length = 168

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     + I A+    F       A +    +    L+L  +  +   +++G   
Sbjct: 1   MLIRSEIGVDAAGIDALLKRCFS--TPAEAELTQALREDGLLTLGVVATDEEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+S++        L P+ V    + +G+  KLI   +D   + G   +V++GD A ++
Sbjct: 59  FSPVSVQGEDRGWVALAPLAVDETLRGQGLASKLIYEGLDTLNEFGYSAVVVLGDPALFN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L    P          L +N     +G +   E
Sbjct: 119 RFGFEPAARYGLRSRWPGTEAAFQVYRLAENAYDGAEGQIDYAE 162


>gi|261416496|ref|YP_003250179.1| GCN5-related N-acetyltransferase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372952|gb|ACX75697.1| GCN5-related N-acetyltransferase [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 207

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 61/167 (36%), Gaps = 19/167 (11%)

Query: 36  ERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            R E       +   +       + PG    FV               LS +     +I+
Sbjct: 6   IRTEQPRDFKIVENLTREAFWNVYRPGCVEHFVLHHYRN--DPSFIPELSLVMEVDGQII 63

Query: 86  GSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G V      I+   G        GPI +HP Y+ +G G+ L+  S++ A K  +  +++V
Sbjct: 64  GHVMYAWSKIDADDGRKIRMMTFGPISIHPNYKRQGYGKALLDYSMELARKMSAGCLLIV 123

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPN--RVLFLPLVQNVAQNIKG 185
           G+I +Y K GF     K +      + +    L   L +     + G
Sbjct: 124 GNIGFYGKSGFVPAYVKGIRYADDPNSDAPYFLCKELDEGFLDGVMG 170


>gi|285018744|ref|YP_003376455.1| N-acetyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283473962|emb|CBA16463.1| putative n-acetyltransferase protein [Xanthomonas albilineans]
          Length = 173

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 11/156 (7%)

Query: 33  FFLERLEHDSSICAMHADSF------GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
             L R E  +   A+ A +          R     V+ R +    L++S +      IVG
Sbjct: 6   ELLLRAERAADTAAIEALTLVAFFRVAHSRHDEQRVIERLRADAALTVSLVIEHEGYIVG 65

Query: 87  SVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
            +  +P++        + LGP+ V P +Q +G+G +L+  ++   +  G+   V++G+ A
Sbjct: 66  HIAASPVTLSDSSRGWYALGPLSVGPGHQRQGLGTRLVREALAQLQALGAAGCVVLGEPA 125

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           +Y++ GF+  P   LILP  V       L     + 
Sbjct: 126 FYARFGFRQEP--GLILPG-VPVEGFQALCFGDRLL 158


>gi|302387054|ref|YP_003822876.1| GCN5-related N-acetyltransferase [Clostridium saccharolyticum WM1]
 gi|302197682|gb|ADL05253.1| GCN5-related N-acetyltransferase [Clostridium saccharolyticum WM1]
          Length = 216

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 61/162 (37%), Gaps = 15/162 (9%)

Query: 34  FLERLEHDSSICAMHADSFG-------PGRFVRA--AVLLREQGMHDLSLSFLCAEGKRI 84
           ++ R E    +  +   +         PG         ++R        L F+  +  RI
Sbjct: 7   YIIRNEQTKDLWKVEDLTRKAFWNLNVPG-CSEHYMVHVMRNHPDFIPELDFVLEKDNRI 65

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T          +      GP+ VHP +Q KG G+ L+  S D A++    VIV+
Sbjct: 66  IGNIMYTKAKLVDEEKREKQILTFGPLSVHPDFQRKGYGKALLEYSFDKAKEMSYDVIVI 125

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
            G+   Y   GF++    ++       P  +L   L +    
Sbjct: 126 FGNPENYVSRGFKSCKKFNICTDQDFYPAAMLVKELTEGCLD 167


>gi|294675211|ref|YP_003575827.1| GNAT family acetyltransferase [Prevotella ruminicola 23]
 gi|294472985|gb|ADE82374.1| acetyltransferase, GNAT family [Prevotella ruminicola 23]
          Length = 296

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 61/167 (36%), Gaps = 20/167 (11%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVLL---REQGMHDLSLSFLCAEGKR 83
            + RLE       +   +       + PG       +L   R        L F+     +
Sbjct: 1   MIIRLEDTKDYREVENLTREAFWNVYRPG-CTEH-YVLNHYRTNPDFISELDFVMEVDGK 58

Query: 84  IVGSVRMTP---ISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+G V  +    +  +         GPI +HP Y+ KG G+KL+  ++D A   G   I 
Sbjct: 59  IIGHVMFSKAELVLDDGCKKASWTFGPISIHPAYKRKGYGQKLLQYALDKARDMGIGFIC 118

Query: 139 LVGDIAYYSKLGFQAVPWKSLIL---PAPVDPNRVLFLPLVQNVAQN 182
           + G+I +Y   GF      ++     P   +    L   L+    +N
Sbjct: 119 MEGNIEFYKHAGFDLASKLNIHYHAEPKDAEVPYFLAQELIPGWLKN 165


>gi|300718566|ref|YP_003743369.1| acetyltransferase [Erwinia billingiae Eb661]
 gi|299064402|emb|CAX61522.1| Putative acetyltransferase [Erwinia billingiae Eb661]
          Length = 167

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 64/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI ++    F       A ++ + +    L+L  +  +   +++G   
Sbjct: 1   MLIRSEIGMDAASIDSLLRRCF--ETSAEAELVQQLREDGLLTLGVVATDEEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V   ++ + +G+KLI   +D   + G   +V++GD AYY 
Sbjct: 59  FSPVTLNGEDNQWVGLAPLAVDADFRGQELGKKLIYEGLDTLNEFGYAAVVVLGDPAYYE 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L               L  N     +G +    
Sbjct: 119 RYGFEPAARHQLRCRTLGAEAAFQVYKLADNAFTGAEGHIDYSA 162


>gi|161524534|ref|YP_001579546.1| GCN5-related N-acetyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189350710|ref|YP_001946338.1| putative acetyltransferase [Burkholderia multivorans ATCC 17616]
 gi|160341963|gb|ABX15049.1| GCN5-related N-acetyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189334732|dbj|BAG43802.1| putative acetyltransferase [Burkholderia multivorans ATCC 17616]
          Length = 185

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query: 34  FLERLEHDSSICAMHAD---SFG----PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
              R E  S + A+      +F      G+F R  ++   +    L++S +     R++G
Sbjct: 12  VTLRDERASDVDAIADVIVSAFAGEPEHGQFER-RIVDALRADRALAVSLVAERDGRVIG 70

Query: 87  SVRMTPISIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
            V  +P+SI          + L P+ V    + + +G  L+  ++DA  ++G+Q  V++G
Sbjct: 71  HVACSPVSIGGAAAGDSRWYGLAPLAVRADCRRRSVGAGLVRTALDALRRRGAQGCVVLG 130

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           D AYY++ GF   P   L+ P        L L L     +   GIVR  +
Sbjct: 131 DPAYYARFGF--APCADLVFP-DAPATHFLALTLDDAAPRPA-GIVRYHD 176


>gi|188532512|ref|YP_001906309.1| Hypothetical acetyltransferase YhbS [Erwinia tasmaniensis Et1/99]
 gi|188027554|emb|CAO95401.1| Hypothetical acetyltransferase YhbS [Erwinia tasmaniensis Et1/99]
          Length = 167

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 60/162 (37%), Gaps = 8/162 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI A+   SF           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGIDAASIDALLRRSFPTSAEAELVQQLRE--DGLLTLGMVATDDEGQVLGYAS 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L  + V    + +G+  +LI   +D   + G   +V++GD AYY 
Sbjct: 59  FSPVTVNGEEQQWVGLASLAVDDSVRKQGLASRLIDEGLDTLNEFGYAAVVVLGDPAYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+      L           L   L       + G +  
Sbjct: 119 RRGFEPAVRHQLRCRGHGTEETFLVYGLSDEAFNGVSGYIAY 160


>gi|22124622|ref|NP_668045.1| hypothetical protein y0708 [Yersinia pestis KIM 10]
 gi|45440461|ref|NP_992000.1| putative acetyltransferase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108808969|ref|YP_652885.1| putative acetyltransferase [Yersinia pestis Antiqua]
 gi|108810776|ref|YP_646543.1| acetyltransferase [Yersinia pestis Nepal516]
 gi|145600540|ref|YP_001164616.1| acetyltransferase [Yersinia pestis Pestoides F]
 gi|153997484|ref|ZP_02022584.1| putative acetyltransferase [Yersinia pestis CA88-4125]
 gi|162421856|ref|YP_001608305.1| acetyltransferase [Yersinia pestis Angola]
 gi|165925816|ref|ZP_02221648.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165936692|ref|ZP_02225259.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010112|ref|ZP_02231010.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214318|ref|ZP_02240353.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398517|ref|ZP_02304041.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420813|ref|ZP_02312566.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423555|ref|ZP_02315308.1| acetyltransferase, GNAT family [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167467375|ref|ZP_02332079.1| acetyltransferase, GNAT family protein [Yersinia pestis FV-1]
 gi|218930490|ref|YP_002348365.1| putative acetyltransferase [Yersinia pestis CO92]
 gi|229839126|ref|ZP_04459285.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896615|ref|ZP_04511782.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis Pestoides A]
 gi|229899690|ref|ZP_04514831.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229900976|ref|ZP_04516100.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis Nepal516]
 gi|270489156|ref|ZP_06206230.1| acetyltransferase, GNAT family [Yersinia pestis KIM D27]
 gi|294505179|ref|YP_003569241.1| putative acetyltransferase [Yersinia pestis Z176003]
 gi|21957428|gb|AAM84296.1|AE013673_4 hypothetical protein y0708 [Yersinia pestis KIM 10]
 gi|45435318|gb|AAS60877.1| putative acetyltransferase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774424|gb|ABG16943.1| acetyltransferase [Yersinia pestis Nepal516]
 gi|108780882|gb|ABG14940.1| putative acetyltransferase [Yersinia pestis Antiqua]
 gi|115349101|emb|CAL22064.1| putative acetyltransferase [Yersinia pestis CO92]
 gi|145212236|gb|ABP41643.1| acetyltransferase [Yersinia pestis Pestoides F]
 gi|149289121|gb|EDM39201.1| putative acetyltransferase [Yersinia pestis CA88-4125]
 gi|162354671|gb|ABX88619.1| acetyltransferase, GNAT family [Yersinia pestis Angola]
 gi|165915341|gb|EDR33951.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922428|gb|EDR39605.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991019|gb|EDR43320.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204550|gb|EDR49030.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961619|gb|EDR57640.1| acetyltransferase, GNAT family [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051021|gb|EDR62429.1| acetyltransferase, GNAT family [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057725|gb|EDR67471.1| acetyltransferase, GNAT family [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229682315|gb|EEO78407.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis Nepal516]
 gi|229687182|gb|EEO79257.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695492|gb|EEO85539.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700393|gb|EEO88425.1| predicted acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis Pestoides A]
 gi|262363241|gb|ACY59962.1| putative acetyltransferase [Yersinia pestis D106004]
 gi|262367172|gb|ACY63729.1| putative acetyltransferase [Yersinia pestis D182038]
 gi|270337660|gb|EFA48437.1| acetyltransferase, GNAT family [Yersinia pestis KIM D27]
 gi|294355638|gb|ADE65979.1| putative acetyltransferase [Yersinia pestis Z176003]
 gi|320016681|gb|ADW00253.1| putative acyltransferase with acyl-CoA N-acyltransferase domain
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 168

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 63/165 (38%), Gaps = 9/165 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F  G        LRE     L+L  +  +    ++G   
Sbjct: 1   MLIRVEIPVDAPGIDALLRRAFQQGDEAELVQQLRE--DGLLTLGIVATDDEGVVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY- 146
            +P+ +         L P+ V    + +G+G KL+   +DA  + G   +V++G  AYY 
Sbjct: 59  FSPVEVGGEDRQWVALAPLAVEEGLRRQGLGEKLVYEGLDALNEFGYAAVVVLGAPAYYY 118

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           S+ GF       L    P          L ++   N KG V    
Sbjct: 119 SRFGFVPAARHQLTCRWPGSEEAFQVYALAEDTLVNTKGEVVFSA 163


>gi|115351952|ref|YP_773791.1| GCN5-like N-acetyltransferase [Burkholderia ambifaria AMMD]
 gi|115281940|gb|ABI87457.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria AMMD]
          Length = 180

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E  S + A+                    ++   +    L +S +    +R+VG 
Sbjct: 11  VTLRDERASDVDAIGRVIVAAFADEPQHGQLERQIVDALRADGALGVSLVAERDERVVGH 70

Query: 88  VRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           V  +P+SI          + L P+ V P  + + IG  L+   +DA  + G++  V++GD
Sbjct: 71  VAFSPVSIGGAPAGSHAWYGLAPLAVRPECRRRSIGAGLVRTGLDALRRLGARGCVVLGD 130

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            AYY++ GF  VP   L+  A       L L   +   +   G VR   
Sbjct: 131 PAYYARFGF--VPSGDLVF-ADAPREYFLALAFDEAALRP-SGEVRYHA 175


>gi|237704043|ref|ZP_04534524.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|309795569|ref|ZP_07689985.1| acetyltransferase, GNAT family [Escherichia coli MS 145-7]
 gi|226901955|gb|EEH88214.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|281181451|dbj|BAI57781.1| putative acetyltransferase [Escherichia coli SE15]
 gi|308120693|gb|EFO57955.1| acetyltransferase, GNAT family [Escherichia coli MS 145-7]
 gi|315286862|gb|EFU46279.1| acetyltransferase, GNAT family [Escherichia coli MS 110-3]
 gi|323955374|gb|EGB51144.1| acetyltransferase [Escherichia coli H263]
          Length = 183

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 64/168 (38%), Gaps = 9/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F +      S I  +   +FG  +       L E      +LS L     + VG +  T
Sbjct: 7   TFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFT 66

Query: 92  PISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             + +        H+L P+ V P YQ  G+G +LI   ++     G Q + ++G   YY 
Sbjct: 67  RATFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYP 126

Query: 148 KLGFQA-VPWKSLILPAPVDPNR---VLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     K    P P+        +   L      N+ G ++C +
Sbjct: 127 RHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTAQPM-NVTGHIQCAQ 173


>gi|254252164|ref|ZP_04945482.1| hypothetical protein BDAG_01380 [Burkholderia dolosa AUO158]
 gi|124894773|gb|EAY68653.1| hypothetical protein BDAG_01380 [Burkholderia dolosa AUO158]
          Length = 197

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E ++ + A+             G  +   ++   +    L++S +     ++VG 
Sbjct: 26  VTLRDERETDVEAIGRVIVAAFAGEPRGGQLERQIVAALRADRALTVSLVAERDGQVVGH 85

Query: 88  VRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           V  +P++I   T      + L P+ V P  + + IG  L+   +DA  + G++  V++G+
Sbjct: 86  VAFSPVAIGAETAEAAQWYGLAPLAVLPDCRRQSIGAGLVRTGLDALRRLGARGCVVLGE 145

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            AYY++ GF    +  ++ P+       L LP  +   +   G VR  +
Sbjct: 146 PAYYTRFGF--AQFDDIVFPS-APREYFLALPFDEAALRP-SGSVRYHD 190


>gi|218561480|ref|YP_002394393.1| acetyltransferase; KpLE2 phage-like element [Escherichia coli S88]
 gi|312969981|ref|ZP_07784163.1| acetyltransferase family protein [Escherichia coli 1827-70]
 gi|218368249|emb|CAR06065.1| putative acetyltransferase; KpLE2 phage-like element [Escherichia
           coli S88]
 gi|310337479|gb|EFQ02590.1| acetyltransferase family protein [Escherichia coli 1827-70]
 gi|323945907|gb|EGB41951.1| acetyltransferase [Escherichia coli H120]
          Length = 181

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 63/168 (37%), Gaps = 9/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F +      S I  +   +FG  +       L E      +LS L     + VG +  T
Sbjct: 7   TFHITDKSDASDIREVETRAFGFSKEADLVTSLLEDESARPALSLLARYEGKAVGHILFT 66

Query: 92  PISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             + +        H+L P+ V P YQ  G+G +LI   ++     G Q + ++G   YY 
Sbjct: 67  RATFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYP 126

Query: 148 KLGFQA-VPWKSLILPAPVDPNR---VLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     K    P P+        +   L       + G +RC +
Sbjct: 127 RHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTAQPMT-LTGHIRCAD 173


>gi|188590489|ref|YP_001921884.1| acetyltransferase [Clostridium botulinum E3 str. Alaska E43]
 gi|188500770|gb|ACD53906.1| acetyltransferase [Clostridium botulinum E3 str. Alaska E43]
          Length = 212

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 66/174 (37%), Gaps = 15/174 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
                R E++     +   +       + PG       +  LR+       L+++     
Sbjct: 1   MDIKIRNENEKDYRKVEEVAREAFWNLYFPGA-AEHVAINKLRKDKDFIPELTYVIEVDG 59

Query: 83  RIVGSVRMTP---ISIEKITGHLL--GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            I G++  +    +S +      +  GP+ + P     G+G KLI+ S++ A+  G + I
Sbjct: 60  EIAGAIFYSHSKIVSKDGTEHETISFGPVFIAPKMHRMGLGFKLITHSIEEAKNLGYKAI 119

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             +G   +Y   GF       + +P       +L LPL ++   NI G     E
Sbjct: 120 TTLGYPYHYEPYGFLGGKKYGISMPDGNFYKGLLVLPLYEDALDNISGYAVFSE 173


>gi|238755169|ref|ZP_04616515.1| acetyltransferase [Yersinia ruckeri ATCC 29473]
 gi|238706616|gb|EEP98987.1| acetyltransferase [Yersinia ruckeri ATCC 29473]
          Length = 151

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 57/136 (41%), Gaps = 3/136 (2%)

Query: 59  RAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNK 115
            A ++ + +    L+L  +  +    +VG    +P+ IE        L P+ V    + +
Sbjct: 11  EAQLVQQLREDGLLTLGIVATDDEGGVVGYAAFSPVDIEGEDRQWVGLAPLAVKAELRRQ 70

Query: 116 GIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           G+G KL+   +DA  + G   +V++G+ AYY + GF+      L    P   +      L
Sbjct: 71  GLGEKLVYEGLDALNEFGYAAVVVLGEPAYYQRFGFKPAADAQLYCRWPGYESAFQVYTL 130

Query: 176 VQNVAQNIKGIVRCRE 191
             +    + G V   E
Sbjct: 131 AADALIGVTGQVNYAE 146


>gi|16132128|ref|NP_418727.1| KpLE2 phage-like element; predicted acetyltransferase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|89111018|ref|AP_004798.1| predicted acetyltransferase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170083742|ref|YP_001733062.1| KpLE2 phage-like element; acetyltransferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|218707968|ref|YP_002415487.1| putative acetyltransferase; KpLE2 phage-like element [Escherichia
           coli UMN026]
 gi|238903400|ref|YP_002929196.1| KpLE2 phage-like element; putative acetyltransferase [Escherichia
           coli BW2952]
 gi|253775077|ref|YP_003037908.1| GCN5-related N-acetyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254164227|ref|YP_003047337.1| putative acetyltransferase [Escherichia coli B str. REL606]
 gi|293402963|ref|ZP_06647060.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298378489|ref|ZP_06988373.1| N-acetyltransferase yjhQ [Escherichia coli FVEC1302]
 gi|300900333|ref|ZP_07118510.1| acetyltransferase, GNAT family [Escherichia coli MS 198-1]
 gi|301019664|ref|ZP_07183821.1| acetyltransferase, GNAT family [Escherichia coli MS 196-1]
 gi|301646551|ref|ZP_07246424.1| acetyltransferase, GNAT family [Escherichia coli MS 146-1]
 gi|331650777|ref|ZP_08351805.1| acetyltransferase, GNAT family [Escherichia coli M718]
 gi|732075|sp|P39368|YJHQ_ECOLI RecName: Full=Uncharacterized N-acetyltransferase YjhQ
 gi|537148|gb|AAA97203.1| ORF_f181 [Escherichia coli str. K-12 substr. MG1655]
 gi|1790761|gb|AAC77263.1| KpLE2 phage-like element; predicted acetyltransferase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|85677049|dbj|BAE78299.1| predicted acetyltransferase [Escherichia coli str. K12 substr.
           W3110]
 gi|169891577|gb|ACB05284.1| KpLE2 phage-like element; predicted acetyltransferase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|218435065|emb|CAR16018.1| putative acetyltransferase; KpLE2 phage-like element [Escherichia
           coli UMN026]
 gi|238861598|gb|ACR63596.1| KpLE2 phage-like element; predicted acetyltransferase [Escherichia
           coli BW2952]
 gi|242379822|emb|CAQ34652.1| KpLE2 phage-like element; predicted acetyltransferase [Escherichia
           coli BL21(DE3)]
 gi|253326121|gb|ACT30723.1| GCN5-related N-acetyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253976130|gb|ACT41801.1| predicted acetyltransferase [Escherichia coli B str. REL606]
 gi|253980286|gb|ACT45956.1| predicted acetyltransferase [Escherichia coli BL21(DE3)]
 gi|260450879|gb|ACX41301.1| GCN5-related N-acetyltransferase [Escherichia coli DH1]
 gi|291429878|gb|EFF02892.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298280823|gb|EFI22324.1| N-acetyltransferase yjhQ [Escherichia coli FVEC1302]
 gi|299882125|gb|EFI90336.1| acetyltransferase, GNAT family [Escherichia coli MS 196-1]
 gi|300356132|gb|EFJ72002.1| acetyltransferase, GNAT family [Escherichia coli MS 198-1]
 gi|301075256|gb|EFK90062.1| acetyltransferase, GNAT family [Escherichia coli MS 146-1]
 gi|315138862|dbj|BAJ46021.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|331051231|gb|EGI23280.1| acetyltransferase, GNAT family [Escherichia coli M718]
          Length = 181

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 63/168 (37%), Gaps = 9/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F +      S I  +   +FG  +       L E      +LS L     + VG +  T
Sbjct: 7   TFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFT 66

Query: 92  PISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             + +        H+L P+ V P YQ  G+G +LI   ++     G Q + ++G   YY 
Sbjct: 67  RATFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYP 126

Query: 148 KLGFQA-VPWKSLILPAPVDPNR---VLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     K    P P+        +   L       + G +RC +
Sbjct: 127 RHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTAQPMT-LTGHIRCAD 173


>gi|258423435|ref|ZP_05686326.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257846496|gb|EEV70519.1| conserved hypothetical protein [Staphylococcus aureus A9635]
          Length = 176

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 60/172 (34%), Gaps = 13/172 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYDFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCREV 192
              YY+ LG+Q      +  P   +     L   L  N      G +    V
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSV 172


>gi|255012673|ref|ZP_05284799.1| acetyltransferase [Bacteroides sp. 2_1_7]
          Length = 189

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 64/171 (37%), Gaps = 13/171 (7%)

Query: 33  FFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
               R    S    I  +   +FG  +       L         +S L       +G + 
Sbjct: 5   NIQIRETATSDFSHIMEVEKLAFGYDKEAELVAELLADNTTKPIVSLLAFYKDEPIGHIL 64

Query: 90  MTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            T     +       H+L P+ V P YQ +GIG  LI   ++  ++KGS ++ ++G   Y
Sbjct: 65  FTRAYFNEQQQQPMMHILAPLAVKPEYQRQGIGGMLIKAGIEKLQEKGSNLVFVLGHKEY 124

Query: 146 YSKLGFQAVPWKSLILPAPVD-----PNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y K GF       L  PAP        +  +  P+     +  KG ++C E
Sbjct: 125 YPKYGFIPDANH-LGYPAPYPILEEYSDYWMVQPISPKGFEIGKGKIKCSE 174


>gi|308324750|gb|ADO29931.1| hypothetical protein PP109 [Penicillium paxilli]
          Length = 175

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 72/169 (42%), Gaps = 16/169 (9%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRA------AVLLREQGMHDLSLSFLCAEG--KRI 84
             + R E ++   A+   +                ++   +  + LS+S +  +     I
Sbjct: 6   EIIIRPETENDEPAIEKVTSTAFMNAEHTDHNEQFIVRGLRDTNHLSISLVAEDKATNTI 65

Query: 85  VGSVRMTPISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           VG   ++P+ I       + LGP+ + P YQN GIG  LI  ++   + + +   V++G+
Sbjct: 66  VGHAAISPVKISTGCANWYGLGPVSILPQYQNNGIGSLLIERALAILQSRRAAGCVVLGN 125

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             YY++ GF+A   +SL LP  V P   + L   +       G V   +
Sbjct: 126 PKYYTRFGFKA--TRSLQLPG-VPPECFMALTWHEQTP---TGTVSYHK 168


>gi|281203986|gb|EFA78182.1| hypothetical protein PPL_08832 [Polysphondylium pallidum PN500]
          Length = 305

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 70/170 (41%), Gaps = 11/170 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGP--GRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSV 88
                  E+ S    +   +     G    A ++ + +      LS +  +  R +VG +
Sbjct: 2   TNISIEKENQSQFIEIRDLTLKAFDGDLDTANIIEKLRDEKKDVLSLVALDNDRSVVGHI 61

Query: 89  RMTPIS------IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
             + +          I    L P+ V P  Q +GIGR+LI  S+   + +G +V++++G 
Sbjct: 62  MYSEMQVTLDDGKRNIRTVALAPVSVRPSLQKQGIGRQLIEQSLRMLKDQGVEVVIVLGH 121

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
             YY K GF A   K L  P       ++ L L +   ++  G VR  ++
Sbjct: 122 PTYYPKFGFSAELIKHLTAPF--AGESLMALELKEGSLKSTNGTVRYADI 169


>gi|266624987|ref|ZP_06117922.1| acetyltransferase [Clostridium hathewayi DSM 13479]
 gi|288863116|gb|EFC95414.1| acetyltransferase [Clostridium hathewayi DSM 13479]
          Length = 213

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 61/165 (36%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
            + R E ++    +   +       + PG      ++  +R+       L F+     R+
Sbjct: 4   IMIRSEKETDYSVVEEITRKAFYNIYVPGA-TEHYLVHIMRQHEDFIPELDFVIELDGRV 62

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T          +      GP+ + P YQ  G G+ L+  S + A + G  VIV+
Sbjct: 63  IGNIMYTKARLIDEAGTEKEILTFGPVSIDPEYQRAGYGKLLLEHSFEQAARLGYDVIVI 122

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G    Y   GF++     + +     P  ++   L  +     K
Sbjct: 123 FGSPMNYVSRGFKSCKKYHICIENGKYPAAMMVKELTPHALDGRK 167


>gi|298374414|ref|ZP_06984372.1| acetyltransferase [Bacteroides sp. 3_1_19]
 gi|298268782|gb|EFI10437.1| acetyltransferase [Bacteroides sp. 3_1_19]
          Length = 189

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 64/171 (37%), Gaps = 13/171 (7%)

Query: 33  FFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
               R    S    I  +   +FG  +       L         +S L       +G + 
Sbjct: 5   NIQIRETATSDFSHIMEVEKLAFGYDKEAELVAELLADNTTKPIVSLLAFYKDEPIGHIL 64

Query: 90  MTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            T     +       H+L P+ V P YQ +GIG  LI   ++  ++KGS ++ ++G   Y
Sbjct: 65  FTRAYFNEHQQQPMMHILAPLAVKPEYQRQGIGGMLIKAGIEKLQEKGSNLVFVLGHKEY 124

Query: 146 YSKLGFQAVPWKSLILPAPVD-----PNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y K GF       L  PAP        +  +  P+     +  KG ++C E
Sbjct: 125 YPKYGFIPDANH-LGYPAPYPILEEYSDYWMVQPISPKGFEIGKGKIKCSE 174


>gi|153814076|ref|ZP_01966744.1| hypothetical protein RUMTOR_00284 [Ruminococcus torques ATCC 27756]
 gi|317499833|ref|ZP_07958071.1| acetyltransferase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331087893|ref|ZP_08336817.1| hypothetical protein HMPREF1025_00400 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848472|gb|EDK25390.1| hypothetical protein RUMTOR_00284 [Ruminococcus torques ATCC 27756]
 gi|316898735|gb|EFV20768.1| acetyltransferase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330409380|gb|EGG88826.1| hypothetical protein HMPREF1025_00400 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 215

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 65/169 (38%), Gaps = 15/169 (8%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAE 80
           +    + R E       +   +       + PG  V   ++  +RE       L F+   
Sbjct: 1   MKENVIIRNERKEDWEIVETITRQAFYNLYVPG-CVEHYLVHNMREHEDFISELDFVLEL 59

Query: 81  GKRIVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
              ++G++  T       +  K      GPI +HP YQ  G G+ LI  S  AA + G  
Sbjct: 60  NGNVIGNIMYTKAKLIDENKNKKDILTFGPISIHPAYQRMGYGKMLIEHSFQAAIQLGYD 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            IV+ G  A Y   GF++    ++ +     P  ++   L+ +V    K
Sbjct: 120 TIVIFGSPANYISRGFKSCKKYNVCIENGKYPAAMMVKELIPHVLDGHK 168


>gi|302332496|gb|ADL22689.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 176

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/149 (23%), Positives = 57/149 (38%), Gaps = 5/149 (3%)

Query: 46  AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT----GH 101
           A      G G        +R    +D +L  +      +VG   ++ + ++       G 
Sbjct: 21  AFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVVGHGLLSEVYLDNEAQREIGL 80

Query: 102 LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLIL 161
           +L P+ V   +QNKGIG++LI      A  KG   I ++G   YY+ LG+Q      +  
Sbjct: 81  VLAPVSVDIHHQNKGIGKRLIQALEREARLKGYNFISVLGWPKYYANLGYQRASMYDIYP 140

Query: 162 PAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
           P   +     L   L  N      G +  
Sbjct: 141 PYDGIPDEAFLIKELKVNSLAGKIGTINY 169


>gi|221215069|ref|ZP_03588036.1| acetyltransferase, gnat family [Burkholderia multivorans CGD1]
 gi|221165005|gb|EED97484.1| acetyltransferase, gnat family [Burkholderia multivorans CGD1]
          Length = 185

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query: 34  FLERLEHDSSICAMHAD---SFG----PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
              R E  S + A+      +F      G+F R  ++   +    L++S +     R++G
Sbjct: 12  VTLRDERPSDVDAIADVIVSAFAGEPEHGQFER-RIVDALRADRALAVSLVAERDGRVIG 70

Query: 87  SVRMTPISIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
            V  +P+SI          + L P+ V    + + +G  L+  ++DA  ++G+Q  V++G
Sbjct: 71  HVACSPVSIGGAAAGDSRWYGLAPLAVRADCRRRSVGAGLVRTALDALRRRGAQGCVVLG 130

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           D AYY++ GF   P   L+ P        L L L     +   GIVR  +
Sbjct: 131 DPAYYARCGF--APCAELVFPG-APATHFLALTLDDAAPRPA-GIVRYHD 176


>gi|238918437|ref|YP_002931951.1| hypothetical protein NT01EI_0481 [Edwardsiella ictaluri 93-146]
 gi|238868005|gb|ACR67716.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 167

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 58/164 (35%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E       I  +    F           LRE     L+L  +  +    +VG V 
Sbjct: 1   MLIRAEIPVDAPGIDRLLRRCFPGADEAEQVSCLREG--GLLTLGIVATDDEGGVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   Y+ +GI  +L+   +D   + G   + ++G+  YY 
Sbjct: 59  FSPVTVDGEECQWVGLAPLAVDEAYRRQGIAEQLVYEGLDTLNEFGYAGVTVLGESHYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF       L    P          L     +  +G +   E
Sbjct: 119 RFGFVNAAQHGLHCRWPGCDALFQVYALAPQALEQARGCIEYAE 162


>gi|151220967|ref|YP_001331789.1| hypothetical protein NWMN_0755 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|150373767|dbj|BAF67027.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
          Length = 176

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLMLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|254387883|ref|ZP_05003120.1| acetyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|326446232|ref|ZP_08220966.1| acetyltransferase-like protein [Streptomyces clavuligerus ATCC
           27064]
 gi|197701607|gb|EDY47419.1| acetyltransferase [Streptomyces clavuligerus ATCC 27064]
          Length = 196

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 56/160 (35%), Gaps = 6/160 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHDL---SLSFLCAE-GKRIVGSVR 89
             R E    I A+ A +         A ++   +   +     LS L      R  G   
Sbjct: 32  TTRPETADDIPAVRAINLAAFPTALEADLVEALRADREAWIDGLSLLAVAPDGRAAGHAL 91

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   +       L P  V P YQ +G G   +  ++DAA   G   +V++G   YY + 
Sbjct: 92  LTRCRVGTEPALALAPCAVLPEYQGQGAGTAAVRAALDAARALGENTVVVLGHPGYYPRF 151

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF       +  P  V    ++ L L         G ++ 
Sbjct: 152 GFAPASGFGIRAPFDVPDEAMMALTLDPGRPA-ATGTIQY 190


>gi|298694121|gb|ADI97343.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 176

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++  T    G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNETQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY  LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYGNLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|313905422|ref|ZP_07838787.1| GCN5-related N-acetyltransferase [Eubacterium cellulosolvens 6]
 gi|313469745|gb|EFR65082.1| GCN5-related N-acetyltransferase [Eubacterium cellulosolvens 6]
          Length = 209

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 65/171 (38%), Gaps = 18/171 (10%)

Query: 33  FFLERLEHDSSICAMHADS-------FGPGRFVRAAV--LLREQGMHDLSLSFLCAEGKR 83
            ++ RLE      A+           + PG      V  +LR+       L F+  + + 
Sbjct: 5   DYMIRLEEKKDHRAVENLVRESFWNVYKPG-CAEHYVIHVLRDDPAFIPELDFVMEKDES 63

Query: 84  IVGSVRMT---PISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++G         ++ +        +GPI + P  + KG G+ L+  S+  A + G   ++
Sbjct: 64  LIGQNLFMKTVIVADDGRAIDVLTMGPIGITPELKRKGYGKALLDYSLGKATEMGFGAVL 123

Query: 139 LVGDIAYYSKLGFQAVPWKSLI---LPAPVDPNRVLFLPLVQNVAQNIKGI 186
             G+I +Y K GF       +    LP   D +  L   L+      I G+
Sbjct: 124 FEGNIGFYGKSGFNYASKFGIRYHDLPEDADSSFFLCKELIPGYLDGITGV 174


>gi|83949707|ref|ZP_00958440.1| acetyltransferase, GNAT family protein [Roseovarius nubinhibens
           ISM]
 gi|83837606|gb|EAP76902.1| acetyltransferase, GNAT family protein [Roseovarius nubinhibens
           ISM]
          Length = 114

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 82  KRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
             + G++R  P+ +      LLGP+ VHP  Q +G+G  LI  S+D A ++G   ++LVG
Sbjct: 7   GIVAGAIRYWPVMVGAARALLLGPVAVHPTRQGEGLGGLLIHGSLDKAREQGWPRVMLVG 66

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           D  YY++ GF+ +    + +P P +P+RVL + L  +    + G V
Sbjct: 67  DAPYYARFGFERL--DGVEMPPPTNPDRVLGIALRPDAWAGVTGHV 110


>gi|85058364|ref|YP_454066.1| putative acetyltransferase [Sodalis glossinidius str. 'morsitans']
 gi|84778884|dbj|BAE73661.1| putative acetyltransferase [Sodalis glossinidius str. 'morsitans']
          Length = 169

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 63/162 (38%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   +F   R   AA++   +    L+L  +  +    ++G   
Sbjct: 1   MLIRMEIPVDAPGIDGLLKRAFN--RDREAALVRALREDGLLTLGVVATDDKGGVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             P+ I+        L P+ V   ++ +GIGR L+   +D   + G   +V +GD A++ 
Sbjct: 59  YCPVWIDGEDHKWVALAPLAVDGAWRGQGIGRSLVYEGLDTLNEFGYSAVVTLGDPAWFH 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+      L    P          L ++    + G V  
Sbjct: 119 RFGFEPAARWQLRTLWPGTEAAFQLFRLAESALDGVSGEVSW 160


>gi|332186780|ref|ZP_08388522.1| acetyltransferase family protein [Sphingomonas sp. S17]
 gi|332013113|gb|EGI55176.1| acetyltransferase family protein [Sphingomonas sp. S17]
          Length = 173

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/141 (32%), Positives = 71/141 (50%), Gaps = 8/141 (5%)

Query: 41  DSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVRMTPISIEKIT 99
            +++ A+   +F PGR  R A  +R       SL F    E   ++GS++  PI++    
Sbjct: 15  PAAVEALLDRAFPPGRQARTAYKVRGSVAPVDSLCFAALTEDGTLIGSIQCWPIALTDDD 74

Query: 100 G-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV-IVLVGDIAYYSK-LGFQ 152
           G      ++GP+ V P YQ  GIGRKL    + AA+ +G    ++L+GD  YY +  GF 
Sbjct: 75  GEHWPLIMIGPVAVAPEYQRDGIGRKLFLHMLAAAQDQGLDRAMMLIGDPEYYGRFFGFT 134

Query: 153 AVPWKSLILPAPVDPNRVLFL 173
           A       LP PV+ +R+L  
Sbjct: 135 AERTARWRLPGPVERHRLLAR 155


>gi|49483043|ref|YP_040267.1| acetyltransferase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257424906|ref|ZP_05601333.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427574|ref|ZP_05603973.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430205|ref|ZP_05606589.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432906|ref|ZP_05609266.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435810|ref|ZP_05611858.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282903418|ref|ZP_06311309.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           C160]
 gi|282905196|ref|ZP_06313053.1| acetyltransferase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908176|ref|ZP_06316007.1| acetyltransferase [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910433|ref|ZP_06318237.1| acetyltransferase [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913630|ref|ZP_06321419.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           M899]
 gi|282918581|ref|ZP_06326318.1| acetyltransferase [Staphylococcus aureus subsp. aureus C427]
 gi|282923547|ref|ZP_06331227.1| acetyltransferase [Staphylococcus aureus subsp. aureus C101]
 gi|283957620|ref|ZP_06375073.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293500671|ref|ZP_06666522.1| acetyltransferase [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509621|ref|ZP_06668332.1| acetyltransferase [Staphylococcus aureus subsp. aureus M809]
 gi|293524207|ref|ZP_06670894.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295427365|ref|ZP_06820000.1| acetyltransferase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297590278|ref|ZP_06948917.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49241172|emb|CAG39850.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272476|gb|EEV04599.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275767|gb|EEV07240.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279402|gb|EEV10003.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282321|gb|EEV12456.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285001|gb|EEV15120.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282314415|gb|EFB44805.1| acetyltransferase [Staphylococcus aureus subsp. aureus C101]
 gi|282317715|gb|EFB48087.1| acetyltransferase [Staphylococcus aureus subsp. aureus C427]
 gi|282322662|gb|EFB52984.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           M899]
 gi|282325825|gb|EFB56133.1| acetyltransferase [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327841|gb|EFB58123.1| acetyltransferase [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282331603|gb|EFB61115.1| acetyltransferase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282596373|gb|EFC01334.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           C160]
 gi|283791071|gb|EFC29886.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290921170|gb|EFD98231.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095676|gb|EFE25937.1| acetyltransferase [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467718|gb|EFF10233.1| acetyltransferase [Staphylococcus aureus subsp. aureus M809]
 gi|295128753|gb|EFG58384.1| acetyltransferase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576577|gb|EFH95292.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|312438783|gb|ADQ77854.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315194406|gb|EFU24798.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 176

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPNYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|325262221|ref|ZP_08128959.1| acetyltransferase, GNAT family protein [Clostridium sp. D5]
 gi|324033675|gb|EGB94952.1| acetyltransferase, GNAT family protein [Clostridium sp. D5]
          Length = 215

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 57/167 (34%), Gaps = 13/167 (7%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E                   + PG        ++R+       L+ +     +
Sbjct: 1   MDIELRVERPEDYRETENLVREAFWNHYSPGCSEHYLLHIMRDCQEFVPELNIVALHQDK 60

Query: 84  IVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V      IE   G       LGPI V P +Q+ GIG +++  +   A   G + ++
Sbjct: 61  IVGNVVYMKSRIEGDDGKTYEVLSLGPIAVLPEFQSSGIGGRMLDYTKKIARDMGFRAVL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           L GD  YYS+ GF       +          +    L +       G
Sbjct: 121 LCGDPDYYSRHGFIPAEKLGIRTADNKYAAALQVCELYEGALSGTGG 167


>gi|57650130|ref|YP_185728.1| acetyltransferase [Staphylococcus aureus subsp. aureus COL]
 gi|87161644|ref|YP_493471.1| acetyltransferase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194571|ref|YP_499367.1| hypothetical protein SAOUHSC_00811 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|161509059|ref|YP_001574718.1| acetyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221142200|ref|ZP_03566693.1| acetyltransferase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|258452165|ref|ZP_05700181.1| acetyltransferase [Staphylococcus aureus A5948]
 gi|262050050|ref|ZP_06022907.1| hypothetical protein SAD30_1790 [Staphylococcus aureus D30]
 gi|262052709|ref|ZP_06024900.1| hypothetical protein SA930_1879 [Staphylococcus aureus 930918-3]
 gi|282926142|ref|ZP_06333777.1| acetyltransferase [Staphylococcus aureus A9765]
 gi|284023809|ref|ZP_06378207.1| acetyltransferase [Staphylococcus aureus subsp. aureus 132]
 gi|294850515|ref|ZP_06791244.1| acetyltransferase [Staphylococcus aureus A9754]
 gi|304381588|ref|ZP_07364238.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57284316|gb|AAW36410.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           COL]
 gi|87127618|gb|ABD22132.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202129|gb|ABD29939.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|160367868|gb|ABX28839.1| acetyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257860380|gb|EEV83212.1| acetyltransferase [Staphylococcus aureus A5948]
 gi|259159406|gb|EEW44459.1| hypothetical protein SA930_1879 [Staphylococcus aureus 930918-3]
 gi|259161846|gb|EEW46431.1| hypothetical protein SAD30_1790 [Staphylococcus aureus D30]
 gi|269940363|emb|CBI48740.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282592283|gb|EFB97300.1| acetyltransferase [Staphylococcus aureus A9765]
 gi|294822653|gb|EFG39093.1| acetyltransferase [Staphylococcus aureus A9754]
 gi|302750682|gb|ADL64859.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339951|gb|EFM05895.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315196268|gb|EFU26622.1| acetyltransferase [Staphylococcus aureus subsp. aureus CGS01]
 gi|320139875|gb|EFW31736.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142034|gb|EFW33862.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329723809|gb|EGG60337.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           21189]
          Length = 176

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|323950605|gb|EGB46483.1| acetyltransferase [Escherichia coli H252]
          Length = 181

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 63/168 (37%), Gaps = 9/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
            F +      S I  +   +FG G+       L E      +LS L     + VG +  T
Sbjct: 7   TFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFT 66

Query: 92  PISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             + +        H+L P+   P YQ  G+G +LI   ++     G Q + ++G   YY 
Sbjct: 67  RATFKGEMDSPLMHILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYP 126

Query: 148 KLGFQA-VPWKSLILPAPVDPNR---VLFLPLVQNVAQNIKGIVRCRE 191
           + GF+     K    P P+        +   L       + G +RC +
Sbjct: 127 RHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTAQPMT-LTGHIRCAD 173


>gi|221198203|ref|ZP_03571249.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2M]
 gi|221208304|ref|ZP_03581307.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2]
 gi|221171717|gb|EEE04161.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2]
 gi|221182135|gb|EEE14536.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2M]
          Length = 185

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 17/170 (10%)

Query: 34  FLERLEHDSSICAMHAD---SFG----PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
              R E  S + A+      +F      G+F R  ++   +    L++S +     R++G
Sbjct: 12  VTLRDERASDVDAIADVIVSAFAGEPEHGQFER-RIVDALRADRALAVSLVAERDGRVIG 70

Query: 87  SVRMTPISIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
            V  +P+SI          + L P+ V    + + +G  L+  ++DA  ++G+Q  V++G
Sbjct: 71  HVACSPVSIGGAAAGDSRWYGLAPLAVRADCRRRSVGAGLVRTALDALRRRGAQGCVVLG 130

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           D AYY++ GF   P   L+ P        L L L  + A +  GIVR  +
Sbjct: 131 DPAYYARFGF--APCAELVFP-DAPATHFLALML-DDAAPHRAGIVRYHD 176


>gi|172060878|ref|YP_001808530.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MC40-6]
 gi|171993395|gb|ACB64314.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MC40-6]
          Length = 180

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 68/169 (40%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    + A+                    ++   +    L++S +    +R+VG 
Sbjct: 11  VTLRDERAGDVDAIGRVIVAAFADEPQHGQLERQIVDALRADGALAVSLVAERDERVVGH 70

Query: 88  VRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           +  +P+SI          + LGP+ V P  + + IG  L+   +DA  + G++  V++GD
Sbjct: 71  IAFSPVSIGGAPAGSHAWYGLGPLAVRPECRRRSIGAGLVRTGLDALRRLGARGCVVLGD 130

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            AYY++ GF  VP   L+  A   P   L L   +   +   G V    
Sbjct: 131 PAYYARFGF--VPSGDLVF-ADAPPEYFLALAFDEAAPRP-SGGVSYHA 175


>gi|308189126|ref|YP_003933257.1| acetyltransferase [Pantoea vagans C9-1]
 gi|308059636|gb|ADO11808.1| putative acetyltransferase [Pantoea vagans C9-1]
          Length = 168

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     + I  +    F           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRSEIGVDAAGIDVLLRRCFSTSAEAELTQALRE--DGLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+S++        L P+ V    + +GI  KLI   +D   + G   +V++GD A +S
Sbjct: 59  FSPVSVQGDDRGWVALAPLAVDETLRGQGIASKLIYEGLDTLNEFGYSAVVVLGDPALFS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF++     L    P          L  N     +G +   E
Sbjct: 119 RFGFESAARHGLRSRWPGTETTFQVYRLADNAFDGAEGQIDYAE 162


>gi|269137776|ref|YP_003294476.1| putative acetyltransferase [Edwardsiella tarda EIB202]
 gi|267983436|gb|ACY83265.1| putative acetyltransferase [Edwardsiella tarda EIB202]
 gi|304557833|gb|ADM40497.1| Acetyltransferase [Edwardsiella tarda FL6-60]
          Length = 167

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 57/164 (34%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E       I  +    F           LRE     L+L  +  +    +VG   
Sbjct: 1   MLIRAEIPVDAPGIDRLLRRCFPGADEAELVSCLRE--DGLLTLGIVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V   Y+ +GI  +L+   +D   + G   + ++GD  YY 
Sbjct: 59  FSPVTVDGEECQWVGLAPLAVDEAYRRQGIAERLVYEGLDTLNEFGYAGVAVLGDPRYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF       L    P          L     +  +G +   E
Sbjct: 119 RFGFVNAAQNDLHCRWPECDTLFQVYALAPQALEQARGRIEYAE 162


>gi|167769025|ref|ZP_02441078.1| hypothetical protein ANACOL_00347 [Anaerotruncus colihominis DSM
           17241]
 gi|167668665|gb|EDS12795.1| hypothetical protein ANACOL_00347 [Anaerotruncus colihominis DSM
           17241]
          Length = 214

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 64/165 (38%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRA--AVLLREQGMHDLSLSFLCAEGKRI 84
            L R E ++    +   +       + PG  V    A ++R        L F+   G ++
Sbjct: 5   VLIRNERETDYQKVEEITRKAFWNLYIPG-CVEHYLAHVMRGHADFLPELDFVVEIGGQV 63

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T         E+      GP+ + P YQ KG G++++  S + A   G   IV+
Sbjct: 64  IGNIMYTKAKLIDECGEEKEILTFGPVSILPEYQRKGYGKRMMEYSFERAAALGYDTIVI 123

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G+   Y   GF++    ++ +     P  ++   L        K
Sbjct: 124 FGNPGNYVGRGFKSCKKYNICMEDGTFPAAMMVKVLKPGALDGRK 168


>gi|294817434|ref|ZP_06776076.1| Predicted acetyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|294322249|gb|EFG04384.1| Predicted acetyltransferase [Streptomyces clavuligerus ATCC 27064]
          Length = 214

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 56/160 (35%), Gaps = 6/160 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFV-RAAVLLREQGMHDL---SLSFLCAE-GKRIVGSVR 89
             R E    I A+ A +         A ++   +   +     LS L      R  G   
Sbjct: 50  TTRPETADDIPAVRAINLAAFPTALEADLVEALRADREAWIDGLSLLAVAPDGRAAGHAL 109

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   +       L P  V P YQ +G G   +  ++DAA   G   +V++G   YY + 
Sbjct: 110 LTRCRVGTEPALALAPCAVLPEYQGQGAGTAAVRAALDAARALGENTVVVLGHPGYYPRF 169

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           GF       +  P  V    ++ L L         G ++ 
Sbjct: 170 GFAPASGFGIRAPFDVPDEAMMALTLDPGRPA-ATGTIQY 208


>gi|237719388|ref|ZP_04549869.1| acetyltransferase [Bacteroides sp. 2_2_4]
 gi|293373299|ref|ZP_06619657.1| acetyltransferase, GNAT family [Bacteroides ovatus SD CMC 3f]
 gi|299149098|ref|ZP_07042159.1| acetyltransferase [Bacteroides sp. 3_1_23]
 gi|229451248|gb|EEO57039.1| acetyltransferase [Bacteroides sp. 2_2_4]
 gi|292631695|gb|EFF50315.1| acetyltransferase, GNAT family [Bacteroides ovatus SD CMC 3f]
 gi|298512765|gb|EFI36653.1| acetyltransferase [Bacteroides sp. 3_1_23]
          Length = 215

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 63/173 (36%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       + PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQSSDYHETENITREAFWNHYSPGCDEHYLLHIMRNHPKFVPELDIVAEHNNK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ +GIG ++I+++   A + G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQQGIGGRMIALTKKLASEMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  N   N+KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVCELYDNALANVKG--RYIE 171


>gi|256376894|ref|YP_003100554.1| GCN5-related N-acetyltransferase [Actinosynnema mirum DSM 43827]
 gi|255921197|gb|ACU36708.1| GCN5-related N-acetyltransferase [Actinosynnema mirum DSM 43827]
          Length = 183

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 68/174 (39%), Gaps = 17/174 (9%)

Query: 34  FLERLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMHD--------------LSLSFLC 78
            L R E  + + A+ A +     R  ++A  LR+    +               +LS + 
Sbjct: 6   VLIRPERPADVPAIRAVTAAAFTRPDQSAAELRDGAPVEVWLVDELRADAGWLPALSLVA 65

Query: 79  AE-GKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            +    +VG V  T  ++  +    LGP+ V P  Q  G+G  L+   + AA+  G  ++
Sbjct: 66  QDPDGAVVGHVLATRGAVGDVPALGLGPLSVRPDRQRAGVGSALVHALLGAADALGEPLV 125

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            L+GD  YY + GF       +  P P         PL  +     +G  R  E
Sbjct: 126 ALLGDPGYYHRFGFLPCGETGVAPPVPEWEPHFQVRPLAAHDPA-ARGTFRYAE 178


>gi|329313528|gb|AEB87941.1| Acetyltransferase [Staphylococcus aureus subsp. aureus T0131]
          Length = 176

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFTQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|123440830|ref|YP_001004821.1| putative acetyltransferase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087791|emb|CAL10577.1| putative acetyltransferase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 167

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F       A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLIRVEIPVDAPGIDALLRKAFKG--DDEAGLVQQLREDGLLTLGIVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V    + +G+  KL+   +D+  + G   +V++GD AYY 
Sbjct: 59  FSPVDVGGEDRQWVALAPLAVEESLRRQGLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF       L    P          L ++   +  G V    
Sbjct: 119 RFGFVPAARHQLTCRWPDTEEAFQVYALAEDALTDADGEVVFSA 162


>gi|317493641|ref|ZP_07952062.1| acetyltransferase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918584|gb|EFV39922.1| acetyltransferase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 172

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +  ++F           LRE     L+L  +  +    ++G   
Sbjct: 1   MLIRVEIPVDAAGIDRLLRNAFPSSEEAELVHRLRE--DGLLTLGVVATDEEGGVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        L P+VV   ++ +G+  ++I   +D+  + G   +V++G+ AY+S
Sbjct: 59  FSPVYVDGEDRQCVGLAPVVVDEAHRRQGLAEQIIYEGLDSLNEFGYSAVVVLGEPAYFS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GFQ    + L    P   +  L  PL     +N KG+V    
Sbjct: 119 RFGFQNAAQQGLRSHLPGTEDSFLVYPLAGGEMENCKGVVEYSA 162


>gi|259907050|ref|YP_002647406.1| putative acetyltransferase YhbS [Erwinia pyrifoliae Ep1/96]
 gi|224962672|emb|CAX54127.1| putative acetyltransferase YhbS [Erwinia pyrifoliae Ep1/96]
 gi|283476847|emb|CAY72685.1| putative acetyltransferase [Erwinia pyrifoliae DSM 12163]
          Length = 167

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI A+   SF           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGIDAASIDALLRRSFPTSAEAELVRQLREG--GLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+ V    + +G+G +LI   +D   + G   +V++GD AYY 
Sbjct: 59  FSPVTLNGEDRQWVGLAPLAVDESVRKQGLGSRLIYEGLDTLNEFGYAAVVVLGDSAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L               L  +V   I G +    
Sbjct: 119 RCGFKTAAHCQLHCRREGTEQAFQVYKLADDVCNGIAGNIEYSA 162


>gi|160933917|ref|ZP_02081304.1| hypothetical protein CLOLEP_02779 [Clostridium leptum DSM 753]
 gi|156866590|gb|EDO59962.1| hypothetical protein CLOLEP_02779 [Clostridium leptum DSM 753]
          Length = 168

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 58/165 (35%), Gaps = 9/165 (5%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRA--------AVLLREQGMHDLSLSFLCAEGKRIVG 86
           + R E       ++                       LR+       LS +      I G
Sbjct: 1   MIRKETTKDHAEVYQLIKEAFETAEHTDGSEQDLVCALRKSDAFIADLSLVAEISGEIAG 60

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            +  T   +       L P+ V P+YQ +G+G  LI      A++ G Q  +++G   YY
Sbjct: 61  HILFTKARVGNAEVVALAPLSVKPVYQRQGVGTALIKEGHRIAKELGYQYSLVLGSELYY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            ++G++      + LP  +     +   L  +  + I+  V   +
Sbjct: 121 PRMGYRPASQLGVELPLGIPDQNFMIAKLRNDA-KPIRSPVAYAK 164


>gi|21282492|ref|NP_645580.1| hypothetical protein MW0763 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49485656|ref|YP_042877.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297208486|ref|ZP_06924915.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300912560|ref|ZP_07130003.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21203929|dbj|BAB94628.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49244099|emb|CAG42525.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296886741|gb|EFH25645.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300886806|gb|EFK82008.1| GNAT family acetyltransferase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|329733948|gb|EGG70270.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           21193]
          Length = 176

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|300789769|ref|YP_003770060.1| GNAT family acetyltransferase [Amycolatopsis mediterranei U32]
 gi|299799283|gb|ADJ49658.1| GNAT family acetyltransferase [Amycolatopsis mediterranei U32]
          Length = 172

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/153 (26%), Positives = 63/153 (41%), Gaps = 10/153 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDL--SLSFLCAEGKRIV 85
            L R E  +   A+HA      R       V A ++   +   DL  +LS +      + 
Sbjct: 1   MLIRRETPADRAAIHAVHSAAFRREEGAVPVEAPLVDELRAEGDLIGALSLVAVRDGEVA 60

Query: 86  GSVRMTPISIEKITGH--LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G V  +   +         LGP+ V P +Q  G+G  L+   + AA+  G  ++VL+G+ 
Sbjct: 61  GHVCCSRARLGDDPAAAVGLGPLGVLPAHQAHGVGSALMHAVLGAADALGHGLVVLLGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           AYYS+ GF A    S+  P P          L 
Sbjct: 121 AYYSRFGFAAASALSITAPDPKWGRYFQARTLT 153


>gi|239834474|ref|ZP_04682802.1| GCN5-related N-acetyltransferase [Ochrobactrum intermedium LMG
           3301]
 gi|239822537|gb|EEQ94106.1| GCN5-related N-acetyltransferase [Ochrobactrum intermedium LMG
           3301]
          Length = 186

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 82  KRIVGSVRMTPISIE------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
           +R  G+VR+  +          ++  LLGP+ V P     GIG  L+  ++D A + G  
Sbjct: 57  ERSQGTVRLWDVHAGLDAFGFPVSALLLGPLAVEPSAAGCGIGSALMRHAIDEAMRLGHG 116

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            I+LVGD  YY + GF A     L +P P +  R L L L         G++R  
Sbjct: 117 AILLVGDPEYYGRFGFTAEKTGELAMPGPYEKRRFLALELKPGHLDGAHGVLRAS 171


>gi|90418048|ref|ZP_01225960.1| possible N-acetyltransferase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337720|gb|EAS51371.1| possible N-acetyltransferase [Aurantimonas manganoxydans SI85-9A1]
          Length = 167

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 59/155 (38%), Gaps = 11/155 (7%)

Query: 36  ERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
            R E       +                  AA++   +    L++S + A   +IVG   
Sbjct: 5   IRPERSGDAAEILHLVTAAFADAPHSGGTEAAIIDALRADDALTVSLVAAADGKIVGHAA 64

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
           ++P++I+        LGP+ V P  Q +GIG  L+   +D    +G++  V++G   YY 
Sbjct: 65  ISPVTIDGRAVGWFGLGPVAVLPDRQRRGIGGALVRTGLDRLRNQGARGCVVLGGPGYYR 124

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           + GF       L  P        + L    ++   
Sbjct: 125 RFGF--AADAQLRYP-DAPAPYFMRLAFGPDIPAG 156


>gi|329940678|ref|ZP_08289959.1| putative acetyltransferase [Streptomyces griseoaurantiacus M045]
 gi|329300739|gb|EGG44636.1| putative acetyltransferase [Streptomyces griseoaurantiacus M045]
          Length = 174

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 62/164 (37%), Gaps = 14/164 (8%)

Query: 34  FLERLEHDSSICAMHADS---FG-PG--RFVRAAVL-----LREQGMHDLSLSFLCAEG- 81
            L R E  + + A+ A +   F  PG  R      +     LR        LSF+     
Sbjct: 1   MLIRRETPADVPAVRAVTAAAFAKPGTPRPAVPVEVTLLDELRACEGWLPELSFVALGDR 60

Query: 82  KRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
             ++G V  T           LGP+ V P +Q +G G  L+   + AA+  G  ++ L+G
Sbjct: 61  DEVIGHVVCTRGRAGAAPVLGLGPLSVSPGHQGRGAGLALVHTVLGAADALGEPLVALLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV--QNVAQNI 183
             AYYS+ GF+A     +  P P          L       +  
Sbjct: 121 SPAYYSRFGFRAATDLGITPPDPAWGAFFQVRTLTAYDPALRGA 164


>gi|227824277|ref|ZP_03989109.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904776|gb|EEH90694.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 168

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 59/163 (36%), Gaps = 9/163 (5%)

Query: 35  LERLEHDSSICAMHADS--------FGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           + R   +    A+            +  G        LR+       L+ +     +  G
Sbjct: 1   MIRKVQEQDWTAIEDLVKQAFATASYSDGTEAALVARLRQGPAFLPDLALMAEREAKPAG 60

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            +  T   + + T   L P+ V P +Q  GIG  L+      A K G     ++GD A+Y
Sbjct: 61  FILFTKARVSQETILALAPLAVKPCFQKSGIGTALVKKGHTLAAKAGFAYAAVLGDPAFY 120

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            +LG++A     +  PA       + + L+ +    + G +  
Sbjct: 121 GRLGYEAAEKWGITPPAAFPKEYFMAIKLIPDA-APLAGTIVY 162


>gi|53723652|ref|YP_103097.1| acetyltransferase [Burkholderia mallei ATCC 23344]
 gi|67642005|ref|ZP_00440768.1| acetyltransferase, GNAT family [Burkholderia mallei GB8 horse 4]
 gi|121600444|ref|YP_993255.1| acetyltransferase [Burkholderia mallei SAVP1]
 gi|124385335|ref|YP_001029301.1| acetyltransferase [Burkholderia mallei NCTC 10229]
 gi|126448736|ref|YP_001080763.1| acetyltransferase [Burkholderia mallei NCTC 10247]
 gi|166998723|ref|ZP_02264577.1| acetyltransferase, GNAT family [Burkholderia mallei PRL-20]
 gi|254178672|ref|ZP_04885327.1| acetyltransferase, GNAT family [Burkholderia mallei ATCC 10399]
 gi|254200044|ref|ZP_04906410.1| acetyltransferase, GNAT family [Burkholderia mallei FMH]
 gi|254206379|ref|ZP_04912731.1| acetyltransferase, GNAT family [Burkholderia mallei JHU]
 gi|254358207|ref|ZP_04974480.1| acetyltransferase, GNAT family [Burkholderia mallei 2002721280]
 gi|52427075|gb|AAU47668.1| acetyltransferase, GNAT family [Burkholderia mallei ATCC 23344]
 gi|121229254|gb|ABM51772.1| acetyltransferase, GNAT family [Burkholderia mallei SAVP1]
 gi|124293355|gb|ABN02624.1| acetyltransferase, GNAT family [Burkholderia mallei NCTC 10229]
 gi|126241606|gb|ABO04699.1| acetyltransferase, GNAT family [Burkholderia mallei NCTC 10247]
 gi|147749640|gb|EDK56714.1| acetyltransferase, GNAT family [Burkholderia mallei FMH]
 gi|147753822|gb|EDK60887.1| acetyltransferase, GNAT family [Burkholderia mallei JHU]
 gi|148027334|gb|EDK85355.1| acetyltransferase, GNAT family [Burkholderia mallei 2002721280]
 gi|160699711|gb|EDP89681.1| acetyltransferase, GNAT family [Burkholderia mallei ATCC 10399]
 gi|238523046|gb|EEP86487.1| acetyltransferase, GNAT family [Burkholderia mallei GB8 horse 4]
 gi|243065077|gb|EES47263.1| acetyltransferase, GNAT family [Burkholderia mallei PRL-20]
          Length = 177

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 71/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRVDGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPRPA-GELRYHA 173


>gi|53719053|ref|YP_108039.1| putative acetyltransferase [Burkholderia pseudomallei K96243]
 gi|76808669|ref|YP_333856.1| acetyltransferase [Burkholderia pseudomallei 1710b]
 gi|126453828|ref|YP_001066605.1| acetyltransferase [Burkholderia pseudomallei 1106a]
 gi|167845285|ref|ZP_02470793.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           B7210]
 gi|226197415|ref|ZP_03792992.1| acetyltransferase, gnat family [Burkholderia pseudomallei Pakistan
           9]
 gi|242315198|ref|ZP_04814214.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1106b]
 gi|254189168|ref|ZP_04895679.1| acetyltransferase, GNAT family [Burkholderia pseudomallei Pasteur
           52237]
 gi|254198286|ref|ZP_04904708.1| acetyltransferase, GNAT family [Burkholderia pseudomallei S13]
 gi|254258432|ref|ZP_04949486.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1710a]
 gi|254297326|ref|ZP_04964779.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 406e]
 gi|52209467|emb|CAH35419.1| putative acetyltransferase [Burkholderia pseudomallei K96243]
 gi|76578122|gb|ABA47597.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1710b]
 gi|126227470|gb|ABN91010.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1106a]
 gi|157807072|gb|EDO84242.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 406e]
 gi|157936847|gb|EDO92517.1| acetyltransferase, GNAT family [Burkholderia pseudomallei Pasteur
           52237]
 gi|169655027|gb|EDS87720.1| acetyltransferase, GNAT family [Burkholderia pseudomallei S13]
 gi|225930794|gb|EEH26804.1| acetyltransferase, gnat family [Burkholderia pseudomallei Pakistan
           9]
 gi|242138437|gb|EES24839.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1106b]
 gi|254217121|gb|EET06505.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1710a]
          Length = 177

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 71/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPRPA-GALRYHA 173


>gi|302529975|ref|ZP_07282317.1| hypothetical protein SSMG_06358 [Streptomyces sp. AA4]
 gi|302438870|gb|EFL10686.1| hypothetical protein SSMG_06358 [Streptomyces sp. AA4]
          Length = 194

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 60/173 (34%), Gaps = 14/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR-----------FVRAAVLLREQGMHDLSLSFLCAE 80
           +    R    +   A+HA      R             +    L   G    +LS +   
Sbjct: 18  SDMQIRQSTTADAPAIHAVHTAAFRVHNPHVTGEMPEAKLVTELTADGDLLPALSLVALR 77

Query: 81  GKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
              ++G    +P  +          GP+ VHP +   G G  L+  ++ AA   G  +IV
Sbjct: 78  DGEVIGHACSSPGRLGDDPESAIGFGPLGVHPDHHRSGAGSALVHATIGAANALGYGLIV 137

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L+GD  YYS+ GF       +  P P        LPL     +N  G  R   
Sbjct: 138 LLGDPGYYSRFGFVLAEKLGVTPPVPEWAPHFQALPLAAYTPEN-HGAFRYAA 189


>gi|238760229|ref|ZP_04621374.1| acetyltransferase [Yersinia aldovae ATCC 35236]
 gi|238701552|gb|EEP94124.1| acetyltransferase [Yersinia aldovae ATCC 35236]
          Length = 159

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 57/155 (36%), Gaps = 5/155 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   +F   R   A ++ + +    L+L  +  +    +VG    +P+ +   
Sbjct: 2   DAPGIDALLRQAFK--RDDEAELVQQLREDGLLTLGIVATDDEGGVVGYAAFSPVDVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + +G+  KL+   +D+  + G   +V++G+  YY + GF     
Sbjct: 60  DRQWVALAPLAVDETLRRQGLAEKLVYEGLDSLNEFGYAAVVVLGEPGYYQRFGFVPAAR 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             L    P          L ++      G V    
Sbjct: 120 HQLTCRWPGTEAAFQVYALAEDALTGADGEVVFSA 154


>gi|330862009|emb|CBX72177.1| uncharacterized N-acetyltransferase yhbS [Yersinia enterocolitica
           W22703]
          Length = 167

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 59/163 (36%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   +F           LRE     L+L  +  +    +VG   
Sbjct: 1   MLIRVEIPVDAPGIDALLRKAFKGDDEAELVQQLRE--DGLLTLGIVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ +         L P+ V    + + +  KL+   +D+  + G   +V++GD AYY 
Sbjct: 59  FSPVDVGGEDRQWVALAPLAVEEGLRRQRLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQ 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           + GF       L    P          L ++   +  G V   
Sbjct: 119 RFGFVPAARHQLTCRWPDTEEAFQVYALAEDALTDADGEVVFS 161


>gi|255691498|ref|ZP_05415173.1| acetyltransferase [Bacteroides finegoldii DSM 17565]
 gi|260622889|gb|EEX45760.1| acetyltransferase [Bacteroides finegoldii DSM 17565]
          Length = 215

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 63/173 (36%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       F PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQPSDYNETENVTREAFWNHFSPGCDEHYLLHIMRNHPKFVPELDIVAELNGK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ KGIGRK+I+++ + A   G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQKGIGRKMIALTQERAFDMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  N   N KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVYELYDNALANAKG--RYIE 171


>gi|303256744|ref|ZP_07342758.1| acetyltransferase, GNAT family [Burkholderiales bacterium 1_1_47]
 gi|302860235|gb|EFL83312.1| acetyltransferase, GNAT family [Burkholderiales bacterium 1_1_47]
          Length = 180

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 57/161 (35%), Gaps = 9/161 (5%)

Query: 38  LEHDSSICAMHADSFG---PGRFVRAAVLLREQGMH--DLSLSFLCAEGKRIVGSVRMTP 92
                +IC +  ++F            ++ R          LS     G   VG + +T 
Sbjct: 13  PHDLPAICRLIEEAFATVQESDHREQFLVKRLLSSPGFIPELSLTAWIGSEFVGYILLTE 72

Query: 93  I----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           I        I    L  + V P +Q +GIG  LI  +   A +   + ++++G   YY +
Sbjct: 73  IEILSKAGSIPTLSLASLAVRPDFQRQGIGAALIEEAHKHAAELNFETVLVLGHKHYYPR 132

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            G++      ++ P  V P   +   L    A      V+ 
Sbjct: 133 FGYRRAEDFGIVFPFEVQPEFCMVKELTPGAASRAADQVKY 173


>gi|282916130|ref|ZP_06323893.1| acetyltransferase [Staphylococcus aureus subsp. aureus D139]
 gi|283769949|ref|ZP_06342841.1| acetyltransferase [Staphylococcus aureus subsp. aureus H19]
 gi|282320078|gb|EFB50425.1| acetyltransferase [Staphylococcus aureus subsp. aureus D139]
 gi|283460096|gb|EFC07186.1| acetyltransferase [Staphylococcus aureus subsp. aureus H19]
          Length = 176

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 58/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  K    I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKRYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEVFLIKELKVNSLAGKTGTINY 169


>gi|325289064|ref|YP_004265245.1| GCN5-related N-acetyltransferase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964465|gb|ADY55244.1| GCN5-related N-acetyltransferase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 235

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 62/165 (37%), Gaps = 13/165 (7%)

Query: 34  FLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              RLE  +    +   +       + PG        ++R+ G     L  +      IV
Sbjct: 17  IKLRLEQPADYRKVEELTREAFWNHYVPGCNEHYLLHIMRDCGAFIRELDTVAEIDGEIV 76

Query: 86  GSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G++  T   I    G        GP+ V P  +  GIG  LI  ++  A++ G   +++ 
Sbjct: 77  GNIVYTKGKILGDDGISREVLSFGPVSVLPALKAAGIGSALIEYTLARAKESGHGAVLIY 136

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           GD AYY + GF +     +     +    +  L L +   +  KG
Sbjct: 137 GDPAYYQRFGFISAETFGIGTADNMYAQPLQALELREGTLRGCKG 181


>gi|323438642|gb|EGA96386.1| acetyltransferase [Staphylococcus aureus O11]
          Length = 176

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAHVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYTNLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|257469851|ref|ZP_05633943.1| GCN5-related N-acetyltransferase [Fusobacterium ulcerans ATCC
           49185]
 gi|317064080|ref|ZP_07928565.1| acetyltransferase [Fusobacterium ulcerans ATCC 49185]
 gi|313689756|gb|EFS26591.1| acetyltransferase [Fusobacterium ulcerans ATCC 49185]
          Length = 219

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 61/171 (35%), Gaps = 21/171 (12%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFV----------RAA--VLLREQGMHDLSLSFLCA 79
                RLE  +    +        R                   LR+  +    L+F+  
Sbjct: 1   MKLEIRLEEKNDYRKVEEMV----REAFWNLYVLGASEHFIPYYLRDSEVTIPELNFVAV 56

Query: 80  EGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           +   IVG +  T   +    G        GP+ V P Y N GIG+ LI  S   A + G 
Sbjct: 57  KDGEIVGYIFYTKAEVRDKNGKAHEILNFGPLCVDPKYHNLGIGKALIEHSKKTAAEMGY 116

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           + I + G   YY+++GFQ+     +     V    +L + L     + I G
Sbjct: 117 KGIAIYGYPGYYTRVGFQSAAKFGIARADGVFVKALLAMELYPGSLEGISG 167


>gi|330817337|ref|YP_004361042.1| acetyltransferase [Burkholderia gladioli BSR3]
 gi|327369730|gb|AEA61086.1| acetyltransferase [Burkholderia gladioli BSR3]
          Length = 174

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 8/143 (5%)

Query: 53  GPGRF-VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT----GHLLGPIV 107
            PG+      ++   +    LSLS +      +VG +  +PI IE         +L P+ 
Sbjct: 31  APGQGVTEHRIVAALRAAGALSLSLVAERDGAMVGHLAFSPIRIEGAEAAAGWFVLAPVS 90

Query: 108 VHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDP 167
           V P  Q +GIG  LI  ++    ++G+   V++GD AYY++ GF      S+     V  
Sbjct: 91  VSPACQRQGIGASLIEAALPMMRERGAAGAVVLGDPAYYTRFGFHHAHRLSV---PDVPA 147

Query: 168 NRVLFLPLVQNVAQNIKGIVRCR 190
              +        A    G+V+  
Sbjct: 148 EYFMAQFFQGETAAIPAGVVQFH 170


>gi|90581539|ref|ZP_01237332.1| putative acetyltransferase [Vibrio angustum S14]
 gi|90437301|gb|EAS62499.1| putative acetyltransferase [Vibrio angustum S14]
          Length = 167

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 61/162 (37%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I     +    F       A +++  +   + +LS +   +   +VG   
Sbjct: 1   MLIRSEAPADILTIDTLLKAVF--PTDAEAKLVMALRENGNRTLSLVACNDEGEVVGYAF 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++  +      L P+ V   YQN+GI   L+  +          VIV VGD  YY 
Sbjct: 59  FSPVTVNGVDTNWQGLAPLAVRDDYQNQGIALTLLEEAKSVLADFDYPVIVAVGDPEYYE 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           K GF+      L    P   N  +   ++       +G V  
Sbjct: 119 KAGFKKAVDHQLTATLPDTENTFMVYEVLPESVAQYQGKVEY 160


>gi|300868974|ref|ZP_07113578.1| GCN5-related N-acetyltransferase [Oscillatoria sp. PCC 6506]
 gi|300333041|emb|CBN58770.1| GCN5-related N-acetyltransferase [Oscillatoria sp. PCC 6506]
          Length = 171

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 61/159 (38%), Gaps = 7/159 (4%)

Query: 38  LEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94
            E D  + A+ A    +FG         ++R+       LS +  E    +  +  T ++
Sbjct: 6   AETDKDVPAIRALLIAAFGGIGEAELVEVIRKYPNFIPELSLVAREDGEAIAHILFTSLA 65

Query: 95  IEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           IE          L P+ V P  Q +GIG +L+   +    + G  ++V+VG+  YY   G
Sbjct: 66  IEGRDRTFGALALAPLAVAPQRQRQGIGSQLVEFGLSKCRELGHGIVVVVGEPEYYQPFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           FQ      L     +     +   L      ++ G+V  
Sbjct: 126 FQRASQFGLTPSLELPDEVFMVAELYPGALTDVSGLVSY 164


>gi|313158286|gb|EFR57688.1| acetyltransferase, GNAT family [Alistipes sp. HGB5]
          Length = 185

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 67/176 (38%), Gaps = 14/176 (7%)

Query: 29  KIGAFFLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
            +    + R    + + A+   H   FG  +       L      + ++S L       V
Sbjct: 1   MMSGEIVIRETVPADLAAIVEVHKKGFGYDKEAGLTAELLSDPTAEPTVSLLALRDGEAV 60

Query: 86  GSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           G +  T   I          ++L P+ V P  Q +G+G  LI+  +    ++G++++ ++
Sbjct: 61  GHILFTRCRIVGAEVQRPLFYILAPLAVVPSCQKQGVGGLLIAEGLQLLRERGAKLVFVL 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVD-----PNRVLFLPLVQNVAQNIKGIVRCRE 191
           G   YY + GF     + L  PAP        +  +   L  +     KG V C +
Sbjct: 121 GHKEYYPRHGFIP-GAEKLGFPAPYPILEKHADYWMAQALTDDGFSGPKGRVVCAD 175


>gi|117164833|emb|CAJ88382.1| putative acetyltransferase [Streptomyces ambofaciens ATCC 23877]
          Length = 211

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 61/162 (37%), Gaps = 6/162 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVR-AAVLLREQGMHDL---SLSFLCAEGK-RIVGSVR 89
             R E  + + A+             AA++   +   +     LS +  +   R VG   
Sbjct: 47  TTRAETGADVPAVRDIVRAAFPTAEEAALVDALRADPEAWIEGLSLVAVDDDDRPVGHAL 106

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           +T   I +     L P+ V P  Q  G G   +  ++DAA ++G + +V++G   YY + 
Sbjct: 107 LTRCHIGESPALCLAPVAVRPERQRSGAGSAAVRAALDAAGRRGERHVVVLGHPEYYPRF 166

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           GF       + +   V    ++ L L         G VR   
Sbjct: 167 GFGRASAHGIRVTFDVPDEALMALTL-DAAHPLPAGTVRYAA 207


>gi|309812419|ref|ZP_07706174.1| acetyltransferase, GNAT family [Dermacoccus sp. Ellin185]
 gi|308433724|gb|EFP57601.1| acetyltransferase, GNAT family [Dermacoccus sp. Ellin185]
          Length = 207

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 12/149 (8%)

Query: 53  GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLY 112
            PG        LRE   +D   +F+  +G RIVG V  T   ++      LGP+ V P  
Sbjct: 41  APGEATLVGW-LRESASYDPRFAFVALDGDRIVGHVMATGGDLDGAPTLGLGPLSVEPSR 99

Query: 113 QNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLF 172
           Q +GIG +L+  ++ AA + G+ VIVL+G   Y+++LGF       +    P        
Sbjct: 100 QGQGIGSRLMGATLGAARQAGASVIVLLGGPGYHARLGFVPAADLGISA-DPSWGEFFQA 158

Query: 173 LPLVQN----------VAQNIKGIVRCRE 191
            PL                  +G++   E
Sbjct: 159 RPLADGWGRDGDAESQAHAGPRGVITYPE 187


>gi|167918547|ref|ZP_02505638.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           BCC215]
          Length = 177

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRVDGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++      G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPCPA-GALRYHA 173


>gi|257415913|ref|ZP_05592907.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257157741|gb|EEU87701.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
          Length = 198

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESDDFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGVGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|298482828|ref|ZP_07001011.1| acetyltransferase, GNAT family protein [Bacteroides sp. D22]
 gi|295083880|emb|CBK65403.1| Predicted acetyltransferase [Bacteroides xylanisolvens XB1A]
 gi|298271028|gb|EFI12606.1| acetyltransferase, GNAT family protein [Bacteroides sp. D22]
          Length = 215

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 62/173 (35%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       F PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQPSDYNETENVTREAFWNHFSPGCDEHYLLHIMRNHPKFVPELDIVAELNGK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ KGIG K+I+++ + A   G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQKGIGGKMIALTKERAFDMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  N   N KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVYELYDNALANAKG--RYIE 171


>gi|255976033|ref|ZP_05426619.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|257086641|ref|ZP_05581002.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|307279112|ref|ZP_07560170.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0860]
 gi|255968905|gb|EET99527.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256994671|gb|EEU81973.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|306504237|gb|EFM73449.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0860]
 gi|315027468|gb|EFT39400.1| acetyltransferase, GNAT family [Enterococcus faecalis TX2137]
 gi|315169976|gb|EFU13993.1| acetyltransferase, GNAT family [Enterococcus faecalis TX1342]
          Length = 198

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGVGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|229550218|ref|ZP_04438943.1| acetyltransferase [Enterococcus faecalis ATCC 29200]
 gi|255972995|ref|ZP_05423581.1| predicted protein [Enterococcus faecalis T1]
 gi|256962111|ref|ZP_05566282.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|257422818|ref|ZP_05599808.1| acetyltransferase [Enterococcus faecalis X98]
 gi|293383136|ref|ZP_06629053.1| acetyltransferase, GNAT family [Enterococcus faecalis R712]
 gi|293387711|ref|ZP_06632256.1| acetyltransferase, GNAT family [Enterococcus faecalis S613]
 gi|312907276|ref|ZP_07766267.1| acetyltransferase, GNAT family [Enterococcus faecalis DAPTO 512]
 gi|312909894|ref|ZP_07768742.1| acetyltransferase, GNAT family [Enterococcus faecalis DAPTO 516]
 gi|312952293|ref|ZP_07771168.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0102]
 gi|229304656|gb|EEN70652.1| acetyltransferase [Enterococcus faecalis ATCC 29200]
 gi|255964013|gb|EET96489.1| predicted protein [Enterococcus faecalis T1]
 gi|256952607|gb|EEU69239.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|257164642|gb|EEU94602.1| acetyltransferase [Enterococcus faecalis X98]
 gi|291079475|gb|EFE16839.1| acetyltransferase, GNAT family [Enterococcus faecalis R712]
 gi|291082900|gb|EFE19863.1| acetyltransferase, GNAT family [Enterococcus faecalis S613]
 gi|310626304|gb|EFQ09587.1| acetyltransferase, GNAT family [Enterococcus faecalis DAPTO 512]
 gi|310629677|gb|EFQ12960.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0102]
 gi|311289852|gb|EFQ68408.1| acetyltransferase, GNAT family [Enterococcus faecalis DAPTO 516]
 gi|315153256|gb|EFT97272.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0031]
 gi|315155966|gb|EFT99982.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0043]
 gi|315157864|gb|EFU01881.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0312]
          Length = 198

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGVGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|134277154|ref|ZP_01763869.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 305]
 gi|134250804|gb|EBA50883.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 305]
          Length = 177

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 71/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   ++A  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLNALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPRPA-GALRYHA 173


>gi|310827708|ref|YP_003960065.1| acetyltransferase [Eubacterium limosum KIST612]
 gi|308739442|gb|ADO37102.1| acetyltransferase [Eubacterium limosum KIST612]
          Length = 225

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 68/173 (39%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMH---ADSF----GPGRFV-RAAVLLREQGMHDLSLSFLCAEGKR 83
                R E             ++F     PG F      ++R        LSF+     +
Sbjct: 11  MEIELRCEQTKDYRETETVTREAFWNHDAPGCFEHYLVHIMRNSPAFLPELSFVAVFDGK 70

Query: 84  IVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+G+V      IE   G       LGPI V P +Q KGIGRKL+  +   A K G + I+
Sbjct: 71  IIGNVMCMESIIEGDDGKVYKILTLGPISVLPEHQQKGIGRKLLEKTKATAHKMGYRAIL 130

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY+K GF      ++     +    +    L  +  + I+G  R  E
Sbjct: 131 LYGDPDYYTKQGFVPAEKYNIRTVDNMYAIALQACELYADALKGIQG--RFVE 181


>gi|238783505|ref|ZP_04627527.1| acetyltransferase [Yersinia bercovieri ATCC 43970]
 gi|238715560|gb|EEQ07550.1| acetyltransferase [Yersinia bercovieri ATCC 43970]
          Length = 159

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 56/155 (36%), Gaps = 5/155 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   SF           LRE     L+L  +  +    +VG    +P+ +   
Sbjct: 2   DAPGIDALLRHSFESNDEAELVQQLRE--DGLLTLGIVATDDEGGVVGYAAFSPVEVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + +G+  KL+   +D+  + G   +V++GD AYY + GF     
Sbjct: 60  DRQWVALAPLAVDESLRRQGLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQRFGFVPAAR 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             L    P          L ++   +  G V    
Sbjct: 120 HQLSCRWPGTEEAFQVYALAEDALTDADGEVVFSA 154


>gi|237713586|ref|ZP_04544067.1| acetyltransferase [Bacteroides sp. D1]
 gi|262406316|ref|ZP_06082865.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294646559|ref|ZP_06724195.1| acetyltransferase, GNAT family [Bacteroides ovatus SD CC 2a]
 gi|294806624|ref|ZP_06765458.1| acetyltransferase, GNAT family [Bacteroides xylanisolvens SD CC 1b]
 gi|229446308|gb|EEO52099.1| acetyltransferase [Bacteroides sp. D1]
 gi|262355019|gb|EEZ04110.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292638082|gb|EFF56464.1| acetyltransferase, GNAT family [Bacteroides ovatus SD CC 2a]
 gi|294446160|gb|EFG14793.1| acetyltransferase, GNAT family [Bacteroides xylanisolvens SD CC 1b]
          Length = 215

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 62/173 (35%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       F PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQPSDYNETENVTREAFWNHFSPGCDEHYLLHIMRNHPKFVPELDIVAELNGK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ KGIG K+I+++ + A   G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQKGIGGKMIALTKERAFDMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  +   N KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVCELYDDALANAKG--RYIE 171


>gi|333027341|ref|ZP_08455405.1| putative acetyltransferase [Streptomyces sp. Tu6071]
 gi|332747193|gb|EGJ77634.1| putative acetyltransferase [Streptomyces sp. Tu6071]
          Length = 179

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 6/160 (3%)

Query: 37  RLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMH---DLSLSFLCAE-GKRIVGSVRMT 91
           R E  + + A+HA +         A ++   +         LS++  +   R  G   +T
Sbjct: 17  RPETPADVAAVHALNAAAFPTPAEADLVDALRADPGAWLDGLSYVSCDADGRPTGYALLT 76

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              I       L P  V P  Q +G G   I   + AA  +G + +V++G  +YY + GF
Sbjct: 77  RCHIGGTPALCLAPCAVRPDRQREGAGSAAIRAVLTAAAARGEKHVVVLGHASYYPRFGF 136

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                  + L   V  + ++ L L   V     G VR   
Sbjct: 137 TRASAHGIRLGIDVPDDSLMALSLDPAVPLPA-GTVRYAA 175


>gi|310766262|gb|ADP11212.1| putative acetyltransferase YhbS [Erwinia sp. Ejp617]
          Length = 167

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 64/164 (39%), Gaps = 8/164 (4%)

Query: 34  FLERLE---HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E     +SI A+   SF           LRE     L+L  +  +   +++G   
Sbjct: 1   MLIRTEIGIDAASIDALLLRSFPTSAEAELVRQLREG--GLLTLGVVATDDEGQVLGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++        L P+ V    + +G+G +LI   +D   + G   +V++GD AYY 
Sbjct: 59  FSPVTLDGEDRQWVGLAPLAVDESVRKQGLGSRLIYEGLDTLNEFGYAAVVVLGDSAYYG 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF+      L               L  +V   I G +    
Sbjct: 119 RCGFKTAAHCQLHCRREGTEQAFQVYKLADDVCNGIAGNIEYSA 162


>gi|300214959|gb|ADJ79375.1| Acetyltransferase [Lactobacillus salivarius CECT 5713]
          Length = 207

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 66/176 (37%), Gaps = 18/176 (10%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAE 80
           +    + RLE+      +   +       + PG      +L   R++      L ++  +
Sbjct: 1   MENNIIIRLENKEEWKQVENLTREAFWNKYHPG-CSEHYILHKFRKRSDFVKELDYVVEK 59

Query: 81  GKRIVGSVRMT-----PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
              ++  +          + + ++    GP+ V P YQ KG G KLI  ++  A+K G  
Sbjct: 60  DGEVIAHIMYCNSKIQCDNGDFVSVMTFGPVSVLPKYQGKGYGSKLIKFTMGKAKKLGCG 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLIL-PAPVDPN--RVLFLPLVQNVAQNIKGIVR 188
            + + GD  YY K GF +    ++   P P +      +   L       + G  +
Sbjct: 120 ALAITGDPKYYRKFGFVSGHSMNIYYDPFPRNEEIPFFMVKELQSGYLSGVIGTFK 175


>gi|315174383|gb|EFU18400.1| acetyltransferase, GNAT family [Enterococcus faecalis TX1346]
          Length = 198

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 56/146 (38%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
             + G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GNLTGHIMSSKAKLRLPDHTEKAVLTIGPLSVHPEVQNTGVGSALIKHSVQKAKELGVGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|222081177|ref|YP_002540540.1| acetyltransferase protein [Agrobacterium radiobacter K84]
 gi|221725856|gb|ACM28945.1| acetyltransferase protein [Agrobacterium radiobacter K84]
          Length = 164

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 67/160 (41%), Gaps = 19/160 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E    + A+H  ++   +           +L   +   DL++S +  E  +I+G 
Sbjct: 1   MLIRHETPEDVDAIHDLTWTAFKPMPFSDDTEVDILRALRASGDLAISLVAEEDGKILGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  + + I+ +      LGPI V P  Q +GIG+ LI+  ++  +  G+    L+G+   
Sbjct: 61  VAFSRVKIDGVDNGWFGLGPISVAPERQRQGIGKALIAKGLELLDGMGASGCALIGNPDV 120

Query: 146 YSKLGFQAVPW-----------KSLILPAPVDPNRVLFLP 174
           Y   GF++              +  +L  P+    + F P
Sbjct: 121 YRHAGFESDGRLTYQDLDTKYVQRFVLRGPIPSGALQFAP 160


>gi|73671154|ref|YP_307169.1| acetyltransferase [Methanosarcina barkeri str. Fusaro]
 gi|72398316|gb|AAZ72589.1| acetyltransferase [Methanosarcina barkeri str. Fusaro]
          Length = 212

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 65/165 (39%), Gaps = 15/165 (9%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
              + R E       +   +       + PG        ++R+       L F+      
Sbjct: 1   MDIIIRNEKVEDFNQVENLTREAFWNLYVPGCNEHYLVHIMRDHPDFIKKLDFVAEYNGE 60

Query: 84  IVGSVRMTPISIEKITGHLL-----GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+G++  T   +    G  +     GPI V P YQ KG+G  LI  ++D A+  G  VIV
Sbjct: 61  IIGNIMYTKAWLYSEDGVKIEIASFGPISVLPKYQRKGVGSALIHHTIDIAKNDGINVIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLI-LPAPVDPNRVLFLPLVQNVAQN 182
           + GD   Y K GF++    ++  +        +L L L + V + 
Sbjct: 121 IFGDPHNYCKHGFKSSKDFNISDMTGEYPY-GMLALELKEGVVKG 164


>gi|332707145|ref|ZP_08427203.1| putative acetyltransferase [Lyngbya majuscula 3L]
 gi|332354170|gb|EGJ33652.1| putative acetyltransferase [Lyngbya majuscula 3L]
          Length = 181

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 59/155 (38%), Gaps = 10/155 (6%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDL------SLSFLCAEGKRIVG 86
             + R        ++ +            ++               +LS +  +  +I+G
Sbjct: 5   NMIIRDAEIRDRESVRSLHMSAFPTGEGDLVASLADDLISNITEPCTLSLVAVDDNKIIG 64

Query: 87  SVRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +V  +P+ I +     G++L P+ V P  Q  GIG +LI   +         ++ + GD 
Sbjct: 65  NVAYSPVFISEKQDFHGYILAPLAVKPECQGNGIGSQLIDAGIKRLRSMNVNIVFVYGDP 124

Query: 144 AYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQ 177
            YY + GF+A      I P P+  P     L L +
Sbjct: 125 RYYQRFGFKAELATHFIPPYPLQWPFGWQALLLGE 159


>gi|254439936|ref|ZP_05053430.1| acetyltransferase, GNAT family [Octadecabacter antarcticus 307]
 gi|198255382|gb|EDY79696.1| acetyltransferase, GNAT family [Octadecabacter antarcticus 307]
          Length = 163

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 9/156 (5%)

Query: 35  LERLEHDSSICAMHA---DSFGPGRFV---RAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
             R E D+ I A+      +F    +     A +L   +    L LS +      I+G V
Sbjct: 4   KIRQEADADIDAITDIVNRAFAGKAYAGGDEADILNGLRDGGGLVLSLVAVLKGNIIGQV 63

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            ++P  I       +GP+ V P +Q +G+G  L+  ++  A+      IVL GD  YY++
Sbjct: 64  ALSPAKIGTQRYLCVGPLSVTPQHQGQGVGSALMGHALGVAQSLHRDGIVLAGDANYYAR 123

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            GF+     S+  P  +  + +L LP     A  + 
Sbjct: 124 FGFEKAA--SVTHPGKL-ADHILVLPFTGAPAGGVT 156


>gi|325675748|ref|ZP_08155432.1| GNAT family acetyltransferase [Rhodococcus equi ATCC 33707]
 gi|325553719|gb|EGD23397.1| GNAT family acetyltransferase [Rhodococcus equi ATCC 33707]
          Length = 169

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 54/161 (33%), Gaps = 6/161 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVR-AAVLLREQGMHD--LSLSFLCAE-GKRIVGSVRM 90
             R E D+   A+             A ++   +        LS L  +     VG   +
Sbjct: 6   TTRPESDTDSDAVRRILLAAFDTAEEADLVDALRRDPAWVDGLSILTVDADGEPVGFALL 65

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T   I       L P  V P YQ  G G   I   + AA+++G   + ++G   YY + G
Sbjct: 66  TRCHIGDTPALCLAPCAVLPQYQRTGAGSAAIRAVLGAAKQRGEHFVTVLGHPEYYPRFG 125

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           F       + +   V  + ++ L L         G +    
Sbjct: 126 FTRASAHDVRMNVVVPEDALMVLALDGRPIPG--GTITYAA 164


>gi|170703396|ref|ZP_02894174.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria IOP40-10]
 gi|170131695|gb|EDT00245.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria IOP40-10]
          Length = 180

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 65/169 (38%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    + A+                    ++   +    L +S +    +R +G 
Sbjct: 11  VTLRDERAGDVDAIGRVIVAAFADEPQHGQLERQIVDALRADGALGVSLVAERDERAIGH 70

Query: 88  VRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           V  +P+SI          + L P+ V P  + + IG  L+   +DA  + G++  V++GD
Sbjct: 71  VAFSPVSIGGAPAGSHAWYGLAPLAVRPECRRQSIGAGLVRTGLDALRRLGARGCVVLGD 130

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            AYY++ GF  VP   L+  A       L L   +   +   G VR   
Sbjct: 131 PAYYARFGF--VPSDDLVF-ADAPREYFLALAFDEAAPRP-SGEVRYHA 175


>gi|296445814|ref|ZP_06887766.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
 gi|296256642|gb|EFH03717.1| GCN5-related N-acetyltransferase [Methylosinus trichosporium OB3b]
          Length = 166

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 56/158 (35%), Gaps = 11/158 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E      A+ +                 A++   +    L++S +  +   I+G 
Sbjct: 1   MLIRDEASGDHRAIRSVVDAAFESMPFSNKKEGALVDALRAAGALTMSLVAEDNDAIIGH 60

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           + ++P++I+        LGP+ V P  Q  G+G  LI  ++       +   V+ G  ++
Sbjct: 61  IAISPVTIDGAALGWFGLGPVAVLPERQRGGVGSALIDAALSRLRATAAAGCVVFGKPSF 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNI 183
           Y + GF+      L       P   + L          
Sbjct: 121 YERFGFRQ--QAGLRFAGG-PPELFMTLLFRSPAPIGA 155


>gi|283470080|emb|CAQ49291.1| acetyltransferase, gnat family [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 176

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 58/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L         G +  
Sbjct: 121 WPKYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVKSLAGKTGTINY 169


>gi|226360995|ref|YP_002778773.1| hypothetical protein ROP_15810 [Rhodococcus opacus B4]
 gi|226239480|dbj|BAH49828.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 169

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 61/163 (37%), Gaps = 8/163 (4%)

Query: 34  FLERLEHDSSICAM---HADSF--GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
            L R E+   + A+   H  +F       V     LR        L+ +      +VG V
Sbjct: 3   MLIRRENAGDVDAVAEVHRQAFDGNAPVEVELVTRLRSSDDWIPQLALVAEIDGTVVGHV 62

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            +T  +++      LGPI V P +Q  G+G  L+   +  A+ +   ++ L+G + YY +
Sbjct: 63  CLTRATVDATDVLALGPIGVLPGHQRDGVGSALMHAVLGGADARDEPLVALLGHLDYYPR 122

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN-IKGIVRCR 190
            GF +     +    P   +      L        + G  R  
Sbjct: 123 FGFVSGTSVGIEPDQPSWSSHFQVRRLA--CWDPAVTGTFRYA 163


>gi|167586944|ref|ZP_02379332.1| GCN5-related N-acetyltransferase [Burkholderia ubonensis Bu]
          Length = 180

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 59  RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE------KITGHLLGPIVVHPLY 112
              ++   +    LS+S +    +RI+G V  +P++I       +   + L P+ V P  
Sbjct: 42  EQRIVDALRAGGCLSVSLVAERDERIIGHVAFSPVTIGTVGDGGESGWYGLAPLAVLPDC 101

Query: 113 QNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLF 172
           Q + +G  L+   +DA  + G++  V++G+ AYY++ GF   P   ++ P    P  ++ 
Sbjct: 102 QRQSVGAGLVRTGLDALRRLGARGCVVLGEPAYYARFGF--GPAGDIVFPQ-APPEYLMV 158

Query: 173 LPLVQNVAQNIKGIVRCRE 191
           LP     A    G VR   
Sbjct: 159 LPF-DAAAPRPAGEVRYHA 176


>gi|298293625|ref|YP_003695564.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
 gi|296930136|gb|ADH90945.1| GCN5-related N-acetyltransferase [Starkeya novella DSM 506]
          Length = 173

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 62/150 (41%), Gaps = 11/150 (7%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
             L R E    I  +        R         A ++   +    L+LS +  E   +VG
Sbjct: 7   DMLIRNETVDDIPTISRLVTEAFRTLPQSTGTEARIIETLRAEGALALSLVAEEKGEVVG 66

Query: 87  SVRMTPISIEKITGH-LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            +  +   I    G  L+GP+ V P    +G+G  L++ ++       S+   LVG  AY
Sbjct: 67  HLAASAARIGTQDGWSLIGPLAVLPSRHRQGVGTALMTEALRQLRV-TSRGAALVGHPAY 125

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           Y + GF+A P  S+   A + P  VL LP 
Sbjct: 126 YGRFGFRAFPSLSV---AGIPPEVVLALPF 152


>gi|239631857|ref|ZP_04674888.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301066092|ref|YP_003788115.1| putative acetyltransferase [Lactobacillus casei str. Zhang]
 gi|239526322|gb|EEQ65323.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438499|gb|ADK18265.1| Predicted acetyltransferase [Lactobacillus casei str. Zhang]
          Length = 177

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 62/163 (38%), Gaps = 8/163 (4%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
             +    + + A+   +F     G          LR    +D +L  +      +VG   
Sbjct: 5   RIQQNDFADVDALLHAAFNASNRGYNGEAELVAGLRRDPNYDSALEVVAMMDGHLVGYGL 64

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           MT  SI       G  L P+ V P YQ  GIG  +++     A       + +VGD  ++
Sbjct: 65  MTAASITPDAHMQGVALAPLAVAPEYQGGGIGVAIVTELDMRATDLRRDFVSVVGDRQFF 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            +LGFQ      L  P PV     L   LV  V  +++G V  
Sbjct: 125 GRLGFQKAAKYKLDPPFPVVTEDHLIKELVPGVLASVRGKVNY 167


>gi|15923800|ref|NP_371334.1| hypothetical protein SAV0810 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926463|ref|NP_373996.1| hypothetical protein SA0741 [Staphylococcus aureus subsp. aureus
           N315]
 gi|148267246|ref|YP_001246189.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393295|ref|YP_001315970.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156979137|ref|YP_001441396.1| hypothetical protein SAHV_0806 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|253315154|ref|ZP_04838367.1| hypothetical protein SauraC_03088 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731418|ref|ZP_04865583.1| acetyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732765|ref|ZP_04866930.1| acetyltransferase [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005599|ref|ZP_05144200.2| hypothetical protein SauraM_03990 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794892|ref|ZP_05643871.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258418208|ref|ZP_05682473.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258421505|ref|ZP_05684430.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258439153|ref|ZP_05690197.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258440919|ref|ZP_05690754.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|258445749|ref|ZP_05693926.1| GNAT family acetyltransferase [Staphylococcus aureus A6300]
 gi|258449562|ref|ZP_05697664.1| GNAT family acetyltransferase [Staphylococcus aureus A6224]
 gi|258453962|ref|ZP_05701934.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|269202411|ref|YP_003281680.1| acetyltransferase [Staphylococcus aureus subsp. aureus ED98]
 gi|282895084|ref|ZP_06303305.1| acetyltransferase [Staphylococcus aureus A8117]
 gi|282926656|ref|ZP_06334286.1| acetyltransferase [Staphylococcus aureus A10102]
 gi|295406512|ref|ZP_06816318.1| acetyltransferase [Staphylococcus aureus A8819]
 gi|296276301|ref|ZP_06858808.1| acetyltransferase [Staphylococcus aureus subsp. aureus MR1]
 gi|297245237|ref|ZP_06929111.1| acetyltransferase [Staphylococcus aureus A8796]
 gi|13700677|dbj|BAB41974.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246579|dbj|BAB56972.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|147740315|gb|ABQ48613.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945747|gb|ABR51683.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156721272|dbj|BAF77689.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|253724868|gb|EES93597.1| acetyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729239|gb|EES97968.1| acetyltransferase [Staphylococcus aureus subsp. aureus TCH130]
 gi|257788864|gb|EEV27204.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257839001|gb|EEV63480.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257842431|gb|EEV66855.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257847725|gb|EEV71722.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257852433|gb|EEV76354.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|257855325|gb|EEV78263.1| GNAT family acetyltransferase [Staphylococcus aureus A6300]
 gi|257857070|gb|EEV79969.1| GNAT family acetyltransferase [Staphylococcus aureus A6224]
 gi|257863827|gb|EEV86583.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262074701|gb|ACY10674.1| acetyltransferase [Staphylococcus aureus subsp. aureus ED98]
 gi|282591549|gb|EFB96621.1| acetyltransferase [Staphylococcus aureus A10102]
 gi|282762580|gb|EFC02719.1| acetyltransferase [Staphylococcus aureus A8117]
 gi|285816489|gb|ADC36976.1| hypothetical protein SA2981_0765 [Staphylococcus aureus 04-02981]
 gi|294968657|gb|EFG44680.1| acetyltransferase [Staphylococcus aureus A8819]
 gi|297177908|gb|EFH37157.1| acetyltransferase [Staphylococcus aureus A8796]
 gi|312829279|emb|CBX34121.1| acetyltransferase (GNAT) family protein [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|329724553|gb|EGG61060.1| acetyltransferase, GNAT family [Staphylococcus aureus subsp. aureus
           21172]
          Length = 176

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLEIVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNGAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|167902278|ref|ZP_02489483.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 177

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 71/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRVDGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-ASPDALMALPFGEHAPRPA-GALRYHA 173


>gi|90962306|ref|YP_536222.1| acetyltransferase [Lactobacillus salivarius UCC118]
 gi|90821500|gb|ABE00139.1| Acetyltransferase [Lactobacillus salivarius UCC118]
          Length = 207

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 67/176 (38%), Gaps = 18/176 (10%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAE 80
           +    + RLE+      +   +       + PG      +L   R++      L ++  +
Sbjct: 1   MENNIIIRLENKEEWKQVENLTREAFWNKYHPG-CSEHYILHKFRKRSDFVKELDYVVEK 59

Query: 81  GKRIVGSVRMT-----PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
              ++ ++          + + ++    GP+ V P YQ KG G KLI  ++  A+K G  
Sbjct: 60  DGEVIANIMYCNSKIQCDNGDFVSVMTFGPVSVLPKYQGKGYGSKLIKFTMGKAKKLGCG 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLIL-PAPVDPN--RVLFLPLVQNVAQNIKGIVR 188
            + + GD  YY K GF +    ++   P P +      +   L       + G  +
Sbjct: 120 ALAITGDPKYYRKFGFVSGHSMNIYYDPFPRNEEIPFFMVKELQSGYLSGVIGTFK 175


>gi|82750495|ref|YP_416236.1| hypothetical protein SAB0743 [Staphylococcus aureus RF122]
 gi|82656026|emb|CAI80431.1| conserved hypothetical protein [Staphylococcus aureus RF122]
          Length = 176

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 59/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQTLEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPNEAFLIKELKVNSLAGKTGTINY 169


>gi|229827871|ref|ZP_04453940.1| hypothetical protein GCWU000182_03263 [Abiotrophia defectiva ATCC
           49176]
 gi|229788070|gb|EEP24184.1| hypothetical protein GCWU000182_03263 [Abiotrophia defectiva ATCC
           49176]
          Length = 208

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 65/169 (38%), Gaps = 16/169 (9%)

Query: 33  FFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRI 84
            ++ RLE +     +           + PG        +LR+       L F+  +   I
Sbjct: 5   DYIIRLEENKDYREVENLIRESFWNIYRPGCGEHYLIHVLRDDPAFVKELDFVMEKDGII 64

Query: 85  VGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G        I+   G       +GPI + P  + KG G+ L+  S++ A K G   ++ 
Sbjct: 65  IGQNMFMKTIIKADDGKTTEVLTMGPICIAPGLKRKGYGKILLDYSLEMAAKLGFGAVLF 124

Query: 140 VGDIAYYSKLGFQAVPWKSLI---LPAPVDPNRVLFLPLVQNVAQNIKG 185
            G+I +Y K GF       +    LPA  D +  L   L+     N+ G
Sbjct: 125 EGNIDFYGKSGFDYAKKFGISYNDLPADADTSFFLCKELIPGYLDNVTG 173


>gi|227535478|ref|ZP_03965527.1| possible acetyltransferase [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|227186888|gb|EEI66955.1| possible acetyltransferase [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
          Length = 177

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 62/163 (38%), Gaps = 8/163 (4%)

Query: 35  LERLEHDSSICAMHADSF-----GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
             +    + + A+   +F     G          LR    +D +L  +      +VG   
Sbjct: 5   RIQQNDFADVDALLHAAFNASNRGYNGEAELVAGLRRDPNYDSALEVVAMMDGHLVGYGL 64

Query: 90  MTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           MT  SI       G  L P+ V P YQ  GIG  +++     A       + +VGD  ++
Sbjct: 65  MTAASITPDAHMQGVALAPLAVAPEYQGGGIGVAIVTELDMRATDLRRDFVSVVGDRQFF 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            +LGFQ      L  P PV     L   LV  V  +++G V  
Sbjct: 125 GRLGFQKAAKYKLDPPFPVVTEDHLIKELVPGVLASVRGKVNY 167


>gi|253686997|ref|YP_003016187.1| GCN5-related N-acetyltransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753575|gb|ACT11651.1| GCN5-related N-acetyltransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 180

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 68/176 (38%), Gaps = 20/176 (11%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I ++   +F  G    A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLVRVEIPVDAAGIDSLLRRAFPTG--AEADLVHQLREDGLLTLGVVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ IE        L P+ V    + +G+G KL+   +DA  +     +V++G+ AYYS
Sbjct: 59  FSPVLIEGEDRQWVALAPLAVDESLRRQGVGEKLVYEGLDALNEFSYTAVVVLGEPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN------------VAQNIKGIVRCRE 191
           + GF       L    P   +     PL  N              +   G+V   E
Sbjct: 119 RFGFVPATEHQLHCRWPDSESTFQVYPLADNQVAGENSSEGESGFEQATGLVEYAE 174


>gi|225018853|ref|ZP_03708045.1| hypothetical protein CLOSTMETH_02803 [Clostridium methylpentosum
           DSM 5476]
 gi|224948413|gb|EEG29622.1| hypothetical protein CLOSTMETH_02803 [Clostridium methylpentosum
           DSM 5476]
          Length = 203

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 16/169 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL-LREQGMHDLSLSFLCAEGKRIV 85
              RLE      A+   +       + PG F    +  LR+       L ++     +I+
Sbjct: 1   MTIRLEEKKDYFAVENLTREAFWNVYQPGCFEHLVLHNLRDDACFVPELDYVVEIDGKII 60

Query: 86  GSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
            ++     ++E   G      L GP+ V P YQ KG G +LI  +++ A++ G   +V+ 
Sbjct: 61  ANIVYAKGNLELENGKTTELLLFGPVSVLPQYQKKGYGDQLIRFTLNKAKQMGYPAVVIT 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPN---RVLFLPLVQNVAQNIKGI 186
           G+  YY K GF++     L L            L   L  +   ++KGI
Sbjct: 121 GNPEYYKKFGFESASKYGLFLKGMDCKEDFPFFLIKVLDPDRVGSLKGI 169


>gi|323441966|gb|EGA99603.1| acetyltransferase [Staphylococcus aureus O46]
          Length = 176

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 61/169 (36%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R  G +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSGTYDNNLELVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++LI +    A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQVLEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKLNSLAGKTGTINY 169


>gi|227892279|ref|ZP_04010084.1| acetyltransferase [Lactobacillus salivarius ATCC 11741]
 gi|227865920|gb|EEJ73341.1| acetyltransferase [Lactobacillus salivarius ATCC 11741]
          Length = 180

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 18/174 (10%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAE 80
           +    + RLE+      +   +       + PG      +L   R++      L ++  +
Sbjct: 1   MENNIIIRLENKEEWKQVENLTREAFWNKYHPG-CSEHYILHKFRKRSDFVKELDYVIEK 59

Query: 81  GKRIVGSVRMT-----PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
              ++ ++          + + ++    GP+ V P YQ KG G KLI  ++  A+K G  
Sbjct: 60  DGEVIANIMYCNSKIQCDNGDFVSVMTFGPVSVLPKYQGKGYGSKLIKFTMGKAKKLGCG 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLIL-PAPVDPN--RVLFLPLVQNVAQNIKGI 186
            + + GD  YY K GF +    ++   P P +      +   L       + G 
Sbjct: 120 ALAITGDPKYYRKFGFVSGHSMNIYYDPFPRNEEIPFFMVKELQSGYLSGVIGT 173


>gi|332879280|ref|ZP_08446977.1| acetyltransferase, GNAT family [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332682700|gb|EGJ55600.1| acetyltransferase, GNAT family [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 178

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 63/174 (36%), Gaps = 12/174 (6%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHD--LSLSFLCAEG 81
           + A +  R E +     +        R           ++ R +        LS +    
Sbjct: 1   MKADYEIRQETEKDYPQVFKLVEEAFRDMKESDHREQFLVERLRHSPAFVPELSLVADGD 60

Query: 82  KRIVGSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
             +VG   MT +SI           L P+ V P  Q+ GIG  LI      A + G +  
Sbjct: 61  GGVVGYGLMTRVSIRSGKVDAESLALAPVAVRPDRQSMGIGSALIRELHARAARLGYKSA 120

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           V++G   +Y + G++      +     V     + + LV    ++I+G+V   E
Sbjct: 121 VVLGHEGFYPRFGYRKASDYGIAFLFEVPSECCMAVELVVGGLRDIRGVVCYPE 174


>gi|295115787|emb|CBL36634.1| Predicted acetyltransferase [butyrate-producing bacterium SM4/1]
          Length = 214

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 63/168 (37%), Gaps = 13/168 (7%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFV-RAAVLLREQGMHDLSLSFLCAEG 81
           +    + R E       +           + PG +    A +LR        L  +  + 
Sbjct: 1   MNREIIIRKEQPEDYLRVETIIRKAFWNLYVPGCYEHYLAHILRSHEDFIPELDLVIEKD 60

Query: 82  KRIVGSVRMTP---ISIEKITGHLL--GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
             ++GSV  T    I        +L  GPI + P YQ  G G++L+ +S   A + G + 
Sbjct: 61  GLVIGSVMYTKNRLIDENGAEKQILTFGPICIAPEYQRMGYGKELMEVSFQKAVQMGYEA 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +V+ G  A Y   GF++    ++ L   + P  +L   L        K
Sbjct: 121 VVIFGSPANYVSSGFKSCKKYNVCLEGDIWPAAMLVKELKPGALDGKK 168


>gi|319786017|ref|YP_004145492.1| GCN5-related N-acetyltransferase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464529|gb|ADV26261.1| GCN5-related N-acetyltransferase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 168

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 61/157 (38%), Gaps = 11/157 (7%)

Query: 34  FLERLEHDSSICAM---HADSFG--PGR-FVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    I A+      +F   PG   +   ++   +  + L++S +     R+ G 
Sbjct: 1   MWIREEGPEDIDAICTVLRKAFAKYPGEGKLETRIVDTLRADNALAVSLVADIDGRVAGH 60

Query: 88  VRMTPISI--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           +  +P     +    ++LGP+ V P  Q  G+   L+   +   + + +   V++GD AY
Sbjct: 61  IAFSPARPSRDGDGWYVLGPLAVDPADQGHGVRAALVRAGLAELQAREANGCVVLGDPAY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           Y + GF A P   L LP          L      +  
Sbjct: 121 YGRFGFMAEPA--LTLPG-APEGAFQALRFTDAASAG 154


>gi|253584238|ref|ZP_04861436.1| acetyltransferase [Fusobacterium varium ATCC 27725]
 gi|251834810|gb|EES63373.1| acetyltransferase [Fusobacterium varium ATCC 27725]
          Length = 197

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 62/168 (36%), Gaps = 15/168 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAV--LLREQGMHDLSLSFLCAEGK 82
                RLE       +           + PG      +   LR   +    L+F+  +  
Sbjct: 1   MKLEIRLEEKKDYRKVEEMIREAFWNLYVPGA-SEHFIPHYLRNSKITIPELNFVALKDG 59

Query: 83  RIVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
            IVG +  T       +         GP+ V P Y N GIGR LI  S   A + G + I
Sbjct: 60  EIVGQIFYTKAEVRDKNGNSHEILNFGPLCVDPKYHNLGIGRALIEHSKKVAAEMGYKGI 119

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
            + G   YY+++GFQ+     +     V    +L + L  +  + I G
Sbjct: 120 AIYGYPGYYTRVGFQSAAKFGIARADGVFVKALLVMELYPDSLKGISG 167


>gi|217421546|ref|ZP_03453050.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 576]
 gi|217395288|gb|EEC35306.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 576]
          Length = 177

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   ++A  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLNALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++      G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPCPA-GELRYHA 173


>gi|318058669|ref|ZP_07977392.1| acetyltransferase [Streptomyces sp. SA3_actG]
 gi|318079441|ref|ZP_07986773.1| acetyltransferase [Streptomyces sp. SA3_actF]
          Length = 168

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 60/160 (37%), Gaps = 6/160 (3%)

Query: 37  RLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMH---DLSLSFLCAE-GKRIVGSVRMT 91
           R E  + + A+HA +         A ++   +         LS++  +   R  G   +T
Sbjct: 6   RPETPADVAAVHALNAAAFPTPAEADLVDALRADPGAWLDGLSYVSCDADGRPAGYALLT 65

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              I       L P  V P  Q +G G   I   + AA  +G + +V++G  +YY + GF
Sbjct: 66  RCHIGGTPALCLAPCAVRPDRQREGAGPAAIRAVLTAAAARGEKHVVVLGHASYYPRFGF 125

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                  + L   V  + ++ L L         G VR   
Sbjct: 126 TRASAHGIRLGIDVPDDSLMALSLDPAGPLPA-GTVRYAA 164


>gi|114798503|ref|YP_759244.1| acetyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|114738677|gb|ABI76802.1| acetyltransferase, GNAT family [Hyphomonas neptunium ATCC 15444]
          Length = 162

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 5/147 (3%)

Query: 36  ERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
            R E+  +I A++  +F  G     A+        D  LS + +    IV  +    I I
Sbjct: 8   FRPEYLDAIVAVNDAAF--GGPDEGAITRALHADGDSVLSLVASGNIEIVAHIEFFRIWI 65

Query: 96  EKIT-GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
           +    G  LGP+ V P  QN GIG +LI + + A E  G  ++ ++G   YY K GF   
Sbjct: 66  DGAPVGVGLGPMSVLPELQNSGIGGRLIRLGLAALEGAGETLVFVLGHDTYYPKFGFSEA 125

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQ 181
             K    P        + L L +   +
Sbjct: 126 AAKPFSAPWSGP--HFMALRLGKGGPE 150


>gi|315129003|gb|EFT85000.1| hypothetical protein CGSSa03_14373 [Staphylococcus aureus subsp.
           aureus CGS03]
          Length = 176

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 58/169 (34%), Gaps = 13/169 (7%)

Query: 34  FLERLEHDSSIC--------AMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R  H             A      G G        +R    +D +L  +      +V
Sbjct: 1   MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLEIVAVLQNEVV 60

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++ + ++       G +L P+ V   +QNKGIG++ I      A  KG   I ++G
Sbjct: 61  GHGLLSEVYLDNGAQREIGLVLAPVSVDIHHQNKGIGKRSIQALEREAILKGYNFISVLG 120

Query: 142 DIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRC 189
              YY+ LG+Q      +  P   +     L   L  N      G +  
Sbjct: 121 WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINY 169


>gi|197106065|ref|YP_002131442.1| acetyltransferase, GNAT family [Phenylobacterium zucineum HLK1]
 gi|196479485|gb|ACG79013.1| acetyltransferase, GNAT family [Phenylobacterium zucineum HLK1]
          Length = 161

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 61/149 (40%), Gaps = 3/149 (2%)

Query: 35  LERLEHDSSICAMHADSFGPGR-FVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
           + R    S   A+        +    A ++   +   D+    +   G+ + G +  + +
Sbjct: 1   MIRHARPSDHGAVRQLVADAFQGETEARLVDLLRADGDVLFELVSLNGETVEGHILFSRM 60

Query: 94  SIEKITGHL-LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
             ++   +  LGP+ V P  Q  GIG  L+  +++ A + G + ++L+G  AYY + GF 
Sbjct: 61  WADRQGLYAALGPLAVRPDRQRTGIGSALVRAALETAREFGVEGVILLGHPAYYPRFGFS 120

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
               + +  P   +P   + L L      
Sbjct: 121 TQAARQVRSPYAGNP-AFMALALEPGAFD 148


>gi|238799402|ref|ZP_04642835.1| acetyltransferase [Yersinia mollaretii ATCC 43969]
 gi|238716754|gb|EEQ08637.1| acetyltransferase [Yersinia mollaretii ATCC 43969]
          Length = 159

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 58/155 (37%), Gaps = 5/155 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   SF       A ++ + +    L+L  +  +    +VG    +P+ +   
Sbjct: 2   DAPGIDALLRQSF--ESNDEADLVQQLREDGLLTLGIVATDDEGGVVGYAAFSPVEVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + +G+  KL+   +D+  + G   +V++GD AYY + GF     
Sbjct: 60  DRQWVALAPLAVEESLRRQGLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQRFGFVPAAR 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             L    P          L ++   +  G V    
Sbjct: 120 HQLSCRWPGTEEAFQVYALAEDALNDADGEVVFSA 154


>gi|254179443|ref|ZP_04886042.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1655]
 gi|184209983|gb|EDU07026.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 1655]
          Length = 177

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ AY
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAY 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF A     ++ P    P+ ++ LP  ++      G +R   
Sbjct: 132 YARFGFGAAG--DIVFPQ-APPDALMALPFGEHAPCPA-GELRYHA 173


>gi|283797236|ref|ZP_06346389.1| acetyltransferase [Clostridium sp. M62/1]
 gi|291075085|gb|EFE12449.1| acetyltransferase [Clostridium sp. M62/1]
 gi|295092398|emb|CBK78505.1| Predicted acetyltransferase [Clostridium cf. saccharolyticum K10]
          Length = 214

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 63/168 (37%), Gaps = 13/168 (7%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPGRFV-RAAVLLREQGMHDLSLSFLCAEG 81
           +    + R E       +           + PG +    A +LR        L  +  + 
Sbjct: 1   MNREIIIRKEQPEDYLRVETIIRKAFWNLYVPGCYEHYLAHILRSHEDFIPELDLVIEKD 60

Query: 82  KRIVGSVRMTP---ISIEKITGHLL--GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
             ++GSV  T    I        +L  GPI + P YQ  G G++L+ +S   A + G + 
Sbjct: 61  GLVIGSVMYTKNRLIDENGAEKQILTFGPICIAPEYQRMGYGKELMEVSFQKAVQMGYEA 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +V+ G  A Y   GF++    ++ L   + P  +L   L        K
Sbjct: 121 VVIFGSPANYVSSGFKSCKKYNVCLEGDIWPAAMLVKELKPGALDGKK 168


>gi|311894851|dbj|BAJ27259.1| putative acetyltransferase [Kitasatospora setae KM-6054]
          Length = 168

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 7/163 (4%)

Query: 32  AFFLERLEHDSSICAMHADSFG--PGRFVRAAVLLREQGMHD--LSLSFLCAEGKRIV-G 86
                R+E  S             PG    A ++   +       +LS +  + + +V G
Sbjct: 1   MTVRTRVELPSDTAETRRVHMAAFPG-PEEADLVDALRRDAAWLPALSLVAVDDREVVIG 59

Query: 87  SVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
              +T + I    G  L P+ V P +Q KG+G  ++  ++DAA + G +V+V++GD  YY
Sbjct: 60  HALLTRLRIGNGKGLALAPVAVAPEWQRKGVGTAVVRAALDAAAQAGERVVVVLGDPDYY 119

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            + GF       +  P  V       LPL         G+ R 
Sbjct: 120 GRFGFTPAAGHRITGPFDVPETYFQALPL-PGADGVPHGVCRY 161


>gi|261820140|ref|YP_003258246.1| GCN5-related N-acetyltransferase [Pectobacterium wasabiae WPP163]
 gi|261604153|gb|ACX86639.1| GCN5-related N-acetyltransferase [Pectobacterium wasabiae WPP163]
          Length = 180

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 70/176 (39%), Gaps = 20/176 (11%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I ++   SF  G    A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLVRVEIPVDAAGINSLLRRSFPTG--AEADLVHQLREDGLLTLGVVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ IE        L P+ V    + +G+G KL+   +DA  + G   +V++G+ AYYS
Sbjct: 59  FSPVLIEGEDRQWVALAPLAVDDSLRRQGVGEKLVYEGLDALNEFGYTAVVVLGEPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN------------VAQNIKGIVRCRE 191
           + GF       L    P   +     PL  N              ++  G+V   E
Sbjct: 119 RFGFVPATEHQLHCRWPDSESTFQVYPLADNQVAGEESSEGESGFEDASGLVEYAE 174


>gi|332653137|ref|ZP_08418882.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
 gi|332518283|gb|EGJ47886.1| acetyltransferase, GNAT family [Ruminococcaceae bacterium D16]
          Length = 208

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 64/174 (36%), Gaps = 16/174 (9%)

Query: 29  KIGAFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAE 80
                 + R E  +   A+   +       + PG        +LR        L  +  +
Sbjct: 1   MKQHNIIIRQETPADYAAVEHLTREAFWNVYRPGCLEHYVVHVLRNDPAFVPELDLVMEQ 60

Query: 81  GKRIVGSVRMTPISIEKITGHLL-----GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
              ++G V      I+   G  +     GPI + P  Q +G+G+ L+  S++ A++ G+ 
Sbjct: 61  DGALIGHVLYMRAIIKADDGREIPMMTFGPISIRPDLQRRGLGKYLLDYSMEKAKELGAG 120

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPN---RVLFLPLVQNVAQNIKGI 186
           V+ + G++ +Y K GF     + +      +       L   L       + G+
Sbjct: 121 VLCIEGNLDFYGKSGFVLAGTRGIRYHGEPEQELVPYFLLKELRPGFLDGVTGV 174


>gi|89072585|ref|ZP_01159157.1| putative acetyltransferase [Photobacterium sp. SKA34]
 gi|89051689|gb|EAR57142.1| putative acetyltransferase [Photobacterium sp. SKA34]
          Length = 167

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 62/162 (38%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSSI---CAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCA-EGKRIVGSVR 89
            L R E  + I     +    F       A +++  +     +LS +   +   +VG   
Sbjct: 1   MLIRSEAPADILTIDTLLKAVF--PTDAEAKLVMALRENGKRTLSLVACNDEGEVVGYAF 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P++++ +      L P+ V   YQ++GIG  L+  +          VIV VG+  YY 
Sbjct: 59  FSPVTVDGVDTNWQGLAPLAVRDDYQSQGIGLTLLEEAKSVLADFDYPVIVAVGNHEYYE 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           K GF+      L    P   N  +   ++       +G V  
Sbjct: 119 KAGFKKAVDHQLTSTLPDIKNAFMVYEVIPESVVQYQGKVEY 160


>gi|160885767|ref|ZP_02066770.1| hypothetical protein BACOVA_03771 [Bacteroides ovatus ATCC 8483]
 gi|156108580|gb|EDO10325.1| hypothetical protein BACOVA_03771 [Bacteroides ovatus ATCC 8483]
          Length = 215

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 62/173 (35%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       + PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQSSDYHETENITREAFWNHYSPGCDEHYLLHIMRNHPKFVPELDIVAEHNNK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ +GIG K+I+++   A + G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQQGIGGKMIALTKKLASEMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  N   N KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVCELYDNALANAKG--RYIE 171


>gi|238787607|ref|ZP_04631405.1| acetyltransferase [Yersinia frederiksenii ATCC 33641]
 gi|238724394|gb|EEQ16036.1| acetyltransferase [Yersinia frederiksenii ATCC 33641]
          Length = 159

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 62/155 (40%), Gaps = 5/155 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   +F   R   A ++ + +    L+L  +  +    +VG V  +P+ +   
Sbjct: 2   DAPGIDALLRQAFK--RDDEAELVQQLREDGLLTLGVVATDDEGGVVGYVAFSPVDVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + +G+  KL+   +D+  + G   +V++G+ AYY + GF     
Sbjct: 60  DRQWVALAPLAVEESLRRQGLAEKLVYEGLDSLNEFGYAAVVVLGEPAYYQRFGFVPAAG 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
             L    P          L ++  ++  G V   +
Sbjct: 120 HQLTCRWPGTEQAFQVYALAEDALKSADGEVVFSD 154


>gi|330470785|ref|YP_004408528.1| GCN5-like N-acetyltransferase [Verrucosispora maris AB-18-032]
 gi|328813756|gb|AEB47928.1| GCN5-related N-acetyltransferase [Verrucosispora maris AB-18-032]
          Length = 181

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 62/171 (36%), Gaps = 15/171 (8%)

Query: 34  FLERLEHDSSICAMH---ADSFGPGR-----FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +   A+    A +F          VR    LR+       L+ +   G  IV
Sbjct: 4   LRLRPEEPADTGAVRRVLAAAFARPDVATPPEVRLVEELRDGDAWLPELAMVAEYGGEIV 63

Query: 86  GSVRMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G    T + +           LGP+ V P  Q  G+G  ++   ++AA + G +++V++G
Sbjct: 64  GYALFTRVVVSADEHTAPALALGPVAVAPHRQRIGLGTSVVQAGLEAATELGERLVVVLG 123

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL---VQNVAQNIKGIVRC 189
           D AYY + GF       L  P          L L           +G V  
Sbjct: 124 DPAYYRRFGFSRADRMGLTSPWSGLGEPWQALVLPPSTSGEPAPPQGEVVF 174


>gi|237812661|ref|YP_002897112.1| acetyltransferase, gnat family [Burkholderia pseudomallei MSHR346]
 gi|237504780|gb|ACQ97098.1| acetyltransferase, gnat family [Burkholderia pseudomallei MSHR346]
          Length = 177

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 34  FLERLEHDSSICAMHADSFGP------GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E      A+             G      ++   +    LS+S +     R+VG 
Sbjct: 12  VTLRGERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLVAVRDGRLVGH 71

Query: 88  VRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ A 
Sbjct: 72  VAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPAC 131

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           Y++ GF   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 132 YARFGF--GPAGDIVFPQ-APPDALMALPFGEHAPRPA-GALRYHA 173


>gi|260174391|ref|ZP_05760803.1| acetyltransferase [Bacteroides sp. D2]
 gi|315922659|ref|ZP_07918899.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313696534|gb|EFS33369.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 215

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 62/173 (35%), Gaps = 15/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R+E  S        +       + PG        ++R        L  +     +
Sbjct: 1   MDIKLRIEQSSDYHETENITREAFWNHYSPGCNEHYLLHIMRNHPKFVPELDIVAEHNNK 60

Query: 84  IVGSVRM-----TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           IVG+V             +     LGPI V P YQ +GIG ++I+++   A + G + I+
Sbjct: 61  IVGNVVCLKSFIMADDGNQYEVLSLGPISVLPEYQQQGIGGRMIALTKKLASEMGFRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           L GD  YY + GF       +     +    +    L  N   N KG  R  E
Sbjct: 121 LCGDPDYYLRQGFIPAETLGIRTEDNMYATALHVYELYDNALANAKG--RYIE 171


>gi|227112586|ref|ZP_03826242.1| putative acetyltransferase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 180

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 67/176 (38%), Gaps = 20/176 (11%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   +F  G    A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLVRVEIPVDAAGIDNLLRRAFPTG--AEADLVHQLREDGLLTLGVVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ I+        L P+ V    + +G+G KL+   +DA  +     +V++G+  YYS
Sbjct: 59  FSPVLIDGEDRQWVALAPLAVDDSLRRQGVGEKLVYEGLDALNEFSYTAVVVLGEPTYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN------------VAQNIKGIVRCRE 191
           + GF       L    P   +     PL  N              ++  G+V   E
Sbjct: 119 RFGFVPATAHQLHCRWPDSESAFQVYPLADNHVVGEGRPEDESGFESASGLVEYAE 174


>gi|169350208|ref|ZP_02867146.1| hypothetical protein CLOSPI_00952 [Clostridium spiroforme DSM 1552]
 gi|169292991|gb|EDS75124.1| hypothetical protein CLOSPI_00952 [Clostridium spiroforme DSM 1552]
          Length = 169

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 64/162 (39%), Gaps = 9/162 (5%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFV---RAAVL--LREQGMHDLSLSFLCAEGKRIV 85
            + + E  +    ++     +F   +        ++  LR+       LS +      + 
Sbjct: 1   MIIQQETSNDYNEVYKLIKEAFASSKHADGNEQDLVVELRKSDAFIPELSLVAKIDTELA 60

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G +  T   +      +L P+ + P YQ +GIG  LI+     A+  G Q  +++G   Y
Sbjct: 61  GHILFTKAKVNDNEVLVLAPLAIKPKYQRQGIGMALINEGHKIAKNLGYQYSMVLGSETY 120

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIV 187
           Y K+G+       + +P  +     + + L +   + IKG +
Sbjct: 121 YPKVGYIEAKDLGIEVPEGIPSKNFMAIKLQE-TVKPIKGKL 161


>gi|227327839|ref|ZP_03831863.1| putative acetyltransferase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 180

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 67/176 (38%), Gaps = 20/176 (11%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I  +   +F  G    A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLVRVEIPVDAAGIDNLLRRAFPTG--AEADLVHQLREDGLLTLGVVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ I+        L P+ V    + +G+G KL+   +DA  +     +V++G+  YYS
Sbjct: 59  FSPVLIDGEDRQWVALAPLAVDESLRRQGVGEKLVYEGLDALNEFSYTAVVVLGEPTYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN------------VAQNIKGIVRCRE 191
           + GF       L    P   +     PL  N              ++  G+V   +
Sbjct: 119 RFGFVPATEHQLHCRWPDSASAFQVYPLADNHVVGEGCPEGESGFESASGLVEYAK 174


>gi|238761778|ref|ZP_04622752.1| acetyltransferase [Yersinia kristensenii ATCC 33638]
 gi|238699892|gb|EEP92635.1| acetyltransferase [Yersinia kristensenii ATCC 33638]
          Length = 150

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 55/139 (39%), Gaps = 3/139 (2%)

Query: 56  RFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLY 112
           R   A ++ + +    L+L  +  +    +VG V  +P+ +         L P+ V    
Sbjct: 7   RDDEADLVQQLREDGLLTLGIVATDDEGGVVGYVAFSPVDVGGEDRQWVALAPVAVEEGL 66

Query: 113 QNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLF 172
           + +G+  KL+   +D+  + G   +V++GD AYY + GF       L    P        
Sbjct: 67  RRQGLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQRFGFVPAARHQLTCRWPGTEEAFQV 126

Query: 173 LPLVQNVAQNIKGIVRCRE 191
             L ++   +  G V    
Sbjct: 127 YALAEDALTDADGEVVFSA 145


>gi|298385532|ref|ZP_06995090.1| acetyltransferase [Bacteroides sp. 1_1_14]
 gi|298261673|gb|EFI04539.1| acetyltransferase [Bacteroides sp. 1_1_14]
          Length = 190

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 64/173 (36%), Gaps = 13/173 (7%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
                 R  +      I  +   +FG  +  +    L         +S L       VG 
Sbjct: 4   SINIQIRETNTDDFDSIMTVEKQAFGYDKEAQLVADLLADKTAKPMVSLLAFYKGEAVGH 63

Query: 88  VRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  T    +        H+L P+ V P YQ +GIG  LI   ++  ++KGS ++ ++G  
Sbjct: 64  ILFTRAYFDGQGAQQMMHILAPLAVKPEYQRQGIGGMLIRAGIERLQEKGSCLVFVLGHK 123

Query: 144 AYYSKLGFQAVPWKSLILPAPVD-----PNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY K GF     + L  PAP        +  +   +        KG +RC +
Sbjct: 124 EYYPKYGFIPDAAR-LGYPAPYPILEQFSDYWMVQAISPKGFDVDKGKIRCSD 175


>gi|218661244|ref|ZP_03517174.1| GCN5-related N-acetyltransferase [Rhizobium etli IE4771]
          Length = 152

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 8/131 (6%)

Query: 34  FLERLEHDSSICAMHADS---FGPGRF---VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E  + I ++H  +   F P  +     A ++ R +   DL++S +  E   I+G 
Sbjct: 9   MLIRYETPADIDSIHDLTSIAFAPMPYSDGTEAEIIRRLRASGDLTISLVAEEEGEILGH 68

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P++I+ +      LGPI V P  Q +GIG+ LI+  +   E+ G+    L+G+   
Sbjct: 69  VAFSPVTIDGVHGGWFGLGPISVRPERQRQGIGKALIAKGLALLEEIGASGCALIGNPEV 128

Query: 146 YSKLGFQAVPW 156
           Y   GF +   
Sbjct: 129 YHGAGFSSDGR 139


>gi|149175845|ref|ZP_01854463.1| hypothetical protein PM8797T_24541 [Planctomyces maris DSM 8797]
 gi|148845292|gb|EDL59637.1| hypothetical protein PM8797T_24541 [Planctomyces maris DSM 8797]
          Length = 172

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 61/149 (40%), Gaps = 12/149 (8%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLC-AEGKRIVGSVR 89
              R E+ S    I  ++  +F  G+   A ++ R +      LS +   E ++++G + 
Sbjct: 2   MQIRFENSSDQTEIRTINEAAF--GQPAEADLVDRLRAGCPEQLSLVAIREDQQLIGHIL 59

Query: 90  MTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
            TP  I+   G       L P+ V P +Q + +G +L+   +   E +    ++++G   
Sbjct: 60  FTPAVIDYTDGSHIKGWGLAPLAVLPEFQKQRVGSQLVQAGLQELENRNQPFVIVLGHPE 119

Query: 145 YYSKLGFQAVPWKSLILPA-PVDPNRVLF 172
           YY   GF+      L       + +  + 
Sbjct: 120 YYLHFGFEPAWQYGLTCDFTGENRDAFMI 148


>gi|329850303|ref|ZP_08265148.1| acetyltransferase GNAT family protein [Asticcacaulis biprosthecum
           C19]
 gi|328840618|gb|EGF90189.1| acetyltransferase GNAT family protein [Asticcacaulis biprosthecum
           C19]
          Length = 169

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/149 (36%), Positives = 75/149 (50%), Gaps = 12/149 (8%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG----KRIVGSVRM 90
           LE       +  +    FGPGR+ + A  LRE       LSF    G    +R++GSVRM
Sbjct: 7   LETPRTADRVIELTDRVFGPGRYTKTAERLREGSEPVHDLSFAATTGPKGHERLMGSVRM 66

Query: 91  TPISIEKITG------HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
            PI I             LGPIVV P ++  GIG+ L+  SVDAA +KG + ++LVG  +
Sbjct: 67  WPIFIYDEDANVREPLVFLGPIVVEPTHRGLGIGKSLVRASVDAAFQKGLRAVLLVGSQS 126

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFL 173
           Y+   GF     + + +P PVD  RVL  
Sbjct: 127 YFKPFGFNLA--EGIDMPGPVDAKRVLIR 153


>gi|323487537|ref|ZP_08092830.1| hypothetical protein HMPREF9474_04581 [Clostridium symbiosum
           WAL-14163]
 gi|323399138|gb|EGA91543.1| hypothetical protein HMPREF9474_04581 [Clostridium symbiosum
           WAL-14163]
          Length = 215

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 62/165 (37%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
              R E +S   A+   +       + PG  V   ++  +R        L F+     ++
Sbjct: 2   IKIRNEKESDYKAVEEITRKAFYNLYVPG-CVEHYLVHTMRGHEDFIPELDFVIELDDQV 60

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T          +      GP+ + P YQ  G G+ LI  S + A   G  VIV+
Sbjct: 61  IGNIMYTKARLVDEAGTEKEILTFGPVSITPEYQRMGYGKMLIEHSFEQAVLLGYDVIVI 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +G    Y   GF++    ++ +     P  ++   L  N     K
Sbjct: 121 LGSPMNYVGHGFKSCKKLNICMEDGRYPAAMMVKELAPNRLDGRK 165


>gi|294634530|ref|ZP_06713065.1| acetyltransferase, GNAT family [Edwardsiella tarda ATCC 23685]
 gi|291092044|gb|EFE24605.1| acetyltransferase, GNAT family [Edwardsiella tarda ATCC 23685]
          Length = 167

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E       I  +   SF P R   A ++   +    L+L  +  +    ++G   
Sbjct: 1   MLIRAEIPVDAPGIERLLRASF-PSR-AEAELVAHLREDGLLTLGVVATDDEGGVIGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+++         L P+VV   Y+ +GIG +L+   +D   + G   +V++GD+ YY 
Sbjct: 59  FSPVTVAGEECQWVGLAPLVVDEGYRRQGIGEQLVYEGLDTLNEFGYAAVVVLGDVHYYR 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + GF       L    P          L  +     +G +    
Sbjct: 119 RFGFVNAAEHGLSCRWPGCEASFQVYALAPDTLAQTRGRIEYAA 162


>gi|171321063|ref|ZP_02910046.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MEX-5]
 gi|171093677|gb|EDT38827.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MEX-5]
          Length = 180

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 62/169 (36%), Gaps = 15/169 (8%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFV------RAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
              R E    I A+                    ++   +    L +S +    +R++G 
Sbjct: 11  VTLRDERAGDIDAIGRVIVAAFADEPQHGQLERQIVAALREDGALGVSLVAERDERVIGH 70

Query: 88  VRMTPISIEKIT-----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           V  +P+SI          + L P+ V P  + + IG  L+   +DA  + G++  V++GD
Sbjct: 71  VAFSPVSIGGEPAGSHAWYALAPLAVRPECRRQSIGAGLVRTGLDALRRLGARGCVVLGD 130

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            AYY++ GF               P   L L   +   +   G VR   
Sbjct: 131 RAYYARFGFVPSGDLVFAA---APPEHFLALAFDEAAPRP-SGEVRYHA 175


>gi|50119669|ref|YP_048836.1| putative acetyltransferase [Pectobacterium atrosepticum SCRI1043]
 gi|49610195|emb|CAG73638.1| putative acetyltransferase [Pectobacterium atrosepticum SCRI1043]
          Length = 180

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/176 (22%), Positives = 69/176 (39%), Gaps = 20/176 (11%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I ++   SF  G    A ++ + +    L+L  +  +    +VG   
Sbjct: 1   MLVRVEIPVDAAGIDSLLRRSFPTG--AEADLVHQLREDGLLTLGVVATDDEGGVVGYAA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ IE        L P+ V    + +G+G KL+   +DA  +     +V++G+ AYYS
Sbjct: 59  FSPVLIEGEDRQWVALAPLAVDESLRRQGVGEKLVYEGLDALNEFSYTAVVVLGEPAYYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN------------VAQNIKGIVRCRE 191
           + GF       L    P   +     PL  N              ++  G+V   E
Sbjct: 119 RFGFVPATEHQLHCRWPDSESTFQVYPLADNQVAGEESSEGESGFEDAIGLVEYAE 174


>gi|302545499|ref|ZP_07297841.1| acetyltransferase, GNAT family protein [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302463117|gb|EFL26210.1| acetyltransferase, GNAT family protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 172

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 57/153 (37%), Gaps = 10/153 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAV--------LLREQGMHDLSLSFLCAEG-KRI 84
            L R E  S +  +   +        AAV         LR       +LSF+ A+    +
Sbjct: 1   MLIRRETRSDLAGVRDVTAAAFGKSEAAVPVEVTLLDELRTCDAWLPALSFVAADDRGDV 60

Query: 85  VGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKL-ISMSVDAAEKKGSQVIVLVGDI 143
           +G V  T   +       LGP+ VHP +Q + +G     + S          ++ L+G  
Sbjct: 61  IGHVVCTRGHVGPDLALGLGPLSVHPTHQRRDLGLATDGTGSWAQRNAFAESLVALLGSP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           AYY + GF+      +  P P   +     PL 
Sbjct: 121 AYYGRFGFRPAAAYGITAPDPAWGDYFQARPLT 153


>gi|325108575|ref|YP_004269643.1| GCN5-related N-acetyltransferase [Planctomyces brasiliensis DSM
           5305]
 gi|324968843|gb|ADY59621.1| GCN5-related N-acetyltransferase [Planctomyces brasiliensis DSM
           5305]
          Length = 191

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/162 (24%), Positives = 74/162 (45%), Gaps = 11/162 (6%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFL-----CAEGKRIVGSVRMTP 92
            E  +S+  +   +F PG F  A V+ + +      +S +           ++G      
Sbjct: 18  AERVNSLTPLLRLAF-PGPF-EAEVVEQMKQDDCRQMSAVLLREPAEAEPEVIGQAYYCA 75

Query: 93  ISIEK---ITGHLLGPIVVHPLYQNKGIGRKLISMSVD-AAEKKGSQVIVLVGDIAYYSK 148
           + +E+     G+ LGP+ +HP +Q +G+G +L+  S+   A++  +  + ++G+ A+YSK
Sbjct: 76  LEVERSPTDEGYSLGPMAIHPDWQGRGLGLQLLKESLKILADEYQAGWVAVLGEPAFYSK 135

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            GF       L    PV P   + L L  N   ++ G VR  
Sbjct: 136 AGFAPASEFDLKCHYPVSPKYFMALELRPNALNDVSGYVRYH 177


>gi|258507355|ref|YP_003170106.1| acetyltransferase [Lactobacillus rhamnosus GG]
 gi|257147282|emb|CAR86255.1| Acetyltransferase [Lactobacillus rhamnosus GG]
 gi|259648712|dbj|BAI40874.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 214

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 62/166 (37%), Gaps = 13/166 (7%)

Query: 30  IGAFFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVLLREQGMHDLSLSFLCAEG 81
           +      R E  S    +  +H ++F     PG      A +LR+       L  +    
Sbjct: 1   MTTNITIRTEQPSDYRTVETIHRNAFWNLYVPGADEHYLAHILRDHADFIPELDLVITLD 60

Query: 82  KRIVGSVRMTP-----ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            +I+G++  T       +  +      GP+ + P YQ +G G++LI  S+  A   G   
Sbjct: 61  GQIIGNIMYTKSKLVTATGLEKPIVTFGPVSITPAYQRRGFGKQLIEASMQQAANLGYGA 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           IV+ GD   Y   GFQ+    ++       P  +L   L       
Sbjct: 121 IVIFGDPDNYVARGFQSCQKFNVWAADNTQPTAMLVKELQPQTLAG 166


>gi|332160094|ref|YP_004296671.1| putative acetyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664324|gb|ADZ40968.1| putative acetyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 159

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 55/154 (35%), Gaps = 5/154 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   +F           LRE     L+L  +  +    +VG    +P+ +   
Sbjct: 2   DAPGIDALLRKAFKGDDEAELVQQLRE--DGLLTLGIVATDDEGGVVGYAAFSPVDVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + + +  KL+   +D+  + G   +V++GD AYY + GF     
Sbjct: 60  DRQWVALAPLAVEEGLRRQRLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQRFGFVPAAR 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             L    P          L ++   +  G V   
Sbjct: 120 HQLTCRWPDTEEAFQVYALAEDALTDADGEVVFS 153


>gi|148553040|ref|YP_001260622.1| GCN5-like N-acetyltransferase [Sphingomonas wittichii RW1]
 gi|148498230|gb|ABQ66484.1| GCN5-related N-acetyltransferase [Sphingomonas wittichii RW1]
          Length = 175

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 7/156 (4%)

Query: 41  DSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITG 100
            S +  +   +FG  R  R A  LRE       LS    E   ++GS++  PI +    G
Sbjct: 12  ASHVEHLLDLAFGTDRHQRTAYRLREGVEALPDLSLAALEDGELIGSIQCWPIQLTGDDG 71

Query: 101 -----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK-LGFQAV 154
                 L+GP+ V P  Q  G+GR L+  ++  A+    + ++L+GD++YY +  GF + 
Sbjct: 72  DSTPLILVGPVAVAPGRQRAGVGRMLMDAALAKADAADREPMMLIGDVSYYERFFGFSSR 131

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             +   +P PV+ +R+L   L         G +  R
Sbjct: 132 HTRGWAVPGPVERDRLLAR-LRPGQVVPGHGRLGPR 166


>gi|258652033|ref|YP_003201189.1| GCN5-related N-acetyltransferase [Nakamurella multipartita DSM
           44233]
 gi|258555258|gb|ACV78200.1| GCN5-related N-acetyltransferase [Nakamurella multipartita DSM
           44233]
          Length = 178

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 63/174 (36%), Gaps = 15/174 (8%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGP--GRFVRAAVLLREQGMHD--LSLSFLCAEGKRI 84
                R E  +   A+ A    +F    GR +   +    +   D    L  +      +
Sbjct: 1   MTVRVRPETPADAAAVQAIIGAAFPAVDGRVLEVGLNDELRTDPDRIPDLCLVADRDGVV 60

Query: 85  VGSVRMTPISIEK-------ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
           VG +  +  ++              +GP+ V P  Q  G+GR L++  +D A  +    +
Sbjct: 61  VGQLTCSYGTLTDPAPAGATRRLVGVGPVAVRPADQGTGVGRALLADLIDRAAHRAELAL 120

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           VL+GD A+Y + GF+      +  P P        L L     + + G  R   
Sbjct: 121 VLLGDPAFYGRFGFRPAAEAGITAPDPAWGEHFQALVLAPGRPR-LTGTFRYAA 173


>gi|319440640|ref|ZP_07989796.1| acetyltransferase [Corynebacterium variabile DSM 44702]
          Length = 189

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 69/170 (40%), Gaps = 23/170 (13%)

Query: 35  LERLEH--DSSICAMHADS---FG---PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
           + R E    S I A+ A +   F          A ++   +   +L  S +     RIVG
Sbjct: 20  VIRPERVDGSDIGAIRALTAEAFAKVEHASGTEAKIIDALRDAGELRYSLVAVHAGRIVG 79

Query: 87  SVRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
            V  + ++++       + +GP+ VHP +Q +G G  L+   +D     G+   VL+GD 
Sbjct: 80  HVAASRVTLDPPDGGWWYGIGPLSVHPDFQGQGTGSGLMRALLDLLIVYGATGAVLLGDP 139

Query: 144 AYYSKLGFQAVPWKSLILPA--PVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           + Y++ GF   P + L +    P   +    L L         G V   E
Sbjct: 140 SLYARFGF--APHEGLTMAGLAPEQASYFQGLRLD--------GTVGYPE 179


>gi|167738142|ref|ZP_02410916.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           14]
 gi|167823736|ref|ZP_02455207.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           9]
          Length = 134

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 6/133 (4%)

Query: 61  AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE--KITGHLLGPIVVHPLYQNKGIG 118
            ++   +    LS+S +     R+VG V  +P++I       H L P+ V P  Q +GIG
Sbjct: 2   RIVDALRADGRLSVSLVAVRDGRLVGHVAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIG 61

Query: 119 RKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
             L+   +DA  + G++  V++G+ AYY++ GF   P   ++ P    P+ ++ LP  ++
Sbjct: 62  AALVRAGLDALRRAGARGCVVLGEPAYYARFGF--GPAGDIVFPQ-APPDALMALPFGEH 118

Query: 179 VAQNIKGIVRCRE 191
             +   G +R   
Sbjct: 119 APRPA-GALRYHA 130


>gi|322831228|ref|YP_004211255.1| GCN5-related N-acetyltransferase [Rahnella sp. Y9602]
 gi|321166429|gb|ADW72128.1| GCN5-related N-acetyltransferase [Rahnella sp. Y9602]
          Length = 167

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 63/162 (38%), Gaps = 8/162 (4%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R E       I  +   SF  G    A ++   +    L+L  +  +    +VG V 
Sbjct: 1   MLIRTEIPVDAAGIDRLLRASFPTG--AEADLVQELREDGLLTLGVVATDDEGGVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
             P+ I+        L P+VV    + +G+G KL+   +D+  + G   +V++GD AYY+
Sbjct: 59  FCPVDIQGEDRNWVALAPLVVEQSLRGQGLGEKLVYEGLDSLNEFGYAAVVVLGDPAYYN 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           + GF+      L               L  +   +  G V  
Sbjct: 119 RFGFKPAAVHGLHCRWIGTEAAFQLFTLSDDALSDASGEVVF 160


>gi|254501425|ref|ZP_05113576.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
 gi|222437496|gb|EEE44175.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11]
          Length = 168

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 64/165 (38%), Gaps = 11/165 (6%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
            + R+     + ++      +F P   +   V           LS +  +  ++VG V  
Sbjct: 1   MIFRVSTKGDLQSLERIYPAAF-PEEDLLPVVRS-LVTGSVDVLSLVAEDDGKVVGHVAF 58

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T  S+  ++  LL P+ V P    +GIG  L+       +K+    ++++GD  YY + G
Sbjct: 59  TICSVGDVSAALLAPLCVDPERHKQGIGTALVREGFKRLQKRAIDQVLVLGDPRYYGRFG 118

Query: 151 FQAVPWKSLILPAPVD---PNRVLFLPLVQNVAQNIKGIVRCREV 192
           F     +++  P P+     +    L         I+G +    V
Sbjct: 119 F--AAERAIRPPYPMPEDWADAWQSLSFGTGA-DQIEGTLVVSGV 160


>gi|168335444|ref|ZP_02693533.1| GCN5-related N-acetyltransferase [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 211

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 65/173 (37%), Gaps = 15/173 (8%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAV--LLREQGMHDLSLSFLCAEGKRI 84
            + R E  +      A +       + PG      +   +R    +   L+F+      +
Sbjct: 2   MIIRNEATTDYEKAEAVARDAFWNLYKPGAE-EHVLLKQMRTHRDYIPELTFVAEVDGEV 60

Query: 85  VGSVRMTPISIEKITGHLL-----GPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           VG+V  T   I +  G  +     GP+ V P    +GIGR +I+ ++  A++ G   + L
Sbjct: 61  VGAVYATRSKIVQTDGAEISTVTFGPVFVAPNLHRQGIGRAMITHAIAEAKEMGFAAVTL 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           +G   +Y   GF      ++          +  LPL +     + G     EV
Sbjct: 121 LGYPYHYKPYGFAGGKKYNVTAEDGKFYAGLQILPLAEAAMAGVSGYAVFSEV 173


>gi|238750138|ref|ZP_04611641.1| acetyltransferase [Yersinia rohdei ATCC 43380]
 gi|238711682|gb|EEQ03897.1| acetyltransferase [Yersinia rohdei ATCC 43380]
          Length = 150

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 56/139 (40%), Gaps = 3/139 (2%)

Query: 56  RFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLY 112
           R   A ++ + +    L+L  +  +    +VG    +P+ +         L P+ V    
Sbjct: 7   RDDEAELVQQLREDGLLTLGIVATDDEGGVVGYAAFSPVEVGGEDRQWVALAPLAVEESL 66

Query: 113 QNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLF 172
           + +G+  KL+   +D+  + G   +V++G+ +YY + GF       L    P   +    
Sbjct: 67  RRQGLAEKLVYEGLDSLNEFGYAAVVVLGEPSYYQRFGFVPAASHQLTCRWPNTEDAFQV 126

Query: 173 LPLVQNVAQNIKGIVRCRE 191
             L ++   + +G V    
Sbjct: 127 YALAEDALADTEGEVVFSA 145


>gi|111018898|ref|YP_701870.1| hypothetical protein RHA1_ro01901 [Rhodococcus jostii RHA1]
 gi|110818428|gb|ABG93712.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 167

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 59/148 (39%), Gaps = 5/148 (3%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRFVRAAVLLREQGMHD--LSLSFLCAEGKRIVGSV 88
            L R E+   I A+   H  +F     +   ++ R +        LS +      + G V
Sbjct: 1   MLIRRENPGDIDAVAEVHRQAFDGDAPLEVGLVTRLRSSDAWIPQLSLVAELAGSVAGHV 60

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            +T  +++      LGPI V P  Q  G+G  L+  ++  A+ +   ++ L+G + YY +
Sbjct: 61  CLTRATVDSTDVLALGPIGVLPDVQRDGVGSALMHAALGGADARDEPLVALLGHLDYYPR 120

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLV 176
            GF +     +    P   +      L 
Sbjct: 121 FGFVSGTSVGIEPDQPSWSSHFQVRRLA 148


>gi|318607346|emb|CBY28844.1| acetyltransferase [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 159

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 55/154 (35%), Gaps = 5/154 (3%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKI 98
               I A+   +F           LRE     L+L  +  +    +VG    +P+ +   
Sbjct: 2   DAPGIDALLRKAFKGDDEAELVQQLRE--DGLLTLGIVATDHVGGVVGYAAFSPVDVGGE 59

Query: 99  T--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPW 156
                 L P+ V    + + +  KL+   +D+  + G   +V++GD AYY + GF     
Sbjct: 60  DRQWVALAPLAVEEGLRRQRLAEKLVYEGLDSLNEFGYAAVVVLGDPAYYQRFGFVPAAR 119

Query: 157 KSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             L    P          L ++   +  G V   
Sbjct: 120 HQLTCRWPDTEEAFQVYALAEDALTDADGEVVFS 153


>gi|294632774|ref|ZP_06711333.1| acetyltransferase [Streptomyces sp. e14]
 gi|292830555|gb|EFF88905.1| acetyltransferase [Streptomyces sp. e14]
          Length = 230

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 60/152 (39%), Gaps = 5/152 (3%)

Query: 30  IGAFFLERLEHDSSICAMHADSFGP-GRFVRAAVLLREQGMHDL---SLSFLCAE-GKRI 84
           +   ++ R E  + I A+ A      G    A ++   +   D     LS +  +    +
Sbjct: 1   MSTLWITRAETRADIPAIRATHLAAFGTAAEADLVDALRADADAWIDGLSVVATDEDGDV 60

Query: 85  VGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           VG   +T   I  +    L P  V P  Q  G G   +  ++ AAE  G Q +V++G  A
Sbjct: 61  VGHALLTRCHIGDVPALCLAPCAVRPERQRDGAGSAAVRAALRAAEDLGEQYVVVLGHPA 120

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           YY + GF       + L   V    ++ L L 
Sbjct: 121 YYPRFGFTRASAHGIGLSIDVPDEALMALALE 152


>gi|307946696|ref|ZP_07662031.1| acetyltransferase [Roseibium sp. TrichSKD4]
 gi|307770360|gb|EFO29586.1| acetyltransferase [Roseibium sp. TrichSKD4]
          Length = 173

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 10/160 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
           + F  R  + + I A+              +++    G     +S   A+  +IVG V  
Sbjct: 2   SDFDIRSTNPADIEALETLYLAAFPEEDLVSLVRELVGGPTPVISLAAAKDGQIVGHVVF 61

Query: 91  TPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
           TP  +        LLGP+ V P+   + IG  LI   ++ A K G++ ++++GD AYY++
Sbjct: 62  TPCGVSGSDEKASLLGPLCVTPMLHKQVIGSALIKAGMEEAHKSGTRQVLVLGDPAYYAR 121

Query: 149 LGFQAVPWKSLILPAPVDPN---RVLFLPLVQNVAQNIKG 185
            GF+  P  ++  P P+         +  L     + + G
Sbjct: 122 SGFK--PSAAIEAPYPLPEEWLAAWQWQMLDDG--EPLTG 157


>gi|229553391|ref|ZP_04442116.1| acetyltransferase [Lactobacillus rhamnosus LMS2-1]
 gi|258538536|ref|YP_003173035.1| acetyltransferase [Lactobacillus rhamnosus Lc 705]
 gi|229313272|gb|EEN79245.1| acetyltransferase [Lactobacillus rhamnosus LMS2-1]
 gi|257150212|emb|CAR89184.1| Acetyltransferase [Lactobacillus rhamnosus Lc 705]
          Length = 214

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 62/167 (37%), Gaps = 15/167 (8%)

Query: 30  IGAFFLERLEHDSS---ICAMHADSF----GPGRFVRA--AVLLREQGMHDLSLSFLCAE 80
           +      R E  S    +  +H ++F     PG       A +LR+       L  +   
Sbjct: 1   MTTNITIRTEQPSDYRTVETIHRNAFWNLYVPGA-DEHYIAHILRDHADFIPELDLVITL 59

Query: 81  GKRIVGSVRMTP-----ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
             +I+G++  T       +  +      GP+ + P YQ +G G++LI  S+  A   G  
Sbjct: 60  DGQIIGNIMYTKSKLVTATGLEKPIVTFGPVSITPAYQRRGFGKQLIDASMQQAADLGYG 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            IV+ GD   Y   GFQ+    ++       P  +L   L       
Sbjct: 120 AIVIFGDPDNYVARGFQSCQKFNVWAADNTQPTAMLVKELQPQTLAG 166


>gi|225418696|ref|ZP_03761885.1| hypothetical protein CLOSTASPAR_05920 [Clostridium asparagiforme
           DSM 15981]
 gi|225041776|gb|EEG52022.1| hypothetical protein CLOSTASPAR_05920 [Clostridium asparagiforme
           DSM 15981]
          Length = 223

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/176 (24%), Positives = 60/176 (34%), Gaps = 15/176 (8%)

Query: 29  KIGAFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAE 80
                   R E                   F PG        ++R        L  +   
Sbjct: 6   DETVEIELRRERPEDYRETEEMVRAAFWNHFAPGCDEHYLLHVMRSCPAFLPELDIVAVF 65

Query: 81  GKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
             RIVG+V  T  ++    G       LGPI V P +Q +G+G KLI  + + A K G  
Sbjct: 66  EGRIVGNVDYTRAAVLGDDGAKREVLALGPIAVLPEFQGRGVGGKLIGYTKELARKMGYG 125

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            I L GD  YY + GF       +     +       L L ++    I+G  R  E
Sbjct: 126 AIFLYGDPEYYGRHGFVPAERFGIRTADNMYAAAHQVLVLREHALDGIRG--RYVE 179


>gi|218779318|ref|YP_002430636.1| GCN5-related N-acetyltransferase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760702|gb|ACL03168.1| GCN5-related N-acetyltransferase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 251

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 61/168 (36%), Gaps = 19/168 (11%)

Query: 34  FLERLEHDSSICAM--------HADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E+     A+            F   +     ++   +    L++S +     ++V
Sbjct: 1   MKIRPENKDDHDAISKTTIVAYEDYPFR--QETEHQIIDDLRKADALTVSLVAVVEGQVV 58

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA-AEKKGSQVIVLVGD 142
           G + ++P++          LGPI V P +Q  GIG KLI   +       G +  VLVG 
Sbjct: 59  GHIAVSPVTISDGTSDWFGLGPISVLPEFQGLGIGGKLIKAGLSRVMNGIGGRGCVLVGP 118

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
             +Y   GF   P    ++         L LP    V     GIV+  
Sbjct: 119 PNFYCMFGFANYPQ---LIHEDCPQELFLALPFKGRVP---CGIVKFH 160


>gi|238793032|ref|ZP_04636661.1| acetyltransferase [Yersinia intermedia ATCC 29909]
 gi|238727632|gb|EEQ19157.1| acetyltransferase [Yersinia intermedia ATCC 29909]
          Length = 150

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 51/137 (37%), Gaps = 3/137 (2%)

Query: 58  VRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQN 114
             A ++ + +    L+L  +  +    +VG    +P+ +         L P+ V    + 
Sbjct: 9   AEAELVQQLREDGLLTLGIVATDDEGGVVGYAAFSPVEVGGEDRQWVALAPLAVAEGLRR 68

Query: 115 KGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP 174
           +G+  KLI   +D+  + G   +V++G  AYY + GF       L    P          
Sbjct: 69  QGLAEKLIYEGLDSLNEFGYAAVVVLGSPAYYQRFGFVPAVRHQLSCRWPGTEEAFQVYA 128

Query: 175 LVQNVAQNIKGIVRCRE 191
           L ++      G V    
Sbjct: 129 LAEDALTGADGEVVFSA 145


>gi|164687976|ref|ZP_02212004.1| hypothetical protein CLOBAR_01621 [Clostridium bartlettii DSM
           16795]
 gi|164602389|gb|EDQ95854.1| hypothetical protein CLOBAR_01621 [Clostridium bartlettii DSM
           16795]
          Length = 203

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 16/169 (9%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
                R         +   +       + PG      VL  L +       L  +     
Sbjct: 1   MSLTIRKIEKDDYNEVEVLTREAFWNIYRPG-CSEHLVLHNLHKNNKSIEDLELVVECEG 59

Query: 83  RIVGSVRMTPISIE---KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +IVG +  +  +I+     T    GP+ VHP +Q K IG KLI +S+  A + G   I +
Sbjct: 60  KIVGHIIYSKGNIDKSKDETFITFGPVSVHPKFQRKEIGSKLIRISMQKAVRLGYSAIFI 119

Query: 140 VGDIAYYSKLGFQAVPWKSLILPA-PVDPNR--VLFLPLVQNVAQNIKG 185
            GD  YY + GF++     + L   PV+      +   L ++  ++I+G
Sbjct: 120 TGDENYYKRFGFESASKYGIHLEGVPVEDEAPFFMVKTLKEDALKDIEG 168


>gi|325962594|ref|YP_004240500.1| hypothetical protein Asphe3_11850 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468681|gb|ADX72366.1| uncharacterized conserved protein [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 314

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 62/176 (35%), Gaps = 21/176 (11%)

Query: 33  FFLERLEHDSS---ICAMHADSFG---------PGRFVRAAVLLR---EQGMHDLSLSFL 77
             L R E       I A+ A++F           G  V    +LR   +   +    S +
Sbjct: 138 EVLLRTEEPGDRDAILALTAEAFAVSPVTGIPVEGEPVEVR-VLRGLFDAKEYLPGFSVV 196

Query: 78  CAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
                 +VG V  T   ++      LGP+ V P  Q  GIG  L++ ++  A       I
Sbjct: 197 AVLDGEVVGHVISTRGWVDGHELLGLGPLGVAPRLQRHGIGSALMTETIHRANAASEIGI 256

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP--LVQNVAQNIKGIVRCRE 191
            L+G   YYS+ GF       ++ P     +    LP  L       + G  R   
Sbjct: 257 ALLGSPEYYSRFGFVPAASLGVLPPDEGWGDHFQILPLALWPG---GVHGTFRYAA 309


>gi|323691901|ref|ZP_08106154.1| acetyltransferase [Clostridium symbiosum WAL-14673]
 gi|323504053|gb|EGB19862.1| acetyltransferase [Clostridium symbiosum WAL-14673]
          Length = 215

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 62/165 (37%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
              R E +S   A+   +       + PG  V   ++  +R        L F+     ++
Sbjct: 2   IKIRNEKESDYKAVEKITRKAFYNLYVPG-CVEHYLVHTMRGHEDFIPELDFVIELDDQV 60

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T          +      GP+ + P YQ  G G+ LI  S + A   G  VIV+
Sbjct: 61  IGNIMYTKARLVDEAGTEKEILTFGPVSITPEYQRMGYGKMLIEHSFEQAVLLGYDVIVI 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +G    Y   GF++    ++ +     P  ++   L  N     K
Sbjct: 121 LGSPMNYVGHGFKSCKKLNVCMEDGRYPAAMMVKELAPNRLDGRK 165


>gi|167622928|ref|YP_001673222.1| GCN5-like N-acetyltransferase [Shewanella halifaxensis HAW-EB4]
 gi|167352950|gb|ABZ75563.1| GCN5-related N-acetyltransferase [Shewanella halifaxensis HAW-EB4]
          Length = 178

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 60/122 (49%), Gaps = 2/122 (1%)

Query: 71  DLSLSFLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAA 129
           D    F+  +G ++ GS+  + ++ E  I   +L P+ VHP +Q +G+G+KLI   ++  
Sbjct: 48  DDLFIFVATDGDKLAGSIMFSRLTFETGIIAFILSPVAVHPEFQRQGVGQKLIKFGLETL 107

Query: 130 EKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVR 188
            +KG ++    GD  YYSK+GF+ +    +  P     P   L   L  +  Q I G   
Sbjct: 108 AEKGVELAFTYGDPNYYSKVGFKQLSEDVVKAPLALTYPEGWLGQSLTADALQPISGRCC 167

Query: 189 CR 190
           C 
Sbjct: 168 CV 169


>gi|157375930|ref|YP_001474530.1| acetyltransferase [Shewanella sediminis HAW-EB3]
 gi|157318304|gb|ABV37402.1| acetyltransferase [Shewanella sediminis HAW-EB3]
          Length = 178

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 66/164 (40%), Gaps = 11/164 (6%)

Query: 38  LEHDSSICAMHADSFGPGRFVRA--------AVLLREQGMHDLSLSFLCAEGKRIVGSVR 89
             H + I  +    F       +        A  L  +        F+  E ++IVGS+ 
Sbjct: 8   PSHIAEIKQLFTQVFS-DSEGESEGMLIGNLAYQLLTETDPQDLYGFIAIEDEQIVGSIV 66

Query: 90  MTP-ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            T  +    I   LL P+ +   YQ KG+G++LI   ++  +++G  ++   GD  +YSK
Sbjct: 67  FTRLVFESGINAFLLSPVAIQTSYQGKGVGQQLIRFGINQLKERGVGLVFTYGDPNFYSK 126

Query: 149 LGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +GF  +  K    P     P   L   LV    + I G   C E
Sbjct: 127 VGFNPISEKLAKAPLKMTYPEGWLGQSLVGEAFEPIIGNSYCVE 170


>gi|87199046|ref|YP_496303.1| acetyltransferase-like [Novosphingobium aromaticivorans DSM 12444]
 gi|87134727|gb|ABD25469.1| acetyltransferase-like protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 178

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/156 (25%), Positives = 71/156 (45%), Gaps = 9/156 (5%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIV-GSVRMTPISIEKI 98
             + I A+   +F P R  R A  +RE      +LSF   + + ++ G+++  P+++   
Sbjct: 20  DPALIEAVLDQAFEPERHKRTAYKVREGTQWLPNLSFAALDDEDMLAGTIQCWPVALTDA 79

Query: 99  TG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK-LGFQ 152
            G      ++GP+ V P  Q +G G+ L++ S+ A + +     VL+GD  YY +  GF 
Sbjct: 80  EGRAHPMIMVGPVAVLPHLQGEGFGKALMTASLTAIDPRAPLPQVLIGDPEYYERFFGFS 139

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVA--QNIKGI 186
                   LP P +  R+L       V   + + G 
Sbjct: 140 NAHTAGWKLPGPFEQRRLLCRTANPAVLPQEGMLGP 175


>gi|331083924|ref|ZP_08333033.1| hypothetical protein HMPREF0992_01957 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330403349|gb|EGG82909.1| hypothetical protein HMPREF0992_01957 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 208

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 64/171 (37%), Gaps = 20/171 (11%)

Query: 33  FFLERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLCAEGK 82
            ++ RLE  +    +           + PG    +V     LR+       L F+  +  
Sbjct: 5   DYIIRLEIPADHADVEYLVRESFWNVYRPGCLEHYVLHC--LRKDKDFVPELDFVMEKDG 62

Query: 83  RIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
           RI+G        I    G       +GPI +    + KG G+ L+  S++ A++ G+  +
Sbjct: 63  RIIGQNIFVKAVICADDGRHVPIMTMGPICIANDLKRKGYGKILLDYSIEKAKQMGAGAL 122

Query: 138 VLVGDIAYYSKLGFQAVPWKSLI---LPAPVDPNRVLFLPLVQNVAQNIKG 185
              G+I +Y K GF       +    LP   D +  L   L+      + G
Sbjct: 123 CFEGNIDFYGKSGFTYASEYGIRYHGLPEGEDASFFLCKELIPGYLDGVTG 173


>gi|257082744|ref|ZP_05577105.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257085445|ref|ZP_05579806.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256990774|gb|EEU78076.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256993475|gb|EEU80777.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
          Length = 198

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 56/146 (38%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VH   QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHLEAQNTGVGSALIKHSVQKAKELGVGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|197337522|ref|YP_002157701.1| acetyltransferase [Vibrio fischeri MJ11]
 gi|197314774|gb|ACH64223.1| acetyltransferase [Vibrio fischeri MJ11]
          Length = 178

 Score =   99 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 2/125 (1%)

Query: 69  MHDLSLSFLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVD 127
             D    F+  +  +IVGS+  T ++ E   T  LL P+V+   YQ KG+G+ LI+ +++
Sbjct: 46  DPDDMFIFVAKDNDKIVGSIFFTRLTFEIDTTAFLLCPVVIDAEYQKKGVGQALINHALE 105

Query: 128 AAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNR-VLFLPLVQNVAQNIKGI 186
             +++G +++   G+  +Y ++GF+ +  +    P P+      L   L       I G 
Sbjct: 106 VLKQEGVELVFTYGEPKFYERVGFEVISEEQFKSPIPLSYLYSWLAQSLNDEALTYIPGR 165

Query: 187 VRCRE 191
            +C  
Sbjct: 166 SKCVA 170


>gi|160939213|ref|ZP_02086564.1| hypothetical protein CLOBOL_04107 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438176|gb|EDP15936.1| hypothetical protein CLOBOL_04107 [Clostridium bolteae ATCC
           BAA-613]
          Length = 224

 Score =   99 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 62/173 (35%), Gaps = 14/173 (8%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGK 82
              + R E           +       + PG      V+  +R        L+F+     
Sbjct: 14  MNIVVRNEETKDYRRTEEVAREAFWNLYFPGA-AEHYVVHQMRSHTDFIPELAFVIEVDG 72

Query: 83  RIVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
            + G++  T         +      GP+ + P Y  +G+GR LI+ S+  A++ G   I+
Sbjct: 73  IVEGAIFYTHSKIVTEQGEFPTISFGPVFISPKYHRQGLGRNLITHSIQKAKEMGYSAIL 132

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           ++G   +Y   GF       + +        +L LPL +N      G V   +
Sbjct: 133 ILGYPYHYEPYGFCGGKKFGIAMADGHFYKGLLVLPLKENALHGKSGYVVFSD 185


>gi|326388405|ref|ZP_08210001.1| acetyltransferase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207137|gb|EGD57958.1| acetyltransferase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 169

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/156 (24%), Positives = 65/156 (41%), Gaps = 9/156 (5%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSVRMTPI----- 93
             + +  +   +F P R  R A  +RE      +LSF   +    +VG+++  P+     
Sbjct: 11  DPALVETLLDTAFEPARHQRTAYKVREGMDWLPTLSFAALDDDDMLVGTIQCWPVALTDP 70

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK-LGFQ 152
                   ++GP+ V P  Q  G G+ L++ S+ A + +     VL+GD  YY +  GF 
Sbjct: 71  QGRAHPMIMVGPVAVMPGLQGLGYGKALVTASLSAIDPRAPLPQVLIGDPEYYERFFGFS 130

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVA--QNIKGI 186
                   LP P +  R+L       V   + + G 
Sbjct: 131 NAQTGGWSLPGPFEQRRLLCRAANPAVLPREGMLGP 166


>gi|85373279|ref|YP_457341.1| putative acetyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84786362|gb|ABC62544.1| putative acetyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 173

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSVRMTPI----- 93
             + +  +  ++FG  R  R A  +RE      +LSF   +    + GS+++ P+     
Sbjct: 11  EPALVEQLLDEAFGEDRMARTAYRVREGSPWLEALSFAALDDGDFLAGSIQLWPVALATP 70

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI-----VLVGDIAYYSK 148
            ++     ++GP+ V P  Q +G G+ L+  ++ A E   +        V++GD  YY +
Sbjct: 71  DVKGHPLIMVGPVAVLPALQGEGYGKALMGAALGAVEAMAADGTSALPQVMIGDAEYYGQ 130

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA--QNIKGI 186
            GF A    +   P P DP R+L       +   + + G 
Sbjct: 131 WGFSADHTGNWHCPGPYDPARLLLRCDNPGILPDEGMLGP 170


>gi|300023212|ref|YP_003755823.1| GCN5-related N-acetyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525033|gb|ADJ23502.1| GCN5-related N-acetyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 171

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 56/156 (35%), Gaps = 11/156 (7%)

Query: 29  KIGAFFLERLE---HDSSICAMHADSFG---PGRFVRAAVLLREQGMHDLSLSFLCAEGK 82
                 + R E       +  +   +F      +     ++ R +   +L L  +     
Sbjct: 1   MTVDSLVIRDEWPADADDVENILQAAFADHPHSQQTEHLIVRRLREAGELVLPQVAVLDG 60

Query: 83  RIVGSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
            IVG    + +  S +    + LGP+ V P +Q   IG  LI   + A +  G+   V++
Sbjct: 61  TIVGHATFSAVQLSPQHEGWYGLGPVAVAPAFQGHRIGSALIDGGLRALKAMGAAGCVVL 120

Query: 141 GDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           G+  +Y +LGF+     +        P   L     
Sbjct: 121 GEPQFYRRLGFERGLGVTF---DGAPPEYFLAQAFR 153


>gi|199597776|ref|ZP_03211203.1| acetyltransferase [Lactobacillus rhamnosus HN001]
 gi|199591392|gb|EDY99471.1| acetyltransferase [Lactobacillus rhamnosus HN001]
          Length = 214

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 62/167 (37%), Gaps = 15/167 (8%)

Query: 30  IGAFFLERLEHDSS---ICAMHADSF----GPGRFVRA--AVLLREQGMHDLSLSFLCAE 80
           +      R E  S    +  +H ++F     PG       A +LR+       L  +   
Sbjct: 1   MTTNITIRTEQPSDYRTVETIHRNAFWNLYVPGA-DEHYIAHILRDHADFIPELDLVITL 59

Query: 81  GKRIVGSVRMTP-----ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
             +I+G++  T       +  +      GP+ + P YQ +G G++LI  S+  A   G  
Sbjct: 60  SGQIIGNIMYTKSKLVTATGLEKPIVTFGPVSITPAYQRRGFGKQLIEASMQQAADLGYG 119

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            IV+ GD   Y   GFQ+    ++       P  +L   L       
Sbjct: 120 AIVIFGDPDNYVARGFQSCQKFNVWAADNTQPTAMLVKELQPQTLAG 166


>gi|29346168|ref|NP_809671.1| acetyltransferase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568403|ref|ZP_04845814.1| acetyltransferase [Bacteroides sp. 1_1_6]
 gi|29338063|gb|AAO75865.1| acetyltransferase [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842476|gb|EES70556.1| acetyltransferase [Bacteroides sp. 1_1_6]
          Length = 190

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 64/173 (36%), Gaps = 13/173 (7%)

Query: 31  GAFFLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
                 R  +      I  +   +FG  +  +    L      +  +S L       VG 
Sbjct: 4   SINIQIRETNTDDFDSIMTVEKQAFGYDKEAQLVADLLADKTAEPMVSLLAFYKGEAVGH 63

Query: 88  VRMTPISIEKITGH----LLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  T    +         +L P+ V P YQ +GIG  LI   ++  ++KGS ++ ++G  
Sbjct: 64  ILFTRAYFDGQGALQMMHILAPLAVKPEYQRQGIGGMLIRAGIERLQEKGSCLVFVLGHK 123

Query: 144 AYYSKLGFQAVPWKSLILPAPVD-----PNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY + GF     + L  PAP        +  +   +        KG +RC +
Sbjct: 124 EYYPEYGFIPDAAR-LGYPAPYPILEQFSDYWMVQAISPKGFDVDKGKIRCSD 175


>gi|126734182|ref|ZP_01749929.1| hypothetical protein RCCS2_08484 [Roseobacter sp. CCS2]
 gi|126717048|gb|EBA13912.1| hypothetical protein RCCS2_08484 [Roseobacter sp. CCS2]
          Length = 177

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 12/163 (7%)

Query: 28  QKIGAFFLERLEHDSSICAMHADS---FGPGRFV---RAAVLLREQGMHDLSLSFLCAEG 81
           ++     + R E  +   A++  +   F P  F       ++ + +   DL+LS +  + 
Sbjct: 6   RQERDRMIIRAETPADHQAIYNLTRDAFAPMSFSDGSEPGIVNQLRADGDLTLSLVAEQ- 64

Query: 82  KRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           K I+G V  +P  I       + LGPI      Q +GIG KL    +    + G+   VL
Sbjct: 65  KEIIGHVAFSPAKISGGEGAWYGLGPISARADMQKQGIGTKLAHTGLGLLRELGAAGCVL 124

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            G+   Y  +GF      +L     ++P  +LF+ L     + 
Sbjct: 125 TGNPDVYCPMGFSN--DHALTYSG-LNPKYILFITLNGTAPKG 164


>gi|315147776|gb|EFT91792.1| acetyltransferase, GNAT family [Enterococcus faecalis TX4244]
 gi|315166734|gb|EFU10751.1| acetyltransferase, GNAT family [Enterococcus faecalis TX1341]
          Length = 198

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|307271224|ref|ZP_07552507.1| acetyltransferase, GNAT family [Enterococcus faecalis TX4248]
 gi|306512722|gb|EFM81371.1| acetyltransferase, GNAT family [Enterococcus faecalis TX4248]
          Length = 198

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 58/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVQLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLQLPDHTEKAVLTIGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF +     + LP
Sbjct: 121 LIILGHPTYYTKFGFVSATTFQITLP 146


>gi|256958782|ref|ZP_05562953.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|257078812|ref|ZP_05573173.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|294781163|ref|ZP_06746512.1| acetyltransferase, GNAT family [Enterococcus faecalis PC1.1]
 gi|256949278|gb|EEU65910.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256986842|gb|EEU74144.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|294451730|gb|EFG20183.1| acetyltransferase, GNAT family [Enterococcus faecalis PC1.1]
 gi|315033691|gb|EFT45623.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0017]
 gi|315036775|gb|EFT48707.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0027]
 gi|315164166|gb|EFU08183.1| acetyltransferase, GNAT family [Enterococcus faecalis TX1302]
 gi|323480526|gb|ADX79965.1| acetyltransferase (GNAT) family protein [Enterococcus faecalis 62]
 gi|329577068|gb|EGG58541.1| acetyltransferase, GNAT family [Enterococcus faecalis TX1467]
          Length = 198

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 58/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLQLPDHTEKAVLTIGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF +     + LP
Sbjct: 121 LIILGHPTYYTKFGFVSATTFQITLP 146


>gi|256618874|ref|ZP_05475720.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256598401|gb|EEU17577.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
          Length = 198

 Score = 99.6 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|229546028|ref|ZP_04434753.1| acetyltransferase [Enterococcus faecalis TX1322]
 gi|256852937|ref|ZP_05558307.1| acetyltransferase [Enterococcus faecalis T8]
 gi|307291278|ref|ZP_07571162.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0411]
 gi|229308871|gb|EEN74858.1| acetyltransferase [Enterococcus faecalis TX1322]
 gi|256711396|gb|EEU26434.1| acetyltransferase [Enterococcus faecalis T8]
 gi|306497509|gb|EFM67042.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0411]
 gi|315030954|gb|EFT42886.1| acetyltransferase, GNAT family [Enterococcus faecalis TX4000]
 gi|327534919|gb|AEA93753.1| GNAT family acetyltransferase [Enterococcus faecalis OG1RF]
          Length = 198

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|29375864|ref|NP_815018.1| acetyltransferase [Enterococcus faecalis V583]
 gi|227518558|ref|ZP_03948607.1| acetyltransferase [Enterococcus faecalis TX0104]
 gi|227553085|ref|ZP_03983134.1| acetyltransferase [Enterococcus faecalis HH22]
 gi|256762291|ref|ZP_05502871.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256965309|ref|ZP_05569480.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257089699|ref|ZP_05584060.1| predicted protein [Enterococcus faecalis CH188]
 gi|257419115|ref|ZP_05596109.1| acetyltransferase [Enterococcus faecalis T11]
 gi|300859921|ref|ZP_07106009.1| acetyltransferase, GNAT family [Enterococcus faecalis TUSoD Ef11]
 gi|307273415|ref|ZP_07554660.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0855]
 gi|307277578|ref|ZP_07558670.1| acetyltransferase, GNAT family [Enterococcus faecalis TX2134]
 gi|312899421|ref|ZP_07758752.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0470]
 gi|29343326|gb|AAO81088.1| acetyltransferase, GNAT family [Enterococcus faecalis V583]
 gi|227073977|gb|EEI11940.1| acetyltransferase [Enterococcus faecalis TX0104]
 gi|227177771|gb|EEI58743.1| acetyltransferase [Enterococcus faecalis HH22]
 gi|256683542|gb|EEU23237.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256955805|gb|EEU72437.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256998511|gb|EEU85031.1| predicted protein [Enterococcus faecalis CH188]
 gi|257160943|gb|EEU90903.1| acetyltransferase [Enterococcus faecalis T11]
 gi|300850739|gb|EFK78488.1| acetyltransferase, GNAT family [Enterococcus faecalis TUSoD Ef11]
 gi|306505843|gb|EFM75021.1| acetyltransferase, GNAT family [Enterococcus faecalis TX2134]
 gi|306509942|gb|EFM78967.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0855]
 gi|311293465|gb|EFQ72021.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0470]
 gi|315150722|gb|EFT94738.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0012]
 gi|315575647|gb|EFU87838.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0309B]
 gi|315578392|gb|EFU90583.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0630]
 gi|315579909|gb|EFU92100.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0309A]
          Length = 198

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|229551855|ref|ZP_04440580.1| possible acetyltransferase [Lactobacillus rhamnosus LMS2-1]
 gi|258539275|ref|YP_003173774.1| acetyltransferase [Lactobacillus rhamnosus Lc 705]
 gi|229314799|gb|EEN80772.1| possible acetyltransferase [Lactobacillus rhamnosus LMS2-1]
 gi|257150951|emb|CAR89923.1| Acetyltransferase [Lactobacillus rhamnosus Lc 705]
          Length = 177

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 35  LERLEHDSSICAMHADSFGP---GRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSVR 89
             +    + + A+   +F     G    AA++  LR    ++ +L  +      +VG   
Sbjct: 5   RIQQSDFADVDALLHTAFSASKRGYHDEAALVAELRRTTDYEAALEVVAMIDGHLVGYGL 64

Query: 90  MTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           MT  +I       G  L P+ V P YQ  G+G  ++S     A       +  +GD  ++
Sbjct: 65  MTAATITPDAHMNGVALWPLAVAPAYQGSGLGTAIVSELDMRATDLRRDFVSAIGDRQFF 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF+      L  P  +     L   LV  V  ++ G V   
Sbjct: 125 GRFGFRKAAAYKLEPPFSIVAEDHLIKELVPGVLASVHGKVNYA 168


>gi|260774923|ref|ZP_05883824.1| predicted acetyltransferase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609178|gb|EEX35336.1| predicted acetyltransferase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 178

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 2/119 (1%)

Query: 76  FLCAEGKRIVGSVRMTPISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           ++  E  RIVG + ++ ++ +   + +LL P+ +   YQ KGIG+ LI  ++   ++KG 
Sbjct: 53  YVATEESRIVGCILLSTMNFDSKASAYLLSPVAIATQYQGKGIGQALIGYALKELKEKGV 112

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           ++++  GD  +YSK+GFQ V    +  P P   P   L   L  N    + G   C EV
Sbjct: 113 ELVMTYGDPNFYSKVGFQQVETSIIASPYPFTQPQGWLANSLNGNAFDTVLGKPVCVEV 171


>gi|229077151|ref|ZP_04209855.1| Acetyltransferase, GNAT [Bacillus cereus Rock4-18]
 gi|228706170|gb|EEL58455.1| Acetyltransferase, GNAT [Bacillus cereus Rock4-18]
          Length = 179

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 58  VRAAVL--LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI---TGHLLGPIVVHPLY 112
              A++  +RE+  +   L  +  E   I+G   ++ + I         +L P+ V    
Sbjct: 32  AEKALVREIREKPFYIPKLDLVVEEEGIIIGHFMLSKLPISNRFENEILMLSPVSVAINK 91

Query: 113 QNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILP---APVDPNR 169
           Q +GIG+ ++   +  A K G + I++ GD  YY + GF       +       P     
Sbjct: 92  QRQGIGKYMLQEGIKFATKMGYKGIIVEGDYRYYQRFGFTTSTEFGIYASKKNLPPSVEN 151

Query: 170 VLFLPLVQNVAQNIKGIVRCR 190
           ++ L L +N  +NI G V   
Sbjct: 152 LMALELYENGLENISGEVDYS 172


>gi|126440655|ref|YP_001059337.1| acetyltransferase [Burkholderia pseudomallei 668]
 gi|126220148|gb|ABN83654.1| acetyltransferase, GNAT family [Burkholderia pseudomallei 668]
          Length = 177

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 73/161 (45%), Gaps = 9/161 (5%)

Query: 36  ERLEHDSSICAMHADSFGP---GRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           ER    +++  +   +F     G      ++   +    LS+S       R+VG V  +P
Sbjct: 17  ERAGDAAALARVIVAAFADEPQGGQFERRIVDALRADGRLSVSLGAVRDGRLVGHVAFSP 76

Query: 93  ISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           ++I       H L P+ V P  Q +GIG  L+   +DA  + G++  V++G+ A Y++ G
Sbjct: 77  VAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGCVVLGEPACYARFG 136

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           F   P   ++ P    P+ ++ LP  ++  +   G +R   
Sbjct: 137 F--GPAGDIVFPQ-APPDALMALPFGEHAPRPA-GELRYHA 173


>gi|288559478|ref|YP_003422964.1| transcriptional regulator TetR family with acetyltransferase GNAT
           family domain [Methanobrevibacter ruminantium M1]
 gi|288542188|gb|ADC46072.1| transcriptional regulator TetR family with acetyltransferase GNAT
           family domain [Methanobrevibacter ruminantium M1]
          Length = 447

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 66/166 (39%), Gaps = 28/166 (16%)

Query: 35  LERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRIV 85
           + RLE +     +           + PG +    ++  LRE       L+++  E   I+
Sbjct: 234 IMRLEEEKDYKKVENLVRDAFWNIYRPGAY-EHFIVYNLREDPSFIKDLAYIIEEDDEII 292

Query: 86  GSVRMTPISIE---------------KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE 130
           G +  +  ++                     +LGPI ++P YQN+G G +LI  ++  A+
Sbjct: 293 GHINYSKGNLNLYKKNNQGMEKINDWNEEAVVLGPIAINPKYQNQGYGFRLIKHTLRLAK 352

Query: 131 KKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPN---RVLFL 173
            K    + ++GD  YY++ GF++    +L L            +  
Sbjct: 353 NKNIPYVFVIGDENYYNRFGFESASKYNLFLEGTDTSEENPFFMIR 398


>gi|312904045|ref|ZP_07763213.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0635]
 gi|310632521|gb|EFQ15804.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0635]
          Length = 198

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLTENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSKAKLRLPDHAEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|237736716|ref|ZP_04567197.1| acetyltransferase [Fusobacterium mortiferum ATCC 9817]
 gi|229420578|gb|EEO35625.1| acetyltransferase [Fusobacterium mortiferum ATCC 9817]
          Length = 212

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 71/173 (41%), Gaps = 13/173 (7%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPGRFVRAAV-LLREQGMHDLSLSFLCAEGKR 83
              + R E +     +   +       + PG  +   V  LR        L+++     +
Sbjct: 1   MSIIIRQEEERDYRRVEEIAREAFWSLYFPGTDIPVVVNKLRRSSDFIKELTYVIEVNGK 60

Query: 84  IVGSVRMTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           + G++  T   I     E+      GP+ + P +  +G+GRKLI+ +++ A++ G + I+
Sbjct: 61  VEGAIFYTNSKIIDKKEEEHKVISFGPVFISPEFHRQGLGRKLITYTIEKAKEMGYRAII 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            +G   +Y   GF       + +P       +L L L +   +NI G V   +
Sbjct: 121 TLGYPYHYEPYGFLGGKKYGISMPDMKFYKGLLVLSLYEGALENISGYVIFSD 173


>gi|85707868|ref|ZP_01038934.1| putative acetyltransferase [Erythrobacter sp. NAP1]
 gi|85689402|gb|EAQ29405.1| putative acetyltransferase [Erythrobacter sp. NAP1]
          Length = 177

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 11/141 (7%)

Query: 44  ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMTPISIEKITG-- 100
           +  +    FG  R  R A  +R       +LSF   +    +V +++  P+++    G  
Sbjct: 19  VEQLLDRVFGEDRHARTAYRIRAGMNWLEALSFAALDADDMLVATIQCWPVALHDREGRP 78

Query: 101 ---HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI-----VLVGDIAYYSKLGFQ 152
               ++GP+ V P  Q +G G  L++  +DA  +  +        VL+GD  YY + GF 
Sbjct: 79  VPLVMVGPVAVVPERQGEGFGVGLMTAMLDAERRMAADGAPPLAQVLIGDAEYYGRFGFS 138

Query: 153 AVPWKSLILPAPVDPNRVLFL 173
           A        P P +  R+L  
Sbjct: 139 AAATGGWKCPGPYEAERLLAR 159


>gi|213021327|ref|ZP_03335774.1| putative acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 149

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVR 89
            L R+E       I A+   SF       A ++   +    L+L  +  +   ++VG V 
Sbjct: 1   MLIRVEIPIDAPGIDALLRRSF--ESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVA 58

Query: 90  MTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            +P+ ++        + P+ V   Y+ +G+ R+L+   +D+  + G   +V +GD A YS
Sbjct: 59  FSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYS 118

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
           + GF+      L    P   +      L ++
Sbjct: 119 RFGFELAAHYDLHCRWPGTESAFQVHRLAED 149


>gi|160938952|ref|ZP_02086303.1| hypothetical protein CLOBOL_03846 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437915|gb|EDP15675.1| hypothetical protein CLOBOL_03846 [Clostridium bolteae ATCC
           BAA-613]
          Length = 211

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 61/165 (36%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
              R E +     +   +       + PG      ++  +R        L F+     ++
Sbjct: 2   ITIRNEEERDYKVVEEITRKAFYNLYIPG-CAEHYLVHIMRGHEDFIPELDFVIELDGQV 60

Query: 85  VGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +G++  T          +      GP+ + P YQ +G GR LI  S + A   G  V+V+
Sbjct: 61  IGNIMYTKARLVDEAGTEKEILTFGPVSIAPEYQRRGYGRMLIEHSFEQAVLLGYDVVVI 120

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           +G    Y   GF++    ++ +     P  ++   LV N     K
Sbjct: 121 LGSPMNYVGCGFKSSRKLNICMENGKYPAAMMVKELVPNQLDGRK 165


>gi|218130300|ref|ZP_03459104.1| hypothetical protein BACEGG_01888 [Bacteroides eggerthii DSM 20697]
 gi|217987479|gb|EEC53808.1| hypothetical protein BACEGG_01888 [Bacteroides eggerthii DSM 20697]
          Length = 220

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 64/167 (38%), Gaps = 13/167 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSF----GPGRFV-RAAVLLREQGMHDLSLSFLCAEGKR 83
                RLE          +  ++F     PG +      ++R        L F+     +
Sbjct: 1   MNIELRLEQPEDYRKTEEIMREAFWNYYAPGCYEHYLLHIMRNSPNFVKELDFVAVWENK 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+GSV          +  K     +GPI V P YQ  G+G+ LI+ +   A + G + I+
Sbjct: 61  IIGSVVCLKSFIAADNGNKYEVLSMGPIAVLPKYQRMGVGKALIAHTRSVAAEMGYRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           L GD  YYSK GF A    ++          +   PL  +    + G
Sbjct: 121 LCGDPDYYSKAGFVAAEQFNIRTSENKYIAALHVCPLWPDALAGVTG 167


>gi|295112833|emb|CBL31470.1| Predicted acetyltransferase [Enterococcus sp. 7L76]
 gi|315145603|gb|EFT89619.1| acetyltransferase, GNAT family [Enterococcus faecalis TX2141]
 gi|315160311|gb|EFU04328.1| acetyltransferase, GNAT family [Enterococcus faecalis TX0645]
          Length = 198

 Score = 98.4 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 17/146 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPG---------RFVRAAVL--LREQGMHDLSLSFLCA-EG 81
              R E  +   A+   ++            R     ++  LRE       LS +   + 
Sbjct: 1   MKIRQEKPAEYQAVERLTYQAFKELNLIENWRPTEHFIVHLLRESADFIPELSLVSETDQ 60

Query: 82  KRIVGSVRMTPIS-----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQV 136
            ++ G +  +          +     +GP+ VHP  QN G+G  LI  SV  A++ G   
Sbjct: 61  GKLTGHIMSSEAKLRLPDHTEKAVLTVGPLSVHPEAQNTGVGSALIKHSVQKAKELGIGG 120

Query: 137 IVLVGDIAYYSKLGFQAVPWKSLILP 162
           ++++G   YY+K GF       + LP
Sbjct: 121 LIILGHPTYYTKFGFVPATTFQITLP 146


>gi|261219677|ref|ZP_05933958.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261322566|ref|ZP_05961763.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260924766|gb|EEX91334.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261295256|gb|EEX98752.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 118

 Score = 98.4 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 74  LSFLCAEGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131
           +S +  E  +++G +  +P+ I       + LGP+ V P  Q +GIG KLI   +     
Sbjct: 1   MSLVAEEDGQVLGHIAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRG 60

Query: 132 KGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            G++  VL+GD+ YY + GF+A   + L     V P     L    ++ Q 
Sbjct: 61  AGARGCVLLGDLGYYGRFGFKADARQKL---PGVPPEYFQCLAFGPDMPQG 108


>gi|258508000|ref|YP_003170751.1| acetyltransferase [Lactobacillus rhamnosus GG]
 gi|257147927|emb|CAR86900.1| Acetyltransferase [Lactobacillus rhamnosus GG]
 gi|259649327|dbj|BAI41489.1| putative acetyltransferase [Lactobacillus rhamnosus GG]
          Length = 177

 Score = 98.4 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 35  LERLEHDSSICAMHADSFGP---GRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSVR 89
             +    + + A+   +F     G    AA++  LR    ++ +L  +      +VG   
Sbjct: 5   RIQQSDFADVDALLHTAFSASKRGYHDEAALVAELRRTTDYEAALEVVAMIDGHLVGYGL 64

Query: 90  MTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           MT  +I       G  L P+ V P YQ  G+G  ++S     A       +  +GD  ++
Sbjct: 65  MTAATITPDAHMNGVALWPLAVAPAYQGSGLGMAIVSELDMRATDLRRDFVSAIGDRQFF 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF+      L  P  +     L   LV  V  ++ G V   
Sbjct: 125 GRFGFRKAAAYKLEPPFSIVAEDHLIKELVPGVLASVHGKVNYA 168


>gi|220911997|ref|YP_002487306.1| GCN5-related N-acetyltransferase [Arthrobacter chlorophenolicus A6]
 gi|219858875|gb|ACL39217.1| GCN5-related N-acetyltransferase [Arthrobacter chlorophenolicus A6]
          Length = 314

 Score = 98.4 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 62/174 (35%), Gaps = 19/174 (10%)

Query: 34  FLERLEHDSS---ICAMHADSFG---------PGRFVRAAVLLREQGMHD--LSLSFLCA 79
              R E  +    I A+ A++F           G  V   +L       +    LS +  
Sbjct: 139 LQLRTETPADRDAILALTAEAFAVSPATGLPAEGEPVEVKILRALFDADEYLPELSVVAV 198

Query: 80  EGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
               +VG V  T   +       LGPI V P  Q +GIG  L++ ++  A   G   I L
Sbjct: 199 LEGEVVGHVISTRGWVGSHGLLGLGPISVTPRLQRQGIGSALMAETIARANAAGESGIAL 258

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLP--LVQNVAQNIKGIVRCRE 191
           +G   YY + GF       ++ P      R   LP  L       + G  R  E
Sbjct: 259 LGSTEYYPRFGFVPSASFGVLPPDEAWGGRFQLLPLALWPG---GVHGTFRYAE 309


>gi|21219162|ref|NP_624941.1| acetyltransferase [Streptomyces coelicolor A3(2)]
 gi|6562829|emb|CAB62759.1| putative acetyltransferase [Streptomyces coelicolor A3(2)]
          Length = 173

 Score = 98.4 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 57/160 (35%), Gaps = 6/160 (3%)

Query: 37  RLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMH---DLSLSFLCAEG-KRIVGSVRMT 91
           R E  + +  +             AA++   +         LS +  +   R VG   +T
Sbjct: 11  RAETGADVPVIRDIVRAAFPTPEEAALVDALRADAGAWIEGLSLVAVDDSDRPVGHALLT 70

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              I       L P+ V P +QN G G   +  ++ AA + G   +V++G   YY + GF
Sbjct: 71  RCHIGDSPALCLAPVAVRPEHQNSGAGAAAVRAALAAAGRLGEHHVVVLGHPEYYPRFGF 130

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                  + L   V    ++ L L         G VR   
Sbjct: 131 GRASAHGIRLSIDVPDEALMVLTL-DAAHPLPAGTVRYAA 169


>gi|294055986|ref|YP_003549644.1| GCN5-related N-acetyltransferase [Coraliomargarita akajimensis DSM
           45221]
 gi|293615319|gb|ADE55474.1| GCN5-related N-acetyltransferase [Coraliomargarita akajimensis DSM
           45221]
          Length = 174

 Score = 98.4 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 62/167 (37%), Gaps = 13/167 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVR-AAVL-----LREQGMHDLSLSFLCAEGKRIVGS 87
              R    +   A+              A++     L +      SL  +  +    V  
Sbjct: 2   LKIRPASQADKDAIQGIHMSAFGENEGPAIVDLVTQLLDDTSSPTSLHLVAEQHGEPVAH 61

Query: 88  VRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           V  +P+   +     G++L P+ VHP  Q  G+G  +++  +    ++    + + GD  
Sbjct: 62  VTFSPVWSTRSDNALGYILAPLAVHPKTQQSGVGTAIVNEGLRLIRQQALPYVFVYGDPK 121

Query: 145 YYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQNIKGIVRCR 190
           YY + GF+    +    P P+  PN    L L  + A   +  VRC 
Sbjct: 122 YYCRFGFELA--RRFTAPQPLQFPNGWQVLKLDPSSADQAE-TVRCV 165


>gi|296284406|ref|ZP_06862404.1| putative acetyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 178

 Score = 98.4 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 11/144 (7%)

Query: 41  DSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSVRMTPISIEKIT 99
            +    +    FG  R  R A  +RE   H   LSF   + +  + G++ + P+S+    
Sbjct: 10  AALHEELLDAVFGDDRTTRTAYRIREGLQHLEGLSFAALDDEEFLAGTIELWPVSLTDPD 69

Query: 100 G-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAE-----KKGSQVIVLVGDIAYYSKL 149
           G      ++GP+ V P  QN+G GR L++ ++ A E     +  +   VL+GD  YY K 
Sbjct: 70  GRQYPLLMVGPVAVAPSRQNEGYGRALMAAALGAIEGPATPENPALPQVLIGDPEYYDKW 129

Query: 150 GFQAVPWKSLILPAPVDPNRVLFL 173
            F A P      P PV+ +R+L  
Sbjct: 130 DFTAGPTAGWDTPGPVERHRLLVR 153


>gi|301065460|ref|YP_003787483.1| hypothetical protein LCAZH_0340 [Lactobacillus casei str. Zhang]
 gi|300437867|gb|ADK17633.1| hypothetical protein LCAZH_0340 [Lactobacillus casei str. Zhang]
          Length = 213

 Score = 98.1 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 32  AFFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E  S    +  +H ++F     PG      A ++R        L  +     +
Sbjct: 1   MKTTIRPEQPSDYRQVETIHRNAFWNLYVPGADEHYLAHIIRNHADFVPELDLVLERNAQ 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++G++  T       +  + T    GP+ + P +Q +G G++L+ +S+  A + G   IV
Sbjct: 61  VIGNIMYTKAKLVDENGNEKTILTFGPVAIDPAFQRQGFGKQLMEVSMKRAAELGYDTIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           ++GD   Y + GF++    ++       P  ++   L  N     K
Sbjct: 121 ILGDPDNYVERGFKSCQKFNVWAADNTQPTAMIVKVLKPNALDGRK 166


>gi|239629344|ref|ZP_04672375.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239528030|gb|EEQ67031.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 213

 Score = 98.1 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 32  AFFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E  S    +  +H ++F     PG      A ++R        L  +     +
Sbjct: 1   MKTTIRPEQPSDYRQVETIHRNAFWNLYVPGADEHYLAHIIRNHADFVPELDLVLERNAQ 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++G++  T       +  + T    GP+ + P +Q +G G++L+ +S+  A + G   IV
Sbjct: 61  VIGNIMYTKAKLVDENGNEKTILTFGPVAIDPAFQRQGFGKQLMEVSMKRAAELGYDTIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           ++GD   Y + GF++    ++       P  ++   L  N     K
Sbjct: 121 ILGDPDNYVERGFKSCQKFNVWAADNTQPTAMIVKVLKPNALDGRK 166


>gi|304385358|ref|ZP_07367703.1| acetyltransferase [Pediococcus acidilactici DSM 20284]
 gi|304328565|gb|EFL95786.1| acetyltransferase [Pediococcus acidilactici DSM 20284]
          Length = 208

 Score = 98.1 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 70/173 (40%), Gaps = 20/173 (11%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLCA 79
           +   +L RLE  +      A         + PG    +V    +LR+       L+ +  
Sbjct: 1   MEKDYLIRLEQPADYRETEAMVREAFWNVYRPGCYEHYVLH--VLRKSSEFVPQLNLVME 58

Query: 80  EGKRIVGSVRMTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           +G +I+G +      +      ++     GP+ + P YQ KG G+KL+   +  A K G+
Sbjct: 59  KGHQIIGQICFVKAKMVDKNGNEVPVLTFGPLSIAPAYQRKGYGKKLLDYGIAQARKWGA 118

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPA-PVDPN--RVLFLPLVQNVAQNIK 184
            V+ + G++A+Y   GF+    K +     P +      L   L +   +  +
Sbjct: 119 SVLCIEGNLAFYKHAGFEVATTKGIRYAGEPENGEIPYFLAKELREGFFEQAQ 171


>gi|325678695|ref|ZP_08158305.1| acetyltransferase, GNAT family [Ruminococcus albus 8]
 gi|324109745|gb|EGC03951.1| acetyltransferase, GNAT family [Ruminococcus albus 8]
          Length = 207

 Score = 98.1 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 20/172 (11%)

Query: 33  FFLERLEHDSS-------ICAMHADSFGPG---RFVRAAVLLREQGMHDLSLSFLCAEGK 82
            F+ RLE ++        +     + + PG    +V    +LR+       L+F+  +  
Sbjct: 3   NFIIRLETENDRRENEFLVREAFWNVYKPGCSEHYVLH--VLRDDPAFVKELNFVMVQNG 60

Query: 83  RIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
           R++G        I    G       +GPI + P  Q+ G+GRKL+  +V+ A   G   +
Sbjct: 61  RLIGQNIFVRTVINADDGRVVDVLTMGPICITPDLQHTGLGRKLLDFTVEKARSMGFGAV 120

Query: 138 VLVGDIAYYSKLGFQAVPWKSLI---LPAPVDPNRVLFLPLVQNVAQNIKGI 186
           +  G+I +Y K GF       +    LP   D +  L   L +     + G+
Sbjct: 121 LFEGNINFYGKSGFDYAEKFGIRYHDLPDGADQSFFLCKELKEGYLDGVTGV 172


>gi|297560778|ref|YP_003679752.1| GCN5-related N-acetyltransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296845226|gb|ADH67246.1| GCN5-related N-acetyltransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 169

 Score = 98.1 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 49/143 (34%), Gaps = 5/143 (3%)

Query: 41  DSSICAMHADSFGPG-RFVRAAVLLREQGMH---DLSLSFLCA-EGKRIVGSVRMTPISI 95
              I A+             A ++   +         LS +    G   VG   ++   +
Sbjct: 11  ADDIPAIRDILLAAFPTGAEADIVDALRADPGAWVEGLSMVATTSGGTPVGYALLSRCHV 70

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVP 155
           +      L P  V P  Q  G G   I  ++ AA   G  +++++G   YY + GF    
Sbjct: 71  DGEPALALAPCAVAPSAQRTGAGSAAIRAALSAARAMGENLVLVLGHADYYPRFGFTPAS 130

Query: 156 WKSLILPAPVDPNRVLFLPLVQN 178
              +  P  V    ++ + L  +
Sbjct: 131 RFGIRAPFEVPDEAMMAMVLNGD 153


>gi|291513874|emb|CBK63084.1| Predicted acetyltransferase [Alistipes shahii WAL 8301]
          Length = 218

 Score = 97.7 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 62/178 (34%), Gaps = 19/178 (10%)

Query: 29  KIGAFFLERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLC 78
                   R E  +        +       + PG    ++    ++R+       L  + 
Sbjct: 1   MEAVELKLRTEQPADYRETENVTREAFWNLYSPGCCEHYLLH--VMRDSPAFVPELDLVA 58

Query: 79  AEGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133
               RIVG+V      +    G       LGPI V P  Q +GIG +LIS + + A + G
Sbjct: 59  ERDGRIVGNVVSLRAVLHGDDGTDCEVLSLGPISVLPECQRQGIGGRLISRTRELARELG 118

Query: 134 SQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            + ++L GD  YY   GF       +     +    +    L       I+G  R  E
Sbjct: 119 FRALLLCGDPDYYLYQGFVPAEMLGIRTADNMYAMALHVCELYDGALSGIRG--RYVE 174


>gi|296140619|ref|YP_003647862.1| GCN5-related N-acetyltransferase [Tsukamurella paurometabola DSM
           20162]
 gi|296028753|gb|ADG79523.1| GCN5-related N-acetyltransferase [Tsukamurella paurometabola DSM
           20162]
          Length = 174

 Score = 97.7 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 63/168 (37%), Gaps = 13/168 (7%)

Query: 34  FLERLEHDSSICAMHAD------SFGPGRFVRAAVL-----LREQGMHDLSLSFLCAEGK 82
            L R E    I A+ A       +  P        +     LR+       LS +     
Sbjct: 1   MLIRRELPGDIAAIAAVHRSAFAALAPPDHETPVEVGLVAALRDSSAWIPELSLVAEAAG 60

Query: 83  RIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            +VG V +T  +++      LGP+ V    Q+ G G  L+   + AA+  G  ++VL+G 
Sbjct: 61  TVVGHVCLTRGTVDDRPVLALGPLGVRTDAQSGGTGSALMHAPLSAADALGEPLVVLLGH 120

Query: 143 IAYYSKLGFQAVPWKSLILP-APVDPNRVLFLPLVQNVAQNIKGIVRC 189
             YY + GF A     +    A    +  L  PL    A  + G  R 
Sbjct: 121 AGYYPRFGFVAAADLGIRPDVADWAGDSFLARPLTSYTAD-LTGEFRY 167


>gi|330806084|ref|XP_003291004.1| hypothetical protein DICPUDRAFT_81702 [Dictyostelium purpureum]
 gi|325078840|gb|EGC32470.1| hypothetical protein DICPUDRAFT_81702 [Dictyostelium purpureum]
          Length = 185

 Score = 97.7 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/144 (24%), Positives = 58/144 (40%), Gaps = 11/144 (7%)

Query: 57  FVRAAVLLREQGM--HDLSLSFLCAE---GKRIVGSVRMTPISIEKIT------GHLLGP 105
                ++ R +G   ++     +  +     +IVG   ++ I I K           L P
Sbjct: 36  HDEHNLIQRLRGEELYNNDFEIVVKDKNDNNKIVGYALLSEIKICKNESTPPFKAVCLAP 95

Query: 106 IVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV 165
           I V P +Q +GIG+ L+    + A K     I ++G   YYSK G+      ++     V
Sbjct: 96  IAVLPSHQKQGIGKLLMKEIEEIATKYRYPAISILGSPNYYSKFGYVPSSNFNINATFDV 155

Query: 166 DPNRVLFLPLVQNVAQNIKGIVRC 189
                +  PL  N   NI+G+V  
Sbjct: 156 PKEYYMIKPLFDNSLSNIEGLVYY 179


>gi|191637126|ref|YP_001986292.1| Acetyltransferase [Lactobacillus casei BL23]
 gi|190711428|emb|CAQ65434.1| Acetyltransferase [Lactobacillus casei BL23]
 gi|327381158|gb|AEA52634.1| Transcriptional regulator TetR family with acetyltransferase GNAT
           family domain [Lactobacillus casei LC2W]
 gi|327384333|gb|AEA55807.1| Transcriptional regulator TetR family with acetyltransferase GNAT
           family domain [Lactobacillus casei BD-II]
          Length = 213

 Score = 97.7 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 32  AFFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E  S    +  +H ++F     PG      A ++R        L  +     +
Sbjct: 1   MKTTIRPEQPSDYRQVETIHRNAFWNLYVPGADEHYLAHIIRNHADFVPELDLVLERNAQ 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++G++  T       +  + T    GP+ + P +Q +G G++L+ +S+  A + G   IV
Sbjct: 61  VIGNIMYTKAKLVDENGNEKTILTFGPVAIDPAFQRQGFGKQLMEVSMKRAAELGYDTIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           ++GD   Y + GF++    ++       P  ++   L  N     K
Sbjct: 121 ILGDPGNYVERGFKSCQKFNVWAADNTQPTAMIVKVLKPNALDGRK 166


>gi|317055738|ref|YP_004104205.1| GCN5-like N-acetyltransferase [Ruminococcus albus 7]
 gi|315448007|gb|ADU21571.1| GCN5-related N-acetyltransferase [Ruminococcus albus 7]
          Length = 219

 Score = 97.3 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 61/169 (36%), Gaps = 21/169 (12%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFV----------RAAVL--LREQGMHDLSLSFLCAE 80
            ++ R E +     +   +    R                +  LR+       L ++   
Sbjct: 5   DYIIRQETEKDYREVEEMA----REAFWNLSVPGCSEHYFIHLLRQHKAFLPQLDYVLES 60

Query: 81  GKRIVGSVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
             RI+G V  +   I        T   +GP+ V   YQ +G+G+ L+  +   AE+ G  
Sbjct: 61  DGRILGCVMYSESDITDEQGCKRTVLTMGPLCVRKGYQRQGLGKALLEHTFRLAEEMGYD 120

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            ++  G+   Y   G+++    ++     + P  +L  PL   V    K
Sbjct: 121 TVINFGNPDNYVARGYKSCRKYNVCFEGDIYPAALLVKPLKDGVFDGRK 169


>gi|256789818|ref|ZP_05528249.1| acetyltransferase [Streptomyces lividans TK24]
 gi|289773701|ref|ZP_06533079.1| acetyltransferase [Streptomyces lividans TK24]
 gi|289703900|gb|EFD71329.1| acetyltransferase [Streptomyces lividans TK24]
          Length = 173

 Score = 97.3 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 56/160 (35%), Gaps = 6/160 (3%)

Query: 37  RLEHDSSICAMHADSFGPG-RFVRAAVLLREQGMH---DLSLSFLCAEG-KRIVGSVRMT 91
           R E  + +  +             AA++   +         LS +  +   R  G   +T
Sbjct: 11  RAETGADVPVIRDIVRAAFPTPEEAALVDALRADAGAWIAGLSLVAVDDSDRPAGHALLT 70

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              I       L P+ V P +QN G G   +  ++ AA + G   +V++G   YY + GF
Sbjct: 71  RCHIGDSPALCLAPVAVRPEHQNSGAGAAAVRAALAAAGRLGEHHVVVLGHPEYYPRFGF 130

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                  + L   V    ++ L L         G VR   
Sbjct: 131 GRASAHGIRLSIDVPDEALMALTL-DAAHPLPAGTVRYAA 169


>gi|270291078|ref|ZP_06197301.1| acetyltransferase [Pediococcus acidilactici 7_4]
 gi|270280474|gb|EFA26309.1| acetyltransferase [Pediococcus acidilactici 7_4]
          Length = 208

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 69/173 (39%), Gaps = 20/173 (11%)

Query: 30  IGAFFLERLEHDSSICAMHADS-------FGPG---RFVRAAVLLREQGMHDLSLSFLCA 79
           +   +L RLE  +                + PG    +V    +LR+       L+ +  
Sbjct: 1   MEKDYLIRLEQPADYRETETMVREAFWNVYRPGCYEHYVLH--VLRKSSEFVPQLNLVME 58

Query: 80  EGKRIVGSVRMTPISI-----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           +G +I+G +      +      ++     GP+ + P YQ KG G+KL+   +  A K G+
Sbjct: 59  KGHQIIGQICFVKAKMVDKNGNEVPVLTFGPLSIAPAYQRKGYGKKLLDYGIAQARKWGA 118

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPA-PVDPN--RVLFLPLVQNVAQNIK 184
            V+ + G++A+Y   GF+    K +     P +      L   L +   +  +
Sbjct: 119 SVLCIEGNLAFYKHAGFEVATTKGIRYAGEPENGEIPYFLAKELREGFFEQAQ 171


>gi|254431705|ref|ZP_05045408.1| acetyltransferase [Cyanobium sp. PCC 7001]
 gi|197626158|gb|EDY38717.1| acetyltransferase [Cyanobium sp. PCC 7001]
          Length = 180

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 11/161 (6%)

Query: 40  HDSSICAMHADSF------GPGRF--VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
              ++  +   +F        GR     A  LLR    H     F+  +   +VGS+ ++
Sbjct: 12  DADAVEQLFVRTFSDSEGEAEGRAVGALAGELLR-STPHSDLYGFVARDQDELVGSIILS 70

Query: 92  PISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            I  E   T  LL P+ +   YQ +G+G+ LI   +   ++ G ++++  GD  +Y K+G
Sbjct: 71  RIRFESAITAFLLAPVAIRTDYQRRGLGQSLIRHGLAVLKRDGIELVLTYGDPRFYGKVG 130

Query: 151 FQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCR 190
           F  V    +  P P+  P   +   L  +    I G   C 
Sbjct: 131 FAPVDASRVPAPFPLSQPEGWMVQSLSGDPIPPIPGCSSCV 171


>gi|311694231|gb|ADP97104.1| GCN5-related N-acetyltransferase [marine bacterium HP15]
          Length = 178

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/162 (25%), Positives = 63/162 (38%), Gaps = 9/162 (5%)

Query: 39  EHDSSICAMHADSFGPGR-FVRAAVLLRE------QGMHDLSLSFLCAEGKRIVGSVRMT 91
                I A+   +F          ++             D    F+  E  +IVG    T
Sbjct: 9   SDRQEIEALFTRTFSDSEGESEGKLIGHLVHELMNGAETDDIFGFIATEQGQIVGCTFFT 68

Query: 92  PISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
            +S        +L P+ V   +Q KG+G+KLI+  +D   ++G ++I   GD  YYSK+G
Sbjct: 69  RLSFGSRVNAFMLSPVAVDIDHQGKGVGQKLINFGIDHLRERGVELIFTYGDPNYYSKVG 128

Query: 151 FQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           F+ VP +    P     P   L   L     +   G   C E
Sbjct: 129 FEHVPQEVAEAPFKLTHPEGWLGQSLDGGSIKLPLGQACCVE 170


>gi|317473805|ref|ZP_07933086.1| acetyltransferase [Bacteroides eggerthii 1_2_48FAA]
 gi|316910062|gb|EFV31735.1| acetyltransferase [Bacteroides eggerthii 1_2_48FAA]
          Length = 220

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 65/167 (38%), Gaps = 13/167 (7%)

Query: 32  AFFLERLEHDSSI---CAMHADSF----GPGRFV-RAAVLLREQGMHDLSLSFLCAEGKR 83
                RLE          +  ++F     PG +      ++R        L F+     +
Sbjct: 1   MNIELRLEQPEDYRKTEEIMREAFWNYYAPGCYEHYLLHIMRNSPNFVKELDFVAVWENK 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+GSV          +  K     +GPI V P YQ  G+G+ LI+ +   A + G + I+
Sbjct: 61  IIGSVVCLKSFIAADNGNKYEILSMGPIAVLPKYQRMGVGKALIAHTRSVAAEMGYRAIL 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           L GD  YYSK GF A    ++          +   PL  +   ++ G
Sbjct: 121 LCGDPDYYSKAGFVAAEQFNIRTSENKYIAALHVCPLWPDALASVTG 167


>gi|218886582|ref|YP_002435903.1| GCN5-related N-acetyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757536|gb|ACL08435.1| GCN5-related N-acetyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 178

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 68/169 (40%), Gaps = 23/169 (13%)

Query: 34  FLERLEHD------SSICAMHADSF------GPG-RFVRAAVLLREQGMHDLSLSFLCAE 80
              R E         +I  +   +F       PG       +    +   DL+LS L  E
Sbjct: 1   MHIRDERPGNEQDSRAIIHIEYTAFKGHPMHAPGAEPTEHLIPGLLRANGDLTLSLLAEE 60

Query: 81  GKRIVGSVRMT-------PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133
               VG V ++        +  ++   HLLGP+ V P  Q +GIG  LI  ++      G
Sbjct: 61  DGAPVGHVALSPAVVGEDQVGSDRAGWHLLGPVGVLPPMQGRGIGSALIREALRRMRDAG 120

Query: 134 SQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
           +  +VLVGD  YY++LGF  VP   L  P  V    VL +     + Q 
Sbjct: 121 ALGVVLVGDPDYYTRLGFACVP--GLHYPG-VPDQYVLAVRFGDRLPQG 166


>gi|163857501|ref|YP_001631799.1| hypothetical protein Bpet3189 [Bordetella petrii DSM 12804]
 gi|163261229|emb|CAP43531.1| conserved hypothetical protein [Bordetella petrii]
          Length = 169

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 72/169 (42%), Gaps = 20/169 (11%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R E D+ + A+ + +    R           V+   +    L+LS +     R+VG 
Sbjct: 1   MLLRPETDADVAAIFSVTQDAFRHEPYSEHTEGPVIDALRAAGALALSLVAEAQGRVVGH 60

Query: 88  VRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           V  +P+SI          + LGPI V P  Q +GIG  L+   +     +G+   V++G 
Sbjct: 61  VAFSPVSIAGPGGTTAGWYGLGPIAVAPDCQGRGIGSMLVIEGLARLRGRGAAGCVVLGR 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN-IKGIVRCR 190
             YYS+ GFQ  P  +L+LP  V P   L         +   +G VR  
Sbjct: 121 PHYYSRFGFQ--PEAALVLP-DVPPEYFLVQ-----AWRGRARGTVRYH 161


>gi|119963713|ref|YP_947053.1| acetyltransferase, GNAT family protein [Arthrobacter aurescens TC1]
 gi|119950572|gb|ABM09483.1| acetyltransferase, GNAT family protein [Arthrobacter aurescens TC1]
          Length = 306

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 63/168 (37%), Gaps = 12/168 (7%)

Query: 35  LERLEHDSSICAMHADSFG----PGRFVRAAVL-------LREQGMHDLSLSFLCAEGKR 83
            E+ E    I  + A +F      G  V    +       L E   +   LS +   G  
Sbjct: 135 SEKPEDRPEILELTARAFSVSPVTGEPVEGTPIEVGLLRELFECSEYIPELSIVAEMGGE 194

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           IVG    T   IE +    LGPI V P +Q +G+G  L+  +   A   G   I L+G  
Sbjct: 195 IVGHAISTRGWIEDLELVALGPIGVLPPFQRRGVGSALMRETAARATALGEPGIALLGSP 254

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YY + G+       +  P  V  +    L L      +++G  R  E
Sbjct: 255 LYYPRFGYVPATSLGVEPPEAVWGDHFQLLTL-PGWPDDVRGTFRYAE 301


>gi|199597342|ref|ZP_03210773.1| Predicted acetyltransferase [Lactobacillus rhamnosus HN001]
 gi|199591858|gb|EDY99933.1| Predicted acetyltransferase [Lactobacillus rhamnosus HN001]
          Length = 177

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 62/164 (37%), Gaps = 8/164 (4%)

Query: 35  LERLEHDSSICAMHADSFGP---GRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSVR 89
             +    + + A+   +F     G    AA++  LR    ++ +L  +      + G   
Sbjct: 5   RIQQSDFADVDALLHTAFSASKRGYHDEAALVAELRRTADYEAALEVVAMIDGHLAGYRL 64

Query: 90  MTPISIEKI---TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           MT ++I       G  L P+ V P YQ  G+G  ++S     A       +  +GD  ++
Sbjct: 65  MTAVTITPDAHMNGVALWPLAVAPAYQGSGLGMAIVSELDMRATDLRRDFVSAIGDRQFF 124

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
            + GF+      L  P  +     L   LV  V  ++ G V   
Sbjct: 125 GRFGFRKAAAYKLEPPFSIVAEDHLIKELVPGVLASVHGKVNYA 168


>gi|220932189|ref|YP_002509097.1| Acetyltransferase [Halothermothrix orenii H 168]
 gi|219993499|gb|ACL70102.1| Acetyltransferase [Halothermothrix orenii H 168]
          Length = 185

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/166 (28%), Positives = 77/166 (46%), Gaps = 12/166 (7%)

Query: 37  RLEHDSSICAMHADSFGPGRFVRA------AVLLREQGMHDLS--LSFLCAEGKRIVGSV 88
           RLE    I  +   +F       +       ++       D     +F+    K+I+GS+
Sbjct: 13  RLEKIKEIKQLFIKTFS-DSEGESEGKLIGNLVFDLMTKTDSQDLHAFIAISNKKIIGSI 71

Query: 89  RMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
             + +  E  +I   LL P+ VHP YQ KGIG+KLI+      +K G +++   GDI +Y
Sbjct: 72  IFSRLRFERSQINAFLLSPVAVHPAYQGKGIGQKLINFGHTDLKKNGVELVFTYGDINFY 131

Query: 147 SKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCRE 191
           SK+G++ +P K +  P  +  P   L   LV +  + I G   C E
Sbjct: 132 SKVGYKVIPEKVVKAPLELSYPEGWLAQSLVSDNIEPISGNSYCVE 177


>gi|328875678|gb|EGG24042.1| hypothetical protein DFA_06180 [Dictyostelium fasciculatum]
          Length = 197

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 72/185 (38%), Gaps = 32/185 (17%)

Query: 32  AFFLERLEHDSSICAMHADS---FGPGRFV---RAAVLLREQGMHDLSLSFLC--AEGKR 83
              + + E  S I ++   +   F            ++   +  + L++S +    +  +
Sbjct: 1   MKIVIQEESQSDIQSIEDVTIEAFASAEHTSHTEQFIVRSLRNSNMLTVSLVAKCEDTGK 60

Query: 84  IVGSVRMTPISIEKI---------------------TGHLLGPIVVHPLYQNKGIGRKLI 122
           IVG +  +PI+I                          + L P+ V P YQNKGIG  L+
Sbjct: 61  IVGHIAASPITINNNNNNNNNDTDVNQSTTITTTTTKWYGLAPLSVLPAYQNKGIGTLLV 120

Query: 123 SMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
              + + +  G+   V++G   YY + GF+A     L+LP  V P     L    +   N
Sbjct: 121 DRLLRSLKDIGADGCVVLGSPKYYGRFGFKADST-KLVLPN-VPPEYFQLLQFNHDS-NN 177

Query: 183 IKGIV 187
            +G +
Sbjct: 178 SRGCI 182


>gi|227533124|ref|ZP_03963173.1| acetyltransferase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227189226|gb|EEI69293.1| acetyltransferase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 213

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 13/166 (7%)

Query: 32  AFFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                R E  S    +  +H ++F     PG      A ++R+       L+ +     +
Sbjct: 1   MTTTIRPEQPSDYRQVETIHRNAFWNLYVPGADEHYLAHIIRDHADFVPELALVLERNAQ 60

Query: 84  IVGSVRMTPISIEKI-----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++G++  T   +        T    GP+ + P +Q +G G++L+ +S+  A + G   IV
Sbjct: 61  VIGNIMYTKAKLIDEAVVEKTILTFGPVAIDPAFQRQGFGKQLMEVSMKRAVELGYDTIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
           + GD   Y + GF++    ++       P  +L   L  NV    K
Sbjct: 121 IFGDPDNYVERGFKSCQKFNVWAANNTQPTAMLVKVLKPNVLDGRK 166


>gi|229488996|ref|ZP_04382862.1| acetyltransferase, gnat family protein [Rhodococcus erythropolis
           SK121]
 gi|229324500|gb|EEN90255.1| acetyltransferase, gnat family protein [Rhodococcus erythropolis
           SK121]
          Length = 172

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 54/153 (35%), Gaps = 10/153 (6%)

Query: 34  FLERLEHDSSICAMHAD---SFG----PGR---FVRAAVLLREQGMHDLSLSFLCAEGKR 83
              R E  S   A+++    +F     PG     +     L     +   LS +   G  
Sbjct: 1   MYIRRETSSDRDAIYSLLGAAFADQAPPGESPYEIELTRQLFASNDYLPKLSLVAVAGDE 60

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           IVG V  T   +  +    LGP+ V P  Q  G+G  L+   + A++     ++ L+G  
Sbjct: 61  IVGFVIGTRGWVGPVEAVGLGPLAVTPDNQRSGVGSALMHAVIGASDALDVPLLALLGST 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
            YY + GF       +  P            L 
Sbjct: 121 EYYPQFGFVTSTDAGIESPEAEWGEHFQIRTLT 153


>gi|294011469|ref|YP_003544929.1| putative acetyltransferase [Sphingobium japonicum UT26S]
 gi|292674799|dbj|BAI96317.1| putative acetyltransferase [Sphingobium japonicum UT26S]
          Length = 170

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 8/157 (5%)

Query: 42  SSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEG-KRIVGSVRMTPI-----SI 95
            +I  +   +FG  R  R A L+R+       LSF   +   R++GS++  P+       
Sbjct: 11  DAIERLLDAAFGADRHGRTAYLIRDGMPWLPQLSFGMEDERGRLIGSLQSWPVALAHADG 70

Query: 96  EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL-GFQAV 154
            +    ++GP+ V P  Q  G GR L+   V AA  + S  ++++GD  YY +  GF A 
Sbjct: 71  GRTPLIMVGPVAVDPAVQGTGHGRALMDAVVAAARAQRSDPLMMIGDPEYYGRFWGFSAE 130

Query: 155 PWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                  P P +P R+L L  V        G++  R 
Sbjct: 131 ATGGWDCPGPFEPRRLLALS-VDGRPLGGTGMLGPRA 166


>gi|262190035|ref|ZP_06048335.1| predicted acetyltransferase [Vibrio cholerae CT 5369-93]
 gi|262034089|gb|EEY52529.1| predicted acetyltransferase [Vibrio cholerae CT 5369-93]
          Length = 180

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R+VGS+  + +S   +   +LL P+ V   +  +GIG+ LI   ++A
Sbjct: 49  DDLFVFVACDDHQRVVGSILFSKLSFPNEENVYLLAPVAVATKWHGQGIGQALIRFGLEA 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            + KG  +++  GDI +YSK+GF A+  + +  P  +  P   L   L       I G  
Sbjct: 109 LKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|238061863|ref|ZP_04606572.1| GCN5 N-acetyltransferase [Micromonospora sp. ATCC 39149]
 gi|237883674|gb|EEP72502.1| GCN5 N-acetyltransferase [Micromonospora sp. ATCC 39149]
          Length = 181

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 58/154 (37%), Gaps = 12/154 (7%)

Query: 34  FLERLEHDSSICAMHA-DSFGPGR-------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              R E  +    +    +    R        VR    LR        L+ +   G  +V
Sbjct: 4   LRLRPEGPADTAPVRRVLTAAFARPDVATPPEVRLVEDLRGTDAWIPELAMVAEYGGEVV 63

Query: 86  GSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   +T + +           LGP+ V P  Q  G G  ++  ++DAA + G +++V++G
Sbjct: 64  GYALLTRVQVRDDDQPAPALALGPVAVAPHRQRIGHGTAVVQAALDAATELGERLVVVLG 123

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
           D AYY + GF       L  P     +    L L
Sbjct: 124 DPAYYRRFGFTRADRMGLTSPWSGLGDPWQALVL 157


>gi|160894039|ref|ZP_02074818.1| hypothetical protein CLOL250_01594 [Clostridium sp. L2-50]
 gi|156864417|gb|EDO57848.1| hypothetical protein CLOL250_01594 [Clostridium sp. L2-50]
          Length = 236

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 13/167 (7%)

Query: 29  KIGAFFLERLEHDSSICAMHADS---F----GPG-RFVRAAVLLREQGMHDLSLSFLCAE 80
           +     + R E       +       F     PG      A L+R        L F+  E
Sbjct: 21  RREREMIIRNEKTDDYRVVEEMIKEIFWNLSVPGCNEHYFAHLVRNSEDFIPELDFVLEE 80

Query: 81  GKRIVGSVRMTP---ISIEK--ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
             +I+GS+       ++++         GP  +HP YQ KG GRKL+  S++AA K G  
Sbjct: 81  DGKIIGSIIYVKAKLVAMDGTEKEILSFGPFTIHPDYQRKGYGRKLLEHSLEAARKLGFD 140

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            I + G+   Y+  GF+     ++ +   V P  ++   L ++  + 
Sbjct: 141 TIAIWGNPENYACYGFKNCKRYNVCIDKDVYPVALMVKVLDEDALEG 187


>gi|84489608|ref|YP_447840.1| acetyltransferase [Methanosphaera stadtmanae DSM 3091]
 gi|84372927|gb|ABC57197.1| predicted acetyltransferase [Methanosphaera stadtmanae DSM 3091]
          Length = 202

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 17/169 (10%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
            + R E  +    +           + PG +    ++  +R        L +L  E   I
Sbjct: 1   MIIRQEIKTDYREVENLVRESFWNIYRPGCY-EHYIIHNMRYAKSFIKQLDYLIEEDNHI 59

Query: 85  VGSVRMT----PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140
           +  +         + E  T  +LGP+ VHP YQ +G G K+I+ ++  AE+ G   I++V
Sbjct: 60  IAHIVYANGKIHSNNESKTLPILGPVSVHPKYQKQGYGSKIINYTLKKAEEMGYPGIIVV 119

Query: 141 GDIAYYSKLGFQAVPWKSLILPA-PVDPNR--VLFLPLVQNVAQNIKGI 186
           GD  YYS+ GF+     ++       +      +     +N   + +GI
Sbjct: 120 GDEKYYSRFGFEKAFKYNIHYEGMDRNDEAPFFMIKVFDKNKINDYQGI 168


>gi|159040534|ref|YP_001539787.1| GCN5-related N-acetyltransferase [Salinispora arenicola CNS-205]
 gi|157919369|gb|ABW00797.1| GCN5-related N-acetyltransferase [Salinispora arenicola CNS-205]
          Length = 186

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 66/171 (38%), Gaps = 17/171 (9%)

Query: 34  FLERLEHDSSICAMH---ADSFG-P--GRFVRAAVLLREQGMHD--LSLSFLCAEGKRIV 85
              R E  +   A+    A +F  P         ++   +G  +   SL+ +   G  +V
Sbjct: 7   MRLRSEDPADTGAVRRVLAAAFARPDVATPPEVGLVDELRGSAEWLPSLAMVAEYGGEVV 66

Query: 86  GSVRMTPIS------IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           G   +T +        +      LGP+ V P  Q  G+G  ++  ++DAA + G +++V+
Sbjct: 67  GYALLTRVRVRSESDRDDAPALALGPVAVSPHRQRIGLGTAVVQAALDAAAELGERLVVV 126

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL---VQNVAQNIKGIV 187
           +GD AYY + GF       L  P          L L           +G V
Sbjct: 127 LGDPAYYRRFGFGRADRIGLTSPWSGLGEPWQALTLPAARGGAESPPRGEV 177


>gi|328545266|ref|YP_004305375.1| acetyltransferase, GNAT family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326415008|gb|ADZ72071.1| Acetyltransferase, GNAT family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 177

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 65/150 (43%), Gaps = 8/150 (5%)

Query: 34  FLERLEHDSSICAMHA-DSFGPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMT 91
              R  + +   A+HA  +   G+   A ++   +    L L  +     +RIVG +  +
Sbjct: 10  VTIRPVNPADEPAVHAVIAAAFGQETEAGLVHDLRHCGALVLERVAETPDRRIVGHIAFS 69

Query: 92  PISIEKITGHL----LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYS 147
            ++       L    L  + VHP +Q  GIG +L+  S+    K G  +++++G  AYY 
Sbjct: 70  RVTGAGAGHRLHVSCLASLSVHPDFQRLGIGSQLVESSLADLRKAGEDLVLVLGPPAYYP 129

Query: 148 KLGFQAVPWKSLILPAPVDPNRVLFLPLVQ 177
           + GF  V  + +    P   N  + + L +
Sbjct: 130 RFGFDPVLAQKVH--GPYAGNAFMAMALTE 157


>gi|308177123|ref|YP_003916529.1| GNAT family acetyltransferase [Arthrobacter arilaitensis Re117]
 gi|307744586|emb|CBT75558.1| putative GNAT-family acetyltransferase [Arthrobacter arilaitensis
           Re117]
          Length = 171

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 59/153 (38%), Gaps = 9/153 (5%)

Query: 34  FLERLEHDSSICAMHADSFGPGRF----VRAAVLLREQGMH-----DLSLSFLCAEGKRI 84
              R E      A++A +          V    +   Q +      D   S +  +   +
Sbjct: 1   MRIRPEVFDDRAAVYALTHAAFAGIDPMVEPEEVGLLQNLFNCEQYDSRFSIVALDDTAV 60

Query: 85  VGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           +G V  T   +E      LGP+ V P YQ++G+G  L+    D AE++    IVL+G  A
Sbjct: 61  IGHVIATWGEVEGEALLGLGPLAVAPEYQHRGVGSILMQEIHDKAEEERVSGIVLLGAPA 120

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQ 177
           YY + G+     + +I    +     +     +
Sbjct: 121 YYRRFGYGPAQAQGIIPTQSMWGEHFMVRVFDE 153


>gi|160880360|ref|YP_001559328.1| GCN5-related N-acetyltransferase [Clostridium phytofermentans ISDg]
 gi|160429026|gb|ABX42589.1| GCN5-related N-acetyltransferase [Clostridium phytofermentans ISDg]
          Length = 196

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 4/127 (3%)

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPI-SIEKITGHLL---GPIVVHPLYQNKGIGR 119
           LR+   +   LS +  +   ++G +  +    ++    H +   GP+ V P +Q  G+G 
Sbjct: 35  LRQDKDYLPELSRIAVKDGVVIGCIMYSKALVVDGADTHEIITFGPLCVEPKWQGSGVGE 94

Query: 120 KLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNV 179
            L+  +++ A  KG + IV+ G+  YY ++GF+      +      + +  + + LV++ 
Sbjct: 95  LLLRETMNLAANKGYKGIVIFGEPDYYPRIGFKTCDNFHIKTADGKNFDAFMGIELVKDG 154

Query: 180 AQNIKGI 186
            +NIKG 
Sbjct: 155 MKNIKGK 161


>gi|328949373|ref|YP_004366710.1| GCN5-related N-acetyltransferase [Treponema succinifaciens DSM
           2489]
 gi|328449697|gb|AEB15413.1| GCN5-related N-acetyltransferase [Treponema succinifaciens DSM
           2489]
          Length = 214

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 62/165 (37%), Gaps = 15/165 (9%)

Query: 34  FLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRI 84
              R E  +   A+   +       + PG      +L   R +      L  +  E   +
Sbjct: 10  ITFRNETPADYRAVENLTREAFWNVYKPG-CDEHFILHNFRTRSEFVPELDIIMEEEGIL 68

Query: 85  VGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           VG V          + + +     GPI +   +++KG G  L+  +++ A+K     + +
Sbjct: 69  VGHVMFVRAEIKLNNSKTLPIMTFGPISIALEFKHKGYGTVLLRYAMEKAKKMDCGALAI 128

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK 184
            G+I +Y K GF     K +   A  D +  L   LV +    +K
Sbjct: 129 TGNIDFYGKNGFVVAKTKGVRYYADPDADYFLIKELVPSFLDEVK 173


>gi|59713298|ref|YP_206073.1| acetyltransferase [Vibrio fischeri ES114]
 gi|59481546|gb|AAW87185.1| acetyltransferase [Vibrio fischeri ES114]
          Length = 178

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 2/125 (1%)

Query: 69  MHDLSLSFLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVD 127
             D    F+  +  +IVGS+  T ++ E   T  LL P+V+   YQNKG+G+ LI+  ++
Sbjct: 46  DSDDMFIFVAKDNGKIVGSIFFTRLTFEIDTTAFLLCPVVIDTEYQNKGVGQTLINHGLE 105

Query: 128 AAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNR-VLFLPLVQNVAQNIKGI 186
             +++G +++   G+  +Y ++GF+ V  +    P P+      L   L   V   I G 
Sbjct: 106 VLKQEGVELVFTYGEPKFYERVGFEIVSEEQFKSPIPLSYLYSWLAQSLNDEVLTYIPGR 165

Query: 187 VRCRE 191
            +C  
Sbjct: 166 SKCVA 170


>gi|226308344|ref|YP_002768304.1| hypothetical protein RER_48570 [Rhodococcus erythropolis PR4]
 gi|226187461|dbj|BAH35565.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 172

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 56/158 (35%), Gaps = 10/158 (6%)

Query: 34  FLERLEHDSSICAMHAD---SFG----PGRFVRAAVLLRE---QGMHDLSLSFLCAEGKR 83
              R E  S   A+++    +F     PG       L R+      +   LS +   G  
Sbjct: 1   MYIRRETSSDRDAIYSLLGAAFADQAPPGETPYEIELTRQLFASDDYLPKLSLVAVAGGE 60

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           IVG V  T   +  +    LGP+ V P  Q  G+G  L+   V A +     +I L+G  
Sbjct: 61  IVGFVIGTRGWVGPVEAVGLGPLAVTPGNQRSGVGSALMHAVVGACDALDVPLIALLGST 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
            YY + GF       +  P            L  + A 
Sbjct: 121 EYYPRFGFVTSTDVGVESPEAEWGAHFQIRTLTTHRAD 158


>gi|284007695|emb|CBA73451.1| acetyltransferase [Arsenophonus nasoniae]
          Length = 138

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 47/129 (36%), Gaps = 4/129 (3%)

Query: 66  EQGMHDLSLSFLCAEG-KRIVGSVRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKL 121
            +      L  +  +   +I+G +  T + +          L P+ V   YQ +GIG KL
Sbjct: 4   LRQDGLFVLEMVATDDKGQIIGYIGFTLVDVNGDKECQWVGLAPLAVASAYQRQGIGAKL 63

Query: 122 ISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ 181
           +   +D+  + G + +V+VGD  YY + GF       L               L      
Sbjct: 64  VYDGLDSLNEFGYKAVVVVGDPNYYRRFGFTLAQQHGLTCKWSGMEAYFQVYALENGNLA 123

Query: 182 NIKGIVRCR 190
           +  G V   
Sbjct: 124 DYAGRVNFS 132


>gi|85375223|ref|YP_459285.1| acetyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84788306|gb|ABC64488.1| acetyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 167

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 11/145 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRF------VRAAVLLREQGMHDLSLSFLCAE-GKRI 84
                R E      A+ A +    R           ++ R +   DL+LS +     + I
Sbjct: 1   MKIAIRPEQPGDERAIRALTDAAFRDMVHADGDEGPLVERLRADGDLTLSLVALSADEAI 60

Query: 85  VGSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           VG +  +P+S    +   + L P+ V PL Q  GIG  LI   +      G++ I LVGD
Sbjct: 61  VGHIAFSPVSIEHGEAPWYQLAPVSVIPLRQKTGIGSDLIEKGLSDMRGAGAKGIALVGD 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVDP 167
             YYS+ GF       L L   +DP
Sbjct: 121 PDYYSRFGFTR--EHDLSLSDELDP 143


>gi|111221731|ref|YP_712525.1| GNAT family acetyltransferase [Frankia alni ACN14a]
 gi|111149263|emb|CAJ60949.1| putative acetyltransferase GNAT family [Frankia alni ACN14a]
          Length = 172

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 62/168 (36%), Gaps = 12/168 (7%)

Query: 35  LERLEHDSSICAMHADS-FGPGRFVRAAVL---------LREQGMHDLSLSFLCA-EGKR 83
           + R E      A+         R V   +L         LR       +LS +       
Sbjct: 1   MVRREIAGDAAAIRTVVGTAFARPVEQDLLPAEVTLVDELRASAAWIPALSLVATTAAGE 60

Query: 84  IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           I+G V  T  +++       GP+ V P +Q +G+G  L+   + AA+  G  ++ L+GD 
Sbjct: 61  IIGQVLCTRAAVDLSPVLAFGPLSVRPDHQRRGVGHALMHAMLGAADALGEPLVGLLGDP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
            YYS+ GF+      +  P P          L  +     +G     E
Sbjct: 121 GYYSRFGFRPSDACGITAPQPAWGAHFQIRTLTAHGPSP-RGRFSYPE 167


>gi|229527770|ref|ZP_04417161.1| hypothetical protein VCG_000842 [Vibrio cholerae 12129(1)]
 gi|229334132|gb|EEN99617.1| hypothetical protein VCG_000842 [Vibrio cholerae 12129(1)]
          Length = 180

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R+VGS+  + +S   +    LL P+ V   +  +GIG+ LI   ++A
Sbjct: 49  DDLFVFVACDDYQRVVGSILFSKLSFPNEENVFLLAPVAVATKWHGQGIGQALIRFGLEA 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            + KG  +++  GDI +YSK+GF A+  + +  P  +  P   L   L       I G  
Sbjct: 109 LKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|297579626|ref|ZP_06941553.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535272|gb|EFH74106.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 180

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R+VGS+  + +S   +    LL P+ V   +  +GIG+ LI   ++A
Sbjct: 49  DDLFVFVACDDHQRVVGSILFSKLSFPNEENVFLLAPVAVATKWHGQGIGQALIRFGLEA 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            + KG  +++  GDI +YSK+GF A+  + +  P  +  P   L   L       I G  
Sbjct: 109 LKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|15601031|ref|NP_232661.1| acetyltransferase, putative [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121587130|ref|ZP_01676906.1| acetyltransferase, putative [Vibrio cholerae 2740-80]
 gi|121728091|ref|ZP_01681128.1| acetyltransferase, putative [Vibrio cholerae V52]
 gi|147672422|ref|YP_001215803.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|153215271|ref|ZP_01949915.1| acetyltransferase, putative [Vibrio cholerae 1587]
 gi|153819506|ref|ZP_01972173.1| acetyltransferase, putative [Vibrio cholerae NCTC 8457]
 gi|153822545|ref|ZP_01975212.1| acetyltransferase, putative [Vibrio cholerae B33]
 gi|227811885|ref|YP_002811895.1| putative acetyltransferase [Vibrio cholerae M66-2]
 gi|229506581|ref|ZP_04396090.1| hypothetical protein VCF_001800 [Vibrio cholerae BX 330286]
 gi|229510623|ref|ZP_04400103.1| hypothetical protein VCE_002031 [Vibrio cholerae B33]
 gi|229517246|ref|ZP_04406691.1| hypothetical protein VCC_001267 [Vibrio cholerae RC9]
 gi|229526116|ref|ZP_04415520.1| hypothetical protein VCA_000224 [Vibrio cholerae bv. albensis
           VL426]
 gi|229606060|ref|YP_002876764.1| hypothetical protein VCD_001010 [Vibrio cholerae MJ-1236]
 gi|254850539|ref|ZP_05239889.1| acetyltransferase [Vibrio cholerae MO10]
 gi|255745936|ref|ZP_05419883.1| predicted acetyltransferase [Vibrio cholera CIRS 101]
 gi|262168236|ref|ZP_06035934.1| predicted acetyltransferase [Vibrio cholerae RC27]
 gi|298500108|ref|ZP_07009914.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9657660|gb|AAF96174.1| acetyltransferase, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548666|gb|EAX58716.1| acetyltransferase, putative [Vibrio cholerae 2740-80]
 gi|121629639|gb|EAX62060.1| acetyltransferase, putative [Vibrio cholerae V52]
 gi|124114810|gb|EAY33630.1| acetyltransferase, putative [Vibrio cholerae 1587]
 gi|126509967|gb|EAZ72561.1| acetyltransferase, putative [Vibrio cholerae NCTC 8457]
 gi|126519905|gb|EAZ77128.1| acetyltransferase, putative [Vibrio cholerae B33]
 gi|146314805|gb|ABQ19345.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|227011027|gb|ACP07238.1| putative acetyltransferase [Vibrio cholerae M66-2]
 gi|227014931|gb|ACP11140.1| putative acetyltransferase [Vibrio cholerae O395]
 gi|229336274|gb|EEO01292.1| hypothetical protein VCA_000224 [Vibrio cholerae bv. albensis
           VL426]
 gi|229345282|gb|EEO10255.1| hypothetical protein VCC_001267 [Vibrio cholerae RC9]
 gi|229353068|gb|EEO18008.1| hypothetical protein VCE_002031 [Vibrio cholerae B33]
 gi|229356932|gb|EEO21850.1| hypothetical protein VCF_001800 [Vibrio cholerae BX 330286]
 gi|229372546|gb|ACQ62968.1| hypothetical protein VCD_001010 [Vibrio cholerae MJ-1236]
 gi|254846244|gb|EET24658.1| acetyltransferase [Vibrio cholerae MO10]
 gi|255735690|gb|EET91088.1| predicted acetyltransferase [Vibrio cholera CIRS 101]
 gi|262023479|gb|EEY42182.1| predicted acetyltransferase [Vibrio cholerae RC27]
 gi|297542089|gb|EFH78140.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 180

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R+VGS+  + +S   +    LL P+ V   +  +GIG+ LI   ++A
Sbjct: 49  DDLFVFVACDDHQRVVGSILFSKLSFPNEENVFLLAPVAVATKWHGQGIGQALIRFGLEA 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            + KG  +++  GDI +YSK+GF A+  + +  P  +  P   L   L       I G  
Sbjct: 109 LKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|254454888|ref|ZP_05068325.1| acetyltransferase, gnat family [Octadecabacter antarcticus 238]
 gi|198269294|gb|EDY93564.1| acetyltransferase, gnat family [Octadecabacter antarcticus 238]
          Length = 163

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 35  LERLEHDSS---ICAMHADSF---GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
             R E +     I  + A +F     G    A ++   +    L LS + A   +I+G V
Sbjct: 4   KIRQETEGDEVAITQVVARAFEGKSYGDENDAKLVDALRDAGALVLSLVAAHKGQIIGQV 63

Query: 89  RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK 148
            ++P  I +     +GP+ V P +Q KG+G  L+  ++  A+  G   +VL GD+ YY++
Sbjct: 64  ALSPAKIGEGRYLCVGPLAVLPEHQRKGVGTGLMGHALGVAQVYGRDGVVLQGDLNYYAR 123

Query: 149 LGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
            GF+  P  S           +  LP          G V+   V
Sbjct: 124 FGFETFPSVSYAGEG---AQFIQVLPFKG----TPSGEVKFHPV 160


>gi|116669714|ref|YP_830647.1| GCN5-related N-acetyltransferase [Arthrobacter sp. FB24]
 gi|116609823|gb|ABK02547.1| GCN5-related N-acetyltransferase [Arthrobacter sp. FB24]
          Length = 331

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 61/171 (35%), Gaps = 15/171 (8%)

Query: 34  FLERLEHDSSICAMHADSFGP------------GRFVRAAV--LLREQGMHDLSLSFLCA 79
            + R E  +   A+   +               G  V   +   L +   +    S +  
Sbjct: 156 LVLRTEQPADRPAILELTAAAFSVSPVTGLPVDGEPVEVGLLKQLFDCDEYLPEFSIVAE 215

Query: 80  EGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +   +VG V  T   +  +    LGPI V P  Q  GIG  L+  +V  A   G + I L
Sbjct: 216 QNGEVVGHVISTRGWVGDLELLGLGPIGVVPRLQRHGIGSALMQETVSRANAAGERGIAL 275

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCR 190
           +G   YYS+ GF       +  P+    +   FLPL       I G  R  
Sbjct: 276 LGSPEYYSRFGFVPSVSLGVEPPSAEWGDAFQFLPLAV-WPGGIHGTFRYA 325


>gi|149185906|ref|ZP_01864221.1| putative acetyltransferase [Erythrobacter sp. SD-21]
 gi|148830467|gb|EDL48903.1| putative acetyltransferase [Erythrobacter sp. SD-21]
          Length = 180

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 64/143 (44%), Gaps = 11/143 (7%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKR-IVGSVRMTPI----- 93
             + +  +   +FG  R  R A  +RE      +LSF   + +  +VGS+++ P+     
Sbjct: 11  DPALVEQLLDAAFGEQRHARTAYRIREGLDPLPALSFATLDQEEYLVGSIQLWPVALTDP 70

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK-----KGSQVIVLVGDIAYYSK 148
                   ++GP+ V P  Q +G G+ L++ S+ A +            VL+GD  YY +
Sbjct: 71  KGRPHPLIMVGPVAVMPGRQGEGFGKALMAASLGAIDAGFDDGAPPFPQVLIGDPDYYGQ 130

Query: 149 LGFQAVPWKSLILPAPVDPNRVL 171
            GF A    +   P P +  R+L
Sbjct: 131 WGFTAEHTGAWHCPGPFERERLL 153


>gi|254425573|ref|ZP_05039290.1| acetyltransferase, GNAT family [Synechococcus sp. PCC 7335]
 gi|196187996|gb|EDX82961.1| acetyltransferase, GNAT family [Synechococcus sp. PCC 7335]
          Length = 176

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 8/149 (5%)

Query: 40  HDSSICAMHADSFGPGRF----VRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISI 95
             + I  +H  +F  G        A  LL E+     +LS +      +VG V  +P++I
Sbjct: 11  DIADIRKVHLCAFSEGEKQKVSALAVNLLSEETNP-STLSLVAEADGVVVGHVAFSPVTI 69

Query: 96  EKITGHL--LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
              +     L P+ V P YQ + IG  L+   ++   + G   + + GD  YY K GF +
Sbjct: 70  NNKSWLGYILAPLGVKPEYQKRQIGSNLVKSGIERLSQVGVDAVFVYGDPHYYGKFGFNS 129

Query: 154 VPWKSLILPAPV-DPNRVLFLPLVQNVAQ 181
                   P  +  P     + L +N+  
Sbjct: 130 DIASKYSSPYELQYPFGWQAIALSENILT 158


>gi|103487594|ref|YP_617155.1| GCN5-related N-acetyltransferase [Sphingopyxis alaskensis RB2256]
 gi|98977671|gb|ABF53822.1| GCN5-related N-acetyltransferase [Sphingopyxis alaskensis RB2256]
          Length = 167

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 6/141 (4%)

Query: 40  HDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKIT 99
             +++  +   +FG  RF R A  +R       +LSF   E   +VG+++  P++     
Sbjct: 11  EPAAVEDLLDAAFGADRFERIAYRIRNGMKAVPALSFAAVEKGALVGAIQCWPVAHRAAD 70

Query: 100 G-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSK-LGFQA 153
           G      ++GP+ V P  Q  G GR L++  + AAE      ++++GD  YY +  GF  
Sbjct: 71  GTATPLVMVGPVAVRPDVQRGGYGRALMAQMLAAAETAADGALMMIGDPEYYGRFFGFTV 130

Query: 154 VPWKSLILPAPVDPNRVLFLP 174
                  LP P +  R+L  P
Sbjct: 131 DATGEWDLPGPFERRRLLARP 151


>gi|261212552|ref|ZP_05926837.1| predicted acetyltransferase [Vibrio sp. RC341]
 gi|260838483|gb|EEX65139.1| predicted acetyltransferase [Vibrio sp. RC341]
          Length = 180

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R++GS+  + +S   +   +LL P+ V   +  +GIG+ LI   ++ 
Sbjct: 49  DDLFVFVACDDHQRVIGSILFSKLSFPNEENVYLLAPVAVATKWHGQGIGQALIRFGLET 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            ++K    ++  GDI +YSK+GF A+    +  P  +  P   L   L       I G  
Sbjct: 109 LKEKDISHVITYGDIRFYSKVGFTAINEGMIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|114705120|ref|ZP_01438028.1| GCN5-related N-acetyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114539905|gb|EAU43025.1| GCN5-related N-acetyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 169

 Score = 95.0 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGRFVR------AAVLLREQGMHDLSLSFLCAEG-KRI 84
                R E  +    +   +      V       A +L   +    L LS +  +   +I
Sbjct: 1   MEITIRKERAADHETIRRLTEAAFEAVEESDGSEADILDALRADEALELSLVAVDETDQI 60

Query: 85  VGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            G +  + I+IE        LGPI V P YQ  GIG +L+   +    K G+   VLVGD
Sbjct: 61  FGHIAFSRITIESGEPQWFGLGPISVWPKYQRGGIGSRLVQAGLLEIRKLGANGCVLVGD 120

Query: 143 IAYYSKLGFQAV 154
             +YS+  F++ 
Sbjct: 121 PNFYSRFSFESD 132


>gi|145597052|ref|YP_001161349.1| GCN5-related N-acetyltransferase [Salinispora tropica CNB-440]
 gi|145306389|gb|ABP56971.1| GCN5-related N-acetyltransferase [Salinispora tropica CNB-440]
          Length = 178

 Score = 95.0 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 63/165 (38%), Gaps = 18/165 (10%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVL----------LREQGMHDLSLSFLCAEGKR 83
              R E  +   A+       G F R  V           LR       SL+ +   G  
Sbjct: 1   MRLRPEEPADTGAVRRVL--AGAFARPDVTTPPEIGLVDELRGSAEWLPSLAMVAEYGGE 58

Query: 84  IVGSVRMTPIS----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           +VG   +T +      + +    LGP+ V P  Q  G+G  ++  ++DAA + G +++V+
Sbjct: 59  VVGYALLTRVRVRSDRDDVAALALGPVAVAPHRQRIGLGSAVVQAALDAAVELGERLVVV 118

Query: 140 VGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL--VQNVAQN 182
           +GD A+Y + GF       L  P            L  V   A+ 
Sbjct: 119 LGDPAFYRRFGFGRADRLGLTSPWSGLGEPWQARVLPSVDGGAEP 163


>gi|124486503|ref|YP_001031119.1| hypothetical protein Mlab_1691 [Methanocorpusculum labreanum Z]
 gi|124364044|gb|ABN07852.1| GCN5-related N-acetyltransferase [Methanocorpusculum labreanum Z]
          Length = 184

 Score = 95.0 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 63/162 (38%), Gaps = 8/162 (4%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEK 97
               + +  +  ++FG  +       L E       +S L   G   VG +  T  S+E 
Sbjct: 13  ASDFNDVMIVEKEAFGYDKEAILVAELLEDTTAQPVVSLLAFAGDEPVGHILFTKASLEG 72

Query: 98  IT----GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF-Q 152
                  +LL P+ V P +QNKGIG  LI   +   +  G  ++ ++G  AYY K GF +
Sbjct: 73  PGPAPLIYLLAPLAVRPAFQNKGIGGMLILEGLKRLKDMGVVLVFVLGHEAYYPKYGFVE 132

Query: 153 AVPWKSLILPAPVD---PNRVLFLPLVQNVAQNIKGIVRCRE 191
                    P P+        +   L  +    + G V C +
Sbjct: 133 GAERMGFAAPYPIPEIHAGAWMVQNLGSDDYAGVFGRVVCAD 174


>gi|254505753|ref|ZP_05117899.1| acetyltransferase [Vibrio parahaemolyticus 16]
 gi|219551406|gb|EED28385.1| acetyltransferase [Vibrio parahaemolyticus 16]
          Length = 178

 Score = 95.0 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 65/166 (39%), Gaps = 9/166 (5%)

Query: 35  LERLEHDSSICAMHADSFGPGR-FVRAAVLLREQGMHDLSLS------FLCAEGKRIVGS 87
           L R E    I  +   +F           + R       + S       +  +   I  S
Sbjct: 5   LFRPEQTQQIIELFTRTFSDSEGEAEGKAIGRLVADLLATTSCEDRYVVVAEKENAIFAS 64

Query: 88  VRMTPISIEKIT-GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
           + +T +S +      L+ P+ V    Q KG+G+ +++  +    ++G  +    GD  YY
Sbjct: 65  ILLTRLSYDSPEQAFLVAPVAVATEVQGKGVGQAILNYGLQLLRQEGVSLAFTYGDPNYY 124

Query: 147 SKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +K+GF+AV       P P+  P+  L   L +     I+G  +C  
Sbjct: 125 AKVGFEAVLESDYPAPLPLSYPHGWLAQSLTEQPLSAIQGSSQCVA 170


>gi|118589717|ref|ZP_01547122.1| acetyltransferase, GNAT family protein [Stappia aggregata IAM
           12614]
 gi|118437803|gb|EAV44439.1| acetyltransferase, GNAT family protein [Stappia aggregata IAM
           12614]
          Length = 179

 Score = 95.0 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 59/152 (38%), Gaps = 10/152 (6%)

Query: 34  FLERLEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLCAE-GKRIVGSVRMT 91
              R        A+           + A ++   +    L L  +  +   RIVG +  +
Sbjct: 10  LTIRNVTPDDEAAVRELVMSAFPSDMEARLVHTLRHCGALVLEQVAVDADGRIVGHIAYS 69

Query: 92  PISI------EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
            ++       + +    L PI V P  Q  GIG  LI  S+D  +  G  +++++G  +Y
Sbjct: 70  RVTPAAVGSGQGMQVVCLAPISVWPDRQKTGIGSALIKASLDCLKDLGEDLVLVLGPPSY 129

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQ 177
           Y + GF  V  + +    P   +  + L L +
Sbjct: 130 YPRFGFDPVLARKVQ--GPYAGDAFMALALTE 159


>gi|291518625|emb|CBK73846.1| Predicted acetyltransferase [Butyrivibrio fibrisolvens 16/4]
          Length = 218

 Score = 94.6 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 63/167 (37%), Gaps = 16/167 (9%)

Query: 33  FFLERLEHDSSICAMHADS-------FGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKR 83
               RLE +    A+   +       + PG       +  +R        L+F+  +   
Sbjct: 3   NIKIRLETELDYRAVEELTRNAFWNVYKPGA-DEHYFVHTMRNHPDFIPDLAFVLEKDGE 61

Query: 84  IVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           I+G++  T   +E   G        GP+ + P YQ   +G+KLI  S + A K G  V +
Sbjct: 62  IIGNIMYTKAWLEDENGNKKEIVSFGPLCLAPEYQRLKLGKKLIEHSFEVARKMGYDVNI 121

Query: 139 LVGDIAYYSKLGFQAVPWKSL-ILPAPVDPNRVLFLPLVQNVAQNIK 184
             G+   Y   GF +   K++        P  +L   LV  V    +
Sbjct: 122 NFGNPGNYVGRGFVSCRKKNVSCFQKGNYPTALLVCELVPGVLDGHE 168


>gi|58426659|gb|AAW75696.1| acetyltransferase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 192

 Score = 94.6 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 25  MKVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIASLRQDGALALSLVADHDGYVV 84

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++   +      LGP+ V P +Q +G+G +L   ++    ++G+   + +G+ 
Sbjct: 85  GHLAVSPVTLSDDSPGWFALGPLAVGPGHQRQGLGTRLAQAALATLRERGAAGCLALGEP 144

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP  V  + +  L     + 
Sbjct: 145 AFFRRLGFAVEP--GLVLP-DVPASELQALAFGDRLL 178


>gi|166711553|ref|ZP_02242760.1| acetyltransferase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 168

 Score = 94.6 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 67/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +  +   +V
Sbjct: 1   MKVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIASLRQDGALALSLVADDDGYVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++   +      LGP+ V P +Q +G+G +L   ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVTLSDDSPGWFALGPLAVGPGHQRQGLGTRLAQAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP  V  + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVLP-DVPASELQALAFGDRLL 154


>gi|37677188|ref|NP_937584.1| acetyltransferase [Vibrio vulnificus YJ016]
 gi|37201733|dbj|BAC97554.1| predicted acetyltransferase [Vibrio vulnificus YJ016]
          Length = 214

 Score = 94.6 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 12/170 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGR-FVRAAVL------LREQGMHDLSLSFLCAEGKR 83
               L   S+I A+      +F          ++      L EQ  +D    ++ AEG+ 
Sbjct: 37  MHYTLADKSAIEAIKTLFCQTFTDSEGEAEGQLIGQLASDLIEQTHNDDLFIYIAAEGEA 96

Query: 84  IVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           +VG++  T +         ++ P+ V   Y  +GIG+ LI+  +   + +G +V V  GD
Sbjct: 97  VVGAILFTRLHYPCGTPVFVMAPVAVATSYHGQGIGQALIAFGLQEIKAQGVEVAVTYGD 156

Query: 143 IAYYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQNIKGIVRCRE 191
             +Y K GF  V  +++  P  +  P+      L       +KG V C  
Sbjct: 157 PNFYHKTGFVPVDTQTIAAPYSLQFPHGWQAQSLTGEALPVLKGPVTCVA 206


>gi|313618416|gb|EFR90438.1| acetyltransferase [Listeria innocua FSL S4-378]
          Length = 106

 Score = 94.2 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 37/90 (41%)

Query: 100 GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSL 159
              L P+ V P YQ K +G  L+   +  + +K    I ++G   YY + GF      ++
Sbjct: 9   ILGLAPLAVLPEYQGKRVGSSLMEEGIRLSREKAYPAIAVLGHADYYPRFGFIPSNQFAI 68

Query: 160 ILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
             P  V     + L L     +N+ G +  
Sbjct: 69  PAPFDVPSEYFMLLELYDGSLENLAGTIHY 98


>gi|326775286|ref|ZP_08234551.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
 gi|326655619|gb|EGE40465.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
          Length = 422

 Score = 94.2 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 64/159 (40%), Gaps = 8/159 (5%)

Query: 37  RLEHDSSICAMHADSFG--PGRFVRAAVLLREQGMHD---LSLSFLCAE-GKRIVGSVRM 90
           R E  +   A+HA +    P R   A ++   +   +     LS +       +     +
Sbjct: 260 RRETPADRAAVHAVNTAAFPTR-DEADLVDALRADAEAWLPGLSHVAEAPDGSLAAYALL 318

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T   +       L P+   P +Q +G G+ ++   +DAA  +G  +++++G  AYY + G
Sbjct: 319 TRCRVGDAPALALAPVATSPAHQRQGAGQAVVRAVLDAARVRGEALVLVLGHPAYYPRFG 378

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           F       +     V    ++ L L  +V     G++R 
Sbjct: 379 FVPASRYGIRPGFEVPDEAMMALVLDDSVPVPA-GLIRY 416


>gi|289663109|ref|ZP_06484690.1| acetyltransferase [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289670044|ref|ZP_06491119.1| acetyltransferase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 168

 Score = 94.2 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/157 (19%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MNVLIREASEGDAAAIELLTMVAFMRAEHSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++   +      LGP+ V P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVTLSDDSPGWFALGPLAVGPGHQRQGLGTRLVQAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+ P  V  + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVFP-DVPASELQALAFGDRLL 154


>gi|144225208|emb|CAJ41445.1| putative acetyltransferase [Serratia liquefaciens]
          Length = 134

 Score = 94.2 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 46/114 (40%), Gaps = 2/114 (1%)

Query: 80  EGKRIVGSVRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
               +VG    +P+ +        +L P+ V    + +G+G KLI   +D+        +
Sbjct: 16  HEGGVVGYAAFSPVDVAGEDRQWVVLAPLAVAESLRRQGLGEKLIYEGLDSLNHFTYAAV 75

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           V++GD AYY   GF+      L    P         PL +N   + +G V   E
Sbjct: 76  VVLGDPAYYGHFGFKPAAAYGLQCRWPGSEAAFQVYPLAENALDDARGAVEFSE 129


>gi|239983715|ref|ZP_04706239.1| putative transferase [Streptomyces albus J1074]
 gi|291455523|ref|ZP_06594913.1| acetyltransferase [Streptomyces albus J1074]
 gi|291358472|gb|EFE85374.1| acetyltransferase [Streptomyces albus J1074]
          Length = 208

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 53/148 (35%), Gaps = 5/148 (3%)

Query: 35  LERLEHDSSICAMHADSFGPGRFVR-AAVLLREQGMH---DLSLSFLCAE-GKRIVGSVR 89
             R E  + I A+             A ++   +         LS +       + G   
Sbjct: 5   TTRPETPADIPAVREIVTAAFPTAEEADLVDALRADPQAWIDGLSVVAEAADSTLAGYAL 64

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
            T   ++      L P+ V P +Q +G G  +I   +D A   G  +++++G   YY K 
Sbjct: 65  FTRCHVDGAPALALAPVAVLPAFQRQGAGAAVIRAGLDTARSLGENLVLVLGHPEYYPKF 124

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQ 177
           GF      S+  P  V    ++ L L  
Sbjct: 125 GFAPASRWSVRAPFEVPDEALMGLTLAP 152


>gi|134295948|ref|YP_001119683.1| GCN5-like N-acetyltransferase [Burkholderia vietnamiensis G4]
 gi|134139105|gb|ABO54848.1| GCN5-related N-acetyltransferase [Burkholderia vietnamiensis G4]
          Length = 179

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 34  FLERLEHDSSICAM---HADSFGPGRF----VRAAVLLREQGMHDLSLSFLCAEGKRIVG 86
              R E    + A+    A +F  G          ++   +    L +S +     R++G
Sbjct: 11  VTLRDERARDVDAIGRVIAAAFA-GEPQQGQRERQIVDALRAAGALGVSLVAERDDRVIG 69

Query: 87  SVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
            +  +P++I         + L P+ V P  + + +G  L+   +DA  + G+   V++GD
Sbjct: 70  HIAFSPVAIGGASPDSRWYALAPLAVRPDCRRQSVGAGLVRTGLDALRRLGAHGCVVLGD 129

Query: 143 IAYYSKLGFQAVPWKSLI 160
            AYY++ GF      +L 
Sbjct: 130 PAYYARFGFAPCSDLALH 147


>gi|262163506|ref|ZP_06031252.1| hypothetical protein VIG_003418 [Vibrio cholerae INDRE 91/1]
 gi|262028073|gb|EEY46732.1| hypothetical protein VIG_003418 [Vibrio cholerae INDRE 91/1]
          Length = 180

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 71  DLSLSFLCAEG-KRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDA 128
           D    F+  +  +R+VGS+  + +S   +    LL P+ V   +  +GIG+ LI   ++A
Sbjct: 49  DDLFVFIACDDHQRVVGSILFSKLSFPNEENVFLLAPVAVATKWHGQGIGQALIRFGLEA 108

Query: 129 AEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIV 187
            + KG  +++  GDI +YSK+GF A+  + +  P  +  P   L   L       I G  
Sbjct: 109 LKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKP 168

Query: 188 RCRE 191
            C E
Sbjct: 169 TCLE 172


>gi|27367424|ref|NP_762951.1| putative acetyltransferase [Vibrio vulnificus CMCP6]
 gi|27358993|gb|AAO07941.1|AE016811_182 Predicted acetyltransferase [Vibrio vulnificus CMCP6]
          Length = 178

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 69/170 (40%), Gaps = 12/170 (7%)

Query: 34  FLERLEHDSSICAMHAD---SFGPGR-FVRAAVL------LREQGMHDLSLSFLCAEGKR 83
               L   S+I A+      +F          ++      L EQ  +D    ++ AEG+ 
Sbjct: 1   MHYTLADKSAIEAIKTLFCQTFTDSEGEAEGQLIGQLASDLIEQTHNDDLFIYIAAEGEA 60

Query: 84  IVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
           +VG++  T +         ++ P+ V      +GIG+ LI+  +   + +G +V V  GD
Sbjct: 61  VVGAILFTRLHYPCGTPVFVMAPVAVATSCHGQGIGQALIAFGLQEIKAQGVEVAVTYGD 120

Query: 143 IAYYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQNIKGIVRCRE 191
             +Y K GF  V  +++  P  +  P+      L       +KG V C  
Sbjct: 121 PNFYHKTGFVPVDTQTIAAPYSLQFPHGWQAQSLTGEALPVLKGPVTCVA 170


>gi|84623972|ref|YP_451344.1| acetyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|122879188|ref|YP_201081.6| acetyltransferase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188576324|ref|YP_001913253.1| acetyltransferase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84367912|dbj|BAE69070.1| acetyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520776|gb|ACD58721.1| acetyltransferase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 168

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MKVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIASLRQDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P++   +      LGP+ V P +Q +G+G +L   ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVTLSDDSPGWFALGPLAVGPGHQRQGLGTRLAQAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP  V  + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVLP-DVPASELQALAFGDRLL 154


>gi|310828368|ref|YP_003960725.1| hypothetical protein ELI_2781 [Eubacterium limosum KIST612]
 gi|308740102|gb|ADO37762.1| hypothetical protein ELI_2781 [Eubacterium limosum KIST612]
          Length = 169

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 49/130 (37%), Gaps = 8/130 (6%)

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITG-----HLLGPIVVHPLYQNKGIG 118
           LRE       L F+     +++G        I+   G       +GPI + P  + KG G
Sbjct: 5   LREDPAFIPELDFVMELDGKMIGQNMFMKAVIKSDDGRDVPIITMGPICITPELKRKGYG 64

Query: 119 RKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLI---LPAPVDPNRVLFLPL 175
           + L+  S++     G   +   G+I +Y K GF       +    LP   D +  L   L
Sbjct: 65  KILLDYSLEKVAAMGFGAVCFEGNIDFYGKSGFTYASEYGIRYHGLPEGEDASFFLCKEL 124

Query: 176 VQNVAQNIKG 185
           +      I G
Sbjct: 125 IPGYLDGITG 134


>gi|261251610|ref|ZP_05944184.1| predicted acetyltransferase [Vibrio orientalis CIP 102891]
 gi|260938483|gb|EEX94471.1| predicted acetyltransferase [Vibrio orientalis CIP 102891]
          Length = 178

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 55/116 (47%), Gaps = 2/116 (1%)

Query: 77  LCAEGKRIVGSVRMTPISIEKI-TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
           +  +G  IVG +  T ++ E      L+ P+ V   YQ KG+G+ LI   +   + +G +
Sbjct: 54  VARDGSDIVGCILFTRLAFENESECFLMAPVAVRTDYQGKGVGQGLIQFGLTEMQNQGIK 113

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCR 190
           +    GD  +YSK GF+ V  ++   P P+  P+  +   L +   + + G   C 
Sbjct: 114 LAFTYGDPNFYSKTGFEPVSEQAFKAPLPLSFPHGWMAQSLGEEKIEALSGSSTCV 169


>gi|284045051|ref|YP_003395391.1| GCN5-related N-acetyltransferase [Conexibacter woesei DSM 14684]
 gi|283949272|gb|ADB52016.1| GCN5-related N-acetyltransferase [Conexibacter woesei DSM 14684]
          Length = 177

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 56/152 (36%), Gaps = 8/152 (5%)

Query: 32  AFFLERLEHDSSICA---MHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGK--RIVG 86
                R E      A   +H  +F           LR +G     L  +  E    R++G
Sbjct: 1   MSLGLRPERQEDHAAARRVHERAFPTAAEADLVDALRAEGAVVPELCLVAVERGAERVLG 60

Query: 87  SVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG--SQVIVLVGDI 143
            +  +   ++  +   +L P+ V P  Q +GIG  L+  ++  A        ++ ++G  
Sbjct: 61  HIVFSRARLDSGVPLLVLAPVAVDPDAQRRGIGGALVREALRRAPAAAPGVPLVSVLGHA 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPL 175
            YY + GF+      +  P  V  +  +   L
Sbjct: 121 DYYPRFGFEPAAPLGIRAPFDVPDDAWMAFRL 152


>gi|157960767|ref|YP_001500801.1| GCN5-like N-acetyltransferase [Shewanella pealeana ATCC 700345]
 gi|157845767|gb|ABV86266.1| GCN5-related N-acetyltransferase [Shewanella pealeana ATCC 700345]
          Length = 178

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 74  LSFLCAEGKRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKK 132
             F+  E   + G +  + ++    I   +L P+ V P +Q +G+G+KLI   +D+ + K
Sbjct: 51  FIFVAIEADTLAGCIMFSKLTFATGINAFILSPVAVQPSFQRQGVGQKLIQFGLDSLQSK 110

Query: 133 GSQVIVLVGDIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G ++    GD  YYSK+GF+ +  + +  P     P   L L L  +  Q + G   C  
Sbjct: 111 GVELAFTYGDPNYYSKVGFKQISEEVVKAPQALTYPEGWLSLSLTGDELQPVIGRCSCVA 170


>gi|167010229|ref|ZP_02275160.1| Acetyltransferase [Francisella tularensis subsp. holarctica FSC200]
          Length = 108

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 2/103 (1%)

Query: 90  MTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
           MT    E +  + L P+ V P YQ++GIG KLI   +  A+K     I ++G  +YY K 
Sbjct: 1   MTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAIIKEAKKNNIDAIFVLGHPSYYPKF 60

Query: 150 GFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG-IVRCRE 191
           GF+      +     V  +  + L L      ++KG  V   E
Sbjct: 61  GFKPATEYQIKCEYDVPADVFMVLDLSAK-LASLKGQTVYYAE 102


>gi|238064026|ref|ZP_04608735.1| transferase [Micromonospora sp. ATCC 39149]
 gi|237885837|gb|EEP74665.1| transferase [Micromonospora sp. ATCC 39149]
          Length = 423

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 61/158 (38%), Gaps = 7/158 (4%)

Query: 38  LEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSL---SFLCAE-GKRIVGSVRMTPI 93
            +  ++I  ++  +F PG  + A ++   +      L   S++  +      G   +T  
Sbjct: 265 PDDRAAIRRINLSAF-PG-PLEADLVDALREDRQAWLPWSSWIAEDPNGAPAGFALLTRC 322

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
            ++ +    LGP  V P  Q  G G   I  ++DAA      +++++G   YY + GF  
Sbjct: 323 HVDGVPALALGPCSVLPEQQRTGAGSAAIRAALDAARAADENLVLVLGHAPYYPRFGFTP 382

Query: 154 VPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
                +  P  V    ++ L          +G +R   
Sbjct: 383 ASGYGIRPPFDVPDENMMALVFDPARPVP-RGTIRYAA 419


>gi|182434769|ref|YP_001822488.1| putative transferase [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|178463285|dbj|BAG17805.1| putative transferase [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 422

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 64/159 (40%), Gaps = 8/159 (5%)

Query: 37  RLEHDSSICAMHADSFG--PGRFVRAAVLLREQGMHD---LSLSFLCAE-GKRIVGSVRM 90
           R E  +   A+HA +    P R   A ++   +   +     LS +       +     +
Sbjct: 260 RRETPADRAAVHAVNTAAFPTR-DEADLVDALRADAEAWLPGLSHVAEAPDGSLAAYALL 318

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
           T   +       L P+   P +Q +G G+ ++   +DAA  +G  +++++G  AYY + G
Sbjct: 319 TRCRVGDAPALALAPVATSPAHQRQGAGQAVVRAVLDAARVRGEALVLVLGHPAYYPRFG 378

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           F       +     V    ++ L L  +V     G++R 
Sbjct: 379 FVPASRYGIRPGFAVPDEAMMALVLDDSVPVPA-GLIRY 416


>gi|54027178|ref|YP_121420.1| putative acetyltransferase [Nocardia farcinica IFM 10152]
 gi|54018686|dbj|BAD60056.1| putative acetyltransferase [Nocardia farcinica IFM 10152]
          Length = 186

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 35  LERLEHDSSICAMHADSFG--PG-----RFVRAAVLLREQGMH--DLSLSFLCAEGKRIV 85
            ER    ++I  +H  +F   PG          A++ R +       +LS +  E   +V
Sbjct: 17  RERAADAAAIAQVHRSAFATAPGSANLPEPPEVALVERLRRDPGWIATLSLVAVEHDDVV 76

Query: 86  GSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           G V +T  ++       LGP+ V   +Q +G+G  L+  ++ AA+     +I L+G + Y
Sbjct: 77  GHVCLTRAAVGPFPALGLGPLGVRADHQGRGVGSALMHAALGAADALDESLIGLLGSLEY 136

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
           Y + GF       +    P   +     PL 
Sbjct: 137 YPRFGFVPAARLGIAPDEPEWASHFQVRPLT 167


>gi|290993348|ref|XP_002679295.1| GCN5-related N-acetyltransferase [Naegleria gruberi]
 gi|284092911|gb|EFC46551.1| GCN5-related N-acetyltransferase [Naegleria gruberi]
          Length = 224

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 49/147 (33%), Gaps = 32/147 (21%)

Query: 66  EQGMHDLSLSFLCAEGKRIVGSVRMTPI-------------------------------S 94
           E+      LS +      IVG   +T                                  
Sbjct: 58  EESSFIPELSLVAELEDEIVGFALLTKCLLVPHHQQQSSSECSTNNNLTSLTTSTEEKQQ 117

Query: 95  IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAV 154
            E I    L P+ + P Y   GIG  L+  +   A++ G   +VLVG   YY + G++ +
Sbjct: 118 QESIISLCLAPLAIKPQYHKMGIGSLLMREAHKRAKELGFTSVVLVGHEHYYPRFGYRLM 177

Query: 155 PWKSLILPA-PVDPNRVLFLPLVQNVA 180
               + +P   +     + + LV+   
Sbjct: 178 REFGISVPYQDIPAQYCMVIELVEGCL 204


>gi|21230996|ref|NP_636913.1| acetyltransferase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768999|ref|YP_243761.1| acetyltransferase [Xanthomonas campestris pv. campestris str. 8004]
 gi|21112618|gb|AAM40837.1| acetyltransferase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574331|gb|AAY49741.1| acetyltransferase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 168

 Score = 93.0 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   D    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MSVLIREASDGDAAAIEVLTMVAFMRAEHSRHDEQHVIAALRNDDALALSLVADHDGYVV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S        LGP+ V P +Q +G+G +L+  ++    ++G+   V  G+ 
Sbjct: 61  GHLAVSPVALSDGSSGWFALGPLAVGPGHQRQGLGTRLVQAALATLRERGAAGCVAHGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
            ++ +LGF   P  S+     V  + +  L     + 
Sbjct: 121 GFFRRLGFAVEPGLSV---PDVPASELQALAFGDRLL 154


>gi|307330977|ref|ZP_07610108.1| GCN5-related N-acetyltransferase [Streptomyces violaceusniger Tu
           4113]
 gi|306883363|gb|EFN14418.1| GCN5-related N-acetyltransferase [Streptomyces violaceusniger Tu
           4113]
          Length = 182

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 20/163 (12%)

Query: 34  FLERLEHDSSICAMHADSFGPGR---------------FVRAAVL--LREQGMHDLSLSF 76
            L R E  S I A+ A +                     V  A+L  LR       +LSF
Sbjct: 1   MLIRRETRSDIDAIRAVTSAAFAKSDTSDTTGTPHTPVPVETALLDELRISDGWLPALSF 60

Query: 77  LCAEGK-RIVGSVRMT--PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133
           +    +  ++G V  T   +  +      LGP+ VHP +Q +G+G+ L+   + AA+  G
Sbjct: 61  VATADRAEVIGHVVCTRGHVGSDLALALGLGPLSVHPAHQRRGVGQALVHAVLGAADAFG 120

Query: 134 SQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV 176
             ++ L+G  AYY + GF+      +  P P   +      L 
Sbjct: 121 ESLVALLGSPAYYGRFGFRPSTDYGITAPDPAWGDYFQVRTLT 163


>gi|78047189|ref|YP_363364.1| putative N-acetyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325928193|ref|ZP_08189402.1| putative acetyltransferase [Xanthomonas perforans 91-118]
 gi|78035619|emb|CAJ23301.1| putative N-acetyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325541489|gb|EGD13022.1| putative acetyltransferase [Xanthomonas perforans 91-118]
          Length = 168

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 65/157 (41%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L LS +      +V
Sbjct: 1   MNVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIAGLRQDGALVLSLVADHDGYVV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S +      LGP+ V P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVALSDDSPGWFALGPLAVGPGHQRQGLGTRLVQAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L LP  V  + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLALP-EVPASELQALAFGDRLL 154


>gi|188992113|ref|YP_001904123.1| Putative N-acetyltransferase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167733873|emb|CAP52079.1| Putative N-acetyltransferase [Xanthomonas campestris pv.
           campestris]
          Length = 183

 Score = 92.7 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/157 (19%), Positives = 61/157 (38%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   D    A+   +          R     V+   +    L+LS +      +V
Sbjct: 16  MSVLIREASDGDAAAIEVLTMVAFMRAEHSRHDEQHVIAALRNDDALALSLVADHDGYVV 75

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S        LGP+ V P +Q +G+G +L+  ++    ++G+   V  G+ 
Sbjct: 76  GHLAVSPVALSDGSSGWFALGPLAVGPGHQRQGLGTRLVQAALATLRERGAAGCVAYGEP 135

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
            ++ +LGF   P  S+        + +  L     + 
Sbjct: 136 GFFRRLGFAVEPGLSV---PDAPASELQALAFGDRLL 169


>gi|21242342|ref|NP_641924.1| acetyltransferase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107776|gb|AAM36460.1| acetyltransferase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 168

 Score = 92.7 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 67/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S +      LGP+ V P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVALSDDSPGWFALGPLAVGPGHQRQGLGARLVQAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP  V  + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVLP-EVPASELQALAFGDRLL 154


>gi|78358211|ref|YP_389660.1| acetyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78220616|gb|ABB39965.1| acetyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 178

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 48/120 (40%), Gaps = 2/120 (1%)

Query: 74  LSFLCAEGKRIVGSVRMTPIS-IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKK 132
                 E   +VG +  T ++  +     L+ P+ V    Q KG G+ LI   ++  ++ 
Sbjct: 51  YCVTATEDGEVVGCIIFTRLTLTDGPVAFLMAPVAVLTGCQGKGTGQMLIKSGLEKLKEH 110

Query: 133 GSQVIVLVGDIAYYSKLGFQAVPWKSLILPAP-VDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           G +++   GD  +Y K GF+ V    +  P     P   L   L     + + G   C E
Sbjct: 111 GVELVFTYGDPDFYGKTGFRPVSEDVVRAPLKLTYPEGWLGQSLAGTGIRPVAGRSYCVE 170


>gi|325921116|ref|ZP_08182987.1| putative acetyltransferase [Xanthomonas gardneri ATCC 19865]
 gi|325548388|gb|EGD19371.1| putative acetyltransferase [Xanthomonas gardneri ATCC 19865]
          Length = 168

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   D    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MDVLIREASDGDAAAIELLTMVAFMRSDHSRHDEQHVIAALRNDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+S   +    H LGP+ + P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVSLSDDSPGWHALGPLAIGPGHQRQGLGTRLVQSALANLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP  V  + +  L     + 
Sbjct: 121 AFFKRLGFAVEP--GLVLP-DVPVSELQALAFGDRLL 154


>gi|167569763|ref|ZP_02362637.1| GCN5-related N-acetyltransferase [Burkholderia oklahomensis C6786]
          Length = 140

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 5/118 (4%)

Query: 63  LLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRK 120
           +   +    L+L  +  +   IVG +   P+  +      + L P+ V P  QN G+G  
Sbjct: 2   IDALRKDDALTLGLVAVDDDAIVGHIAFPPVLNDGKRLDWYALAPLAVRPDRQNAGVGGV 61

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
           L    +D     G+   V++G   +Y + GF A    SL     V P   +      +
Sbjct: 62  LAREGLDRLRLLGAHGCVVLGHPDHYGRFGFIARAALSLT---GVPPEYFIARSFTTD 116


>gi|88703314|ref|ZP_01101030.1| acetyltransferase, GNAT family protein [Congregibacter litoralis
           KT71]
 gi|88702028|gb|EAQ99131.1| acetyltransferase, GNAT family protein [Congregibacter litoralis
           KT71]
          Length = 179

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 76  FLCAEGKRIVGSVRMTPISI-EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           F+ A+ + +  ++  +P+S  +   G LL P+ V    Q +GIG +LI   ++A + +G 
Sbjct: 54  FVAADQQGLEAAIIFSPLSFAKGDAGFLLSPVAVRSKTQGQGIGSRLIRHGLEALKAQGH 113

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQNIKGIVRCR 190
            ++   GD AYYS+ GF AV  + ++ P P+  P   L + L  +    ++G ++C 
Sbjct: 114 DIVFTYGDPAYYSRFGFVAVSHEKVVAPYPLSMPVGWLAVSLKGDDVTKLEGRLQCV 170


>gi|302338470|ref|YP_003803676.1| GCN5-related N-acetyltransferase [Spirochaeta smaragdinae DSM
           11293]
 gi|301635655|gb|ADK81082.1| GCN5-related N-acetyltransferase [Spirochaeta smaragdinae DSM
           11293]
          Length = 221

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 62/174 (35%), Gaps = 13/174 (7%)

Query: 32  AFFLERLEHDSSICAMHADS-------FGPG-RFVRAAVLLREQGMHDLSLSFLCAEGKR 83
                RLE       +   +       + PG        +LR+       L F+     +
Sbjct: 1   MNIDIRLEAQDDYKKVEELTREAFWNLYMPGCDEHYLCHILRDHKDFIKELDFVAEIDGK 60

Query: 84  IVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIV 138
           ++ S+  T         +K+     GP+ VHP YQ KGIG  LI  + +  E      IV
Sbjct: 61  LIASIMYTRSFLLGDDNDKVEIVSFGPLCVHPEYQRKGIGTALIEKTRNVVENMNIPAIV 120

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
           + GD   Y K GF+      +       P  +L L +        K  +R  +V
Sbjct: 121 IYGDPHNYCKHGFRNGIDYQVSNMDGEYPLGLLVLEIQSGFFGQKKWKIRQSDV 174


>gi|298250109|ref|ZP_06973913.1| GCN5-related N-acetyltransferase [Ktedonobacter racemifer DSM
           44963]
 gi|297548113|gb|EFH81980.1| GCN5-related N-acetyltransferase [Ktedonobacter racemifer DSM
           44963]
          Length = 147

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 34  FLERLEH---DSSICAMHADSFGPGRFVRAAVL--LREQGMHDLSLSFLCAEGKRIVGSV 88
            L R E     + I A+HA +FG  R + A ++  LR++   D  LS +  E  +IVG V
Sbjct: 1   MLIRPEQVSDYADIGALHARAFG-NRSLEAVIVMLLRQRRAFDPELSLVAEENGQIVGHV 59

Query: 89  RMTPISI----EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
             +P  +    + +    L P+ V P+YQ +G+G +LI      A  +G  + +L+G  +
Sbjct: 60  LFSPYQMRLLGQTLPIVNLAPLAVDPVYQRRGVGGQLIIRGHAIAATRGYALSILLGHSS 119

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNRVL 171
           YY        P    I  + + P+R L
Sbjct: 120 YYRS------PTLGQIWTSHIHPDRFL 140


>gi|294626336|ref|ZP_06704938.1| N-acetyltransferase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292599337|gb|EFF43472.1| N-acetyltransferase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 168

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MNVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S +      LGP+ V P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVALSDDSAGWFALGPLAVGPGHQRQGLGTRLVRAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP     + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVLP-EAPASELQALAFGDRLL 154


>gi|229005740|ref|ZP_04163439.1| GCN5-related N-acetyltransferase [Bacillus mycoides Rock1-4]
 gi|228755525|gb|EEM04871.1| GCN5-related N-acetyltransferase [Bacillus mycoides Rock1-4]
          Length = 75

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 37/71 (52%)

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           +IS  +  A++ G   ++++G   YY K GF+     ++  P  V     + + L +N  
Sbjct: 1   MISHVLRKAKELGYHSVIVLGHKDYYPKFGFKPASIWNICAPFEVPDEVFMAMELTENAL 60

Query: 181 QNIKGIVRCRE 191
           QNI+GIV+  E
Sbjct: 61  QNIQGIVQYSE 71


>gi|294665151|ref|ZP_06730452.1| N-acetyltransferase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292605064|gb|EFF48414.1| N-acetyltransferase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 168

 Score = 91.9 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 11/157 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
              L R   +    A+   +          R     V+   +    L+LS +      +V
Sbjct: 1   MNVLIREATEGDAAAIELLTMVAFMRAEHSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60

Query: 86  GSVRMTPI--SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           G + ++P+  S +      LGP+ V P +Q +G+G +L+  ++    ++G+   + +G+ 
Sbjct: 61  GHLAVSPVALSDDSPGWFALGPLAVGPGHQRQGLGTRLVRAALATLRERGAAGCLALGEP 120

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           A++ +LGF   P   L+LP     + +  L     + 
Sbjct: 121 AFFRRLGFAVEP--GLVLP-EAPASELQALAFGDRLL 154


>gi|320159273|ref|YP_004191651.1| putative acetyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319934585|gb|ADV89448.1| predicted acetyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 178

 Score = 91.9 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 2/130 (1%)

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLI 122
           L EQ  +D    ++ A+G+ +VG++  T +         ++ P+ V   Y  +GIG+ LI
Sbjct: 41  LIEQTHNDDLFIYIAAKGEAVVGAILFTRLHYPCGTPVFVMAPVAVATSYHGQGIGQALI 100

Query: 123 SMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQ 181
           +  +   + +G +V V  GD  +Y K GF  V  + +  P  +  P+      L      
Sbjct: 101 AFGLQEIKAQGVEVAVTYGDPNFYHKTGFVPVDTQIIAAPYSLQFPHGWQAQSLTGEALP 160

Query: 182 NIKGIVRCRE 191
            +KG V C  
Sbjct: 161 VLKGPVTCVA 170


>gi|149914043|ref|ZP_01902575.1| GCN5-related N-acetyltransferase [Roseobacter sp. AzwK-3b]
 gi|149812327|gb|EDM72158.1| GCN5-related N-acetyltransferase [Roseobacter sp. AzwK-3b]
          Length = 179

 Score = 91.5 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 61/162 (37%), Gaps = 12/162 (7%)

Query: 40  HDSSICAMHADSFGPGRFVR--------AAVLLREQGMHDLSLSFLCAEGKRIVGSVRMT 91
             + I  +   +F                  LL E    D+ + F+  +  RIV     +
Sbjct: 10  RQAQIAELFVQTFTASDGAEEGAMVGGLVRALLAEMAQGDVVV-FVAEDEGRIVAGAIFS 68

Query: 92  PISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKL 149
            +          +L P+ V    Q +GIG++L++ ++      G  V +  GD A+Y K+
Sbjct: 69  RLRYGTDPRHVMILSPMAVASDRQGQGIGQRLLTEALATLRAAGVDVAMTYGDPAFYGKV 128

Query: 150 GFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCR 190
           GF+ V    +  P P+  P   +   L  +    + G   C 
Sbjct: 129 GFEPVAQDVVPAPLPLSQPEGWIGQSLTGDEIMPLHGPCTCV 170


>gi|116332868|ref|YP_794395.1| acetyltransferase [Lactobacillus brevis ATCC 367]
 gi|116098215|gb|ABJ63364.1| Predicted acetyltransferase [Lactobacillus brevis ATCC 367]
          Length = 177

 Score = 90.7 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 64/168 (38%), Gaps = 10/168 (5%)

Query: 32  AFFLERLEHDSSICAMHADSFGP-----GRFVRAAVLLREQGMHDLSLSFLCA-EGKRIV 85
           +F   +      +  +   +F P     G  V     LR+   +  SL  +       IV
Sbjct: 4   SFETIQPTDYQQVDQLVQAAFEPVEDSQGNEVDLIHQLRKTYDYQASLEVVAKPSIDTIV 63

Query: 86  GSVRMTPISIEKITG----HLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG 141
           G   ++P+ I           L P+ V P +Q +G+G +L+S     A   G   + +VG
Sbjct: 64  GHGLLSPVMIRGNRHTTTIVALAPLAVAPDWQGQGVGSELLSELETRARMAGFAAVSVVG 123

Query: 142 DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           D+ YY   G+      ++    PV     L  PL      ++ G++  
Sbjct: 124 DMTYYGGRGYVMAEDFAIHNSLPVPMGSHLIKPLTAGALAHVGGMLEY 171


>gi|319891429|ref|YP_004148304.1| Acetyltransferase (GNAT) family protein [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161125|gb|ADV04668.1| Acetyltransferase (GNAT) family protein [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465401|gb|ADX77554.1| acetyltransferase, GNAT family [Staphylococcus pseudintermedius
           ED99]
          Length = 177

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 5/134 (3%)

Query: 63  LLREQGMHDLSLSFLCA-EGKRIVGSVRMTPISIEKIT----GHLLGPIVVHPLYQNKGI 117
            LR    +   L  +   +   I+G    + ++I+          L P+ V   Y+NKGI
Sbjct: 40  RLRLSPNYRYELEVVAKTDEGDIIGHGMCSEVTIQNDDTTYTALALAPLAVVAEYRNKGI 99

Query: 118 GRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQ 177
           GR L+    + A  +    IV++G   YY KLG++      ++ P  V         L  
Sbjct: 100 GRALVQALEERAFAENYTTIVVLGHADYYQKLGYEEAIRHHILAPFDVPSENYRVKFLWD 159

Query: 178 NVAQNIKGIVRCRE 191
            +     G V   E
Sbjct: 160 TLEDPPNGKVIYPE 173


>gi|114568693|ref|YP_755373.1| GCN5-like N-acetyltransferase [Maricaulis maris MCS10]
 gi|114339155|gb|ABI64435.1| GCN5-related N-acetyltransferase [Maricaulis maris MCS10]
          Length = 173

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 10/136 (7%)

Query: 38  LEHDSSICAMHADSF-GPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS-- 94
            + ++ + A+   +F GPG    A ++   +     +L  +  +   +VGS+  +P++  
Sbjct: 8   ADDEAGVDALLKAAFPGPG---EARLVTALRAADADTLELVAVDHGSVVGSIMFSPVTAR 64

Query: 95  ----IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
                + + G  LGP+ V P +Q +GIG  LI   +      G    VL+GD  YY +  
Sbjct: 65  PGSGDDDLFGVGLGPVAVVPEHQARGIGVALIEAGLTYLTTLGVPWCVLLGDPDYYKRFD 124

Query: 151 FQAVPWKSLILPAPVD 166
           F      +       D
Sbjct: 125 FVPAATWNWSWAGDPD 140


>gi|87120124|ref|ZP_01076020.1| acetyltransferase [Marinomonas sp. MED121]
 gi|86164826|gb|EAQ66095.1| acetyltransferase [Marinomonas sp. MED121]
          Length = 178

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 48/117 (41%), Gaps = 2/117 (1%)

Query: 77  LCAEGKRIVGSVRMTPIS-IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQ 135
           +  E   IVG +  +           +L P+ V    Q  GIG+KLI   +D   +    
Sbjct: 54  VAFEKGIIVGCIFFSRFRVPSGQEAFILSPVAVATDVQGTGIGQKLIQYGLDYLRRLNVS 113

Query: 136 VIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +    GD +YY+K GF+ +    +  P P+  P   L   L     Q + G  RC E
Sbjct: 114 LAFTYGDPSYYAKTGFEQINEGIVKAPCPLSQPIGWLAQSLEGKEIQAMAGSTRCVE 170


>gi|328464458|gb|EGF35851.1| acetyltransferase [Lactobacillus rhamnosus MTCC 5462]
          Length = 139

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 50/130 (38%), Gaps = 3/130 (2%)

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI---TGHLLGPIVVHPLYQNKGIGRK 120
           +R    ++ +L  +      +VG   MT  +I       G  L P+ V P YQ  G+G  
Sbjct: 1   MRRTTDYEAALEVVAMIDGHLVGYGLMTAATITPDAHMNGVALWPLAVAPAYQGSGLGMA 60

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           ++S     A       +  +GD  ++ + GF+      L  P  +     L   LV  V 
Sbjct: 61  IVSELDMRATDLRRDFVSAIGDRQFFGRFGFRKAAAYKLEPPFSIVAEDHLIKELVPGVL 120

Query: 181 QNIKGIVRCR 190
            ++ G V   
Sbjct: 121 ASVHGKVNYA 130


>gi|312194375|ref|YP_004014436.1| GCN5-related N-acetyltransferase [Frankia sp. EuI1c]
 gi|311225711|gb|ADP78566.1| GCN5-related N-acetyltransferase [Frankia sp. EuI1c]
          Length = 194

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 57/154 (37%), Gaps = 13/154 (8%)

Query: 34  FLERLEHDSSICAMH---ADSFGPGRFVR--AAVLLREQG--MHDLSLSFLCAEGKRIVG 86
              R E      ++      +FG G      A ++   +        LS +  +   IVG
Sbjct: 1   MSLRHESAHDRESVRGVVTRAFG-GEHGEVVADLVDDLRATISPGTGLSLVAEDDGEIVG 59

Query: 87  SVRMTPISIEKITGHL----LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD 142
               T   ++     +    L P+ V P YQ +G+G  L+   ++   +  S ++ L GD
Sbjct: 60  HAMFTRSLLDAPRRLVEVQVLSPLAVLPEYQKRGLGSALVRHGLEILAESSSPLVFLEGD 119

Query: 143 IAYYSKLGFQAVPWKSLILPA-PVDPNRVLFLPL 175
            +YY + GF      +   P+  +       + L
Sbjct: 120 PSYYHRFGFVPGGGLNFRKPSLRIPDAGFQVVTL 153


>gi|269959865|ref|ZP_06174242.1| hypothetical protein VME_06260 [Vibrio harveyi 1DA3]
 gi|269835164|gb|EEZ89246.1| hypothetical protein VME_06260 [Vibrio harveyi 1DA3]
          Length = 168

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 60/118 (50%), Gaps = 3/118 (2%)

Query: 76  FLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
           F+  +G+R++  V  TP+S E    G+LL P+      Q  G+G+ LI+  ++  +++G 
Sbjct: 44  FVAKQGERLIAGVLFTPLSFENGEVGYLLSPMATLTECQGIGVGQALINFGLEHLKQQGI 103

Query: 135 QVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +++   GD  +YS++GFQ V       P  +  P+  L   LV      I+G   C +
Sbjct: 104 ELVFTYGDPNFYSRVGFQQVTEAQFKAPHTLSFPHGWLAQSLV-GELTPIQGSSSCVQ 160


>gi|167567702|ref|ZP_02360618.1| GCN5-related N-acetyltransferase [Burkholderia oklahomensis EO147]
          Length = 140

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 5/118 (4%)

Query: 63  LLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRK 120
           +   +    L+L  +  +   IVG +   P+  +      + L P+ V P  QN G+   
Sbjct: 2   IDALRKDDALTLGLVAVDDDAIVGHIAFPPVLNDGKRLDWYALAPLAVRPDRQNAGVDGV 61

Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
           L    +D     G+   V++G   +Y + GF A    SL   A V P   +      +
Sbjct: 62  LAREGLDRLRLLGAHGCVVLGHPDHYGRFGFIARAALSL---ADVPPEYFIARSFTTD 116


>gi|328955999|ref|YP_004373332.1| GCN5-related N-acetyltransferase [Coriobacterium glomerans PW2]
 gi|328456323|gb|AEB07517.1| GCN5-related N-acetyltransferase [Coriobacterium glomerans PW2]
          Length = 324

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 71/186 (38%), Gaps = 23/186 (12%)

Query: 22  WRRSRWQKIGA----------FFLERLEHDSS---ICAMHADSF----GPG-RFVRAAVL 63
           W R R + +              + R E  +    +  ++  SF     PG        +
Sbjct: 93  WARDRKKTLKDGPATRGDPSEDPVVRRETKADRETVDKLYRTSFWNLHEPGCSEHYLVHI 152

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEK-----ITGHLLGPIVVHPLYQNKGIG 118
           +RE       L+ +      IVGS+  T  SI        T   LGP+ VHP  + +G  
Sbjct: 153 MREHPDLVHDLNLVLEVHGHIVGSIMYTRASISDETGAKRTALTLGPVCVHPGCRYQGFA 212

Query: 119 RKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQN 178
            +L+  S+  A   G   +V+ GD A + + GF++    ++ L     P  +L   L Q 
Sbjct: 213 TRLMDHSLQKARDLGFGTVVVFGDPAIFVRQGFRSCKRVNMSLEDGTYPASMLVAQLAQG 272

Query: 179 VAQNIK 184
             +  +
Sbjct: 273 TLEGHR 278


>gi|169335385|ref|ZP_02862578.1| hypothetical protein ANASTE_01797 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258123|gb|EDS72089.1| hypothetical protein ANASTE_01797 [Anaerofustis stercorihominis DSM
           17244]
          Length = 218

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 62/176 (35%), Gaps = 21/176 (11%)

Query: 27  WQKIGAFFLERLEHDSSICAMHADSFGPGRFV----------RAAVLLREQG--MHDLSL 74
              +   ++ R E           +    R               +L +      +   L
Sbjct: 2   KNNMKKNYIIRKETKEDYKETEYIT----REAFFNVYQEGCFEHYILNKLHSSKDYIKEL 57

Query: 75  SFLCAEGKRIVGSVRMTPI-----SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAA 129
           +F+  +  +++G +  T       + ++      GP+ + P Y+ +GIG KLI  S+  A
Sbjct: 58  AFVVEKNNKLIGHIGYTHSKLISSNNDEKNIISFGPVSIIPEYKMQGIGSKLIIHSIAEA 117

Query: 130 EKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKG 185
           +K   + IV+ G+   Y   GF       +      +   +L + L +    +  G
Sbjct: 118 KKLAHKAIVIYGNPKLYQHFGFTLGIKYGIKTAEGKNAVPLLAMELEKGYLNDADG 173


>gi|153833615|ref|ZP_01986282.1| acetyltransferase [Vibrio harveyi HY01]
 gi|148870013|gb|EDL68968.1| acetyltransferase [Vibrio harveyi HY01]
          Length = 190

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 4/129 (3%)

Query: 66  EQGMHDLSL-SFLCAEGKRIVGSVRMTPISIE-KITGHLLGPIVVHPLYQNKGIGRKLIS 123
                +  L  F+  + +R++  V  TP+  E    G+LL P+      Q KG+G+ LI+
Sbjct: 55  LSTTPERELKGFVAKQDERLISGVLFTPLRFENGEVGYLLSPMATLTECQGKGVGQALIN 114

Query: 124 MSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPV-DPNRVLFLPLVQNVAQN 182
             ++  +++G +++   GD  +YS++GFQ V       P  +  P+  L   LV      
Sbjct: 115 FGLEQLKQQGIELVFTYGDPNFYSRVGFQQVTEAQFKAPHILSFPHGWLAQSLV-GELTQ 173

Query: 183 IKGIVRCRE 191
           I+G   C +
Sbjct: 174 IQGTSSCVK 182


>gi|84499752|ref|ZP_00998040.1| acetyltransferase, GNAT family protein [Oceanicola batsensis
           HTCC2597]
 gi|84392896|gb|EAQ05107.1| acetyltransferase, GNAT family protein [Oceanicola batsensis
           HTCC2597]
          Length = 160

 Score = 88.8 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 61/150 (40%), Gaps = 8/150 (5%)

Query: 34  FLERLEHDSS---ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRM 90
              R    +    +  +   +F         ++   +   DL++  +     R+VG V +
Sbjct: 1   MNIRPFEPTDKTSVSILLDTAF--ESPAELRLVETLRAGGDLAIELVALLEGRVVGYVAL 58

Query: 91  TPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLG 150
             +         L P+ V P  Q +GIG  LI   +D A + G+  + ++G+  YYS+ G
Sbjct: 59  AHLVSP-RGWLSLSPVAVSPSRQERGIGSGLIRQGLDLARRSGAAAVTVLGNPEYYSRFG 117

Query: 151 FQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           F     ++L++  P      +  P+  + A
Sbjct: 118 FTLKAAENLVVEYP--KEFFMLYPIAPHTA 145


>gi|283853280|ref|ZP_06370530.1| GCN5-related N-acetyltransferase [Desulfovibrio sp. FW1012B]
 gi|283571320|gb|EFC19330.1| GCN5-related N-acetyltransferase [Desulfovibrio sp. FW1012B]
          Length = 171

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 67/156 (42%), Gaps = 12/156 (7%)

Query: 36  ERLEHDSSICAMHADSF------GPG-RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
           ER E  S I  +   +F       PG       ++ R +    L+LS L   G   VG +
Sbjct: 6   ERPEDVSRISPIQYAAFQGHPMHAPGAEPTEHHIVERLRASGALALSLLAEAGGEAVGHI 65

Query: 89  RMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYY 146
            ++P ++ +      LLGP+ V P  Q +GIG  L+  S+  A   G+  IVLVGD  +Y
Sbjct: 66  ALSPAAVGEEPDGWLLLGPVGVLPRRQGQGIGSALVRESLRRARGSGAAGIVLVGDPGFY 125

Query: 147 SKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQN 182
            + GF  VP   L+    V    VL +         
Sbjct: 126 GRFGFGNVP--GLVYRG-VPDQYVLAVCFGDQAPAG 158


>gi|325918082|ref|ZP_08180240.1| putative acetyltransferase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535705|gb|EGD07543.1| putative acetyltransferase [Xanthomonas vesicatoria ATCC 35937]
          Length = 183

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 61/155 (39%), Gaps = 11/155 (7%)

Query: 34  FLERLEHDSSICAMHADSFGPG------RFVRAAVLLREQGMHDLSLSFLCAEGKRIVGS 87
            L R   D    A+   +          R     V+   +G   L+LS +      +VG 
Sbjct: 18  VLIREASDGDAAAIEILTMVAFMRAEHSRHDEQHVIAALRGDDVLALSLVADHDGYVVGH 77

Query: 88  VRMTPIS--IEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           + ++P+S          LGP+ V P +Q +G+G +L+  ++    ++G+   V  G+  +
Sbjct: 78  LAVSPVSLSDGSSGWFALGPLAVGPGHQRQGLGTRLVHAALATLRERGAAGCVAFGEPGF 137

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180
           + + GF   P  S+        + +  L     + 
Sbjct: 138 FRRFGFAVEPGLSV---PDAPVSELQALAFGDRLL 169


>gi|254284061|ref|ZP_04959029.1| acetyltransferase [gamma proteobacterium NOR51-B]
 gi|219680264|gb|EED36613.1| acetyltransferase [gamma proteobacterium NOR51-B]
          Length = 178

 Score = 88.4 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 2/129 (1%)

Query: 64  LREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEK-ITGHLLGPIVVHPLYQNKGIGRKLI 122
           L  +      +     +   I+G++  T +  ++ +  ++L P+ V   +Q   +G+ LI
Sbjct: 41  LAARVDDQEVICLGAYQDGSIIGAIFFTRLRFDEPVDTYMLSPVAVSTAHQGSRVGQALI 100

Query: 123 SMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVAQ 181
           +  +   +++   V+V  GD  YYSK+GF A+    +  P  +  P   L   L      
Sbjct: 101 NFGLQELKRRSVSVVVTYGDPLYYSKVGFHALSEDVIQAPLDLSMPEGWLGQSLSGEAIP 160

Query: 182 NIKGIVRCR 190
            +KG   C 
Sbjct: 161 ELKGRPVCV 169


>gi|50557406|ref|XP_506111.1| YALI0F31867p [Yarrowia lipolytica]
 gi|49651981|emb|CAG78925.1| YALI0F31867p [Yarrowia lipolytica]
          Length = 186

 Score = 88.4 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 65/171 (38%), Gaps = 19/171 (11%)

Query: 32  AFFLERLE---HDSSICAMHADSFGP---GRFVRAAVLLREQGMHDLSLSFLCAEGK--R 83
                  E   H   I  +   +F            ++   +    L+ S++  +    +
Sbjct: 13  VDVKISPELPWHKDDISNVIKSAFAKLAISNHQEQEIVHDLRATGALTASWVAIDNNTQQ 72

Query: 84  IVGSVRMTPISIEKI----TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE-KKGSQVIV 138
           +VG++ ++ + ++        + +GPI V P +Q  GIG KL+  +++  + +  +  +V
Sbjct: 73  VVGTIFLSEVKVDGQVQSPKWYGIGPIAVLPDFQGNGIGAKLMHTAIEHCQGQLDAGGVV 132

Query: 139 LVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           L+G+  +Y +  F  VP + L L   V                   G V  
Sbjct: 133 LLGNPEFYKQFEF--VPRRDLSL-MGVPSQYFQVRKFRGEWP---SGEVTY 177


>gi|312885112|ref|ZP_07744797.1| putative acetyltransferase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367212|gb|EFP94779.1| putative acetyltransferase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 161

 Score = 88.0 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 75/164 (45%), Gaps = 18/164 (10%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRA-----AVLLREQGMHDLSLSFLCAEG-KRIVGS 87
            L R E  S I A+        R V +       +++ +     +L+ +  +   +++G 
Sbjct: 1   MLIRTEAPSDILAIDDLL----REVSSGSIVAERVMKLRENGQRTLAIVACDDFGKVIGF 56

Query: 88  VRMTPISIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAY 145
           V  +P+++         L  + + P Y+ +GI R+++   + +  + G    V++GD  Y
Sbjct: 57  VMFSPVTLNDEEVNWQALSSLYLTPSYRQRGIARQMVEEGLTSLSELGYPACVVIGDTEY 116

Query: 146 YSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
           +S+ GF+     S  L  P     +L + L +NV ++ KGI+R 
Sbjct: 117 FSRFGFKNNELFS-TLSDP-----LLIVELEENVCRDKKGIIRY 154


>gi|119386403|ref|YP_917458.1| GCN5-related N-acetyltransferase [Paracoccus denitrificans PD1222]
 gi|119376998|gb|ABL71762.1| GCN5-related N-acetyltransferase [Paracoccus denitrificans PD1222]
          Length = 269

 Score = 88.0 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/140 (24%), Positives = 56/140 (40%), Gaps = 10/140 (7%)

Query: 35  LERLEHDSSICAMHAD-SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPI 93
             R E      A+    +        A ++   +   DL+LS +      ++G V ++P+
Sbjct: 120 RLRAEMAHDRAAVSELLACAFDGPAEARLVEALRADDDLALSLVAEAEGTVIGHVALSPL 179

Query: 94  SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQA 153
             E      L P+ VHP  Q++GIG  L   ++          IV++GD AYY + GF  
Sbjct: 180 KAEG-PALALAPLAVHPAVQSRGIGEALTRAALA---AFDDHTIVVLGDPAYYGRFGFAP 235

Query: 154 VPWKSLILPAPVDPNRVLFL 173
               S     P     ++ L
Sbjct: 236 ADLDS-----PYAGPHLMAL 250


>gi|116494546|ref|YP_806280.1| acetyltransferase [Lactobacillus casei ATCC 334]
 gi|116104696|gb|ABJ69838.1| Predicted acetyltransferase [Lactobacillus casei ATCC 334]
          Length = 124

 Score = 88.0 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 47/112 (41%), Gaps = 3/112 (2%)

Query: 81  GKRIVGSVRMTPISIEKIT---GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
              +VG   MT  SI       G  L P+ V P YQ  GIG  +++     A       +
Sbjct: 3   DGHLVGYGLMTAASITPDAHMQGVALAPLAVAPEYQGGGIGVAIVTELDMRATDLRRDFV 62

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRC 189
            +VGD  ++ +LGFQ      L  P PV     L   LV  V  +++G V  
Sbjct: 63  SVVGDRQFFGRLGFQKAAKYKLDPPFPVVTEDHLIKELVPGVLASVRGKVNY 114


>gi|296390932|ref|ZP_06880407.1| hypothetical protein PaerPAb_22377 [Pseudomonas aeruginosa PAb1]
          Length = 107

 Score = 87.7 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 40/107 (37%), Gaps = 8/107 (7%)

Query: 32  AFFLERLEHDSSICAMHADSFGPGR------FVRAAVLLREQGMHDLSLSFLCAEGKRIV 85
                R E    I A+   +    R           ++   +    L+ S +     +++
Sbjct: 1   MNISIRAETPGDIDAIARLTEAAFRNETHSSHTEQYIVDALRRAGALTFSLVAEANGQVI 60

Query: 86  GSVRMTPISIEKI--TGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE 130
           G +  +P++I+      + L P+ V P  Q +G+G +L+   +    
Sbjct: 61  GHIAASPVTIDGEAGDWYGLAPLSVAPERQRQGLGSQLVRRLLAELR 107


>gi|290955856|ref|YP_003487038.1| acetyltransferase [Streptomyces scabiei 87.22]
 gi|260645382|emb|CBG68468.1| putative acetyltransferase [Streptomyces scabiei 87.22]
          Length = 175

 Score = 87.7 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 64/159 (40%), Gaps = 8/159 (5%)

Query: 37  RLEHDSSIC---AMHADSFGPGRFVRAAVLLREQ-GMHDLSLSFLCAE-GKRIVGSVRMT 91
           R E  +      A++A +FG     R    LRE  G     LS++       +     +T
Sbjct: 13  RPETPADREGVYAVNAAAFGTDAEARLVDALREDPGAWLPELSYVAEAPDGTLAAYALIT 72

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
              +++     L P+ V P  Q +G G  ++   ++AA  +    ++++G   YY + GF
Sbjct: 73  RCHVDEAPALALAPVAVLPEVQRRGAGAAVVRAVLEAARARREGPVLVLGHPEYYPRFGF 132

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIK-GIVRC 189
                  +     V    ++   LV + +  +  G++R 
Sbjct: 133 VRASAYGIRPGFEVPDAAMMA--LVPDGSAPVTPGVIRY 169


>gi|84495544|ref|ZP_00994663.1| GCN5-related N-acetyltransferase [Janibacter sp. HTCC2649]
 gi|84385037|gb|EAQ00917.1| GCN5-related N-acetyltransferase [Janibacter sp. HTCC2649]
          Length = 174

 Score = 87.7 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 58/145 (40%), Gaps = 7/145 (4%)

Query: 32  AFFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSV 88
                R E  S   A+      +FG  R       +R   ++  SL+ +      +VG V
Sbjct: 1   MDLTIRPETPSDFPAIREVVRTAFGNTREPDGVENIRASEIYIPSLALVAQLDSEVVGYV 60

Query: 89  RMTPISIEK----ITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
            +T  +I       T  +L P+ V P +Q  GIG  L+  ++  AE  G  +++L G   
Sbjct: 61  MITHCTITGDAGARTTAMLTPLAVSPAHQRHGIGSVLVRAALAGAEAAGEPMVILQGSPR 120

Query: 145 YYSKLGFQAVPWKSLILPAPVDPNR 169
           +Y   GF+      + +  P    R
Sbjct: 121 WYGSRGFEDSRPHGIHMELPDWAPR 145


>gi|332188568|ref|ZP_08390287.1| acetyltransferase family protein [Sphingomonas sp. S17]
 gi|332011412|gb|EGI53498.1| acetyltransferase family protein [Sphingomonas sp. S17]
          Length = 181

 Score = 87.3 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 66/163 (40%), Gaps = 14/163 (8%)

Query: 33  FFLERLEHDSSICAMHAD---SFGPGRFVRAAVLLREQGMHDLSLSFLCAEG--KRIVGS 87
               R      + A+ A    SF       AA++       D+ L  +  +     ++G+
Sbjct: 8   DITIRPARGEDVAALDALLVASFPA--PAEAALVRDLCVEGDMVLMLVAVDEETDSLIGA 65

Query: 88  VRMTPISIE----KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143
           +  + +S+E     I    L PI V   ++ +G+G  L++  ++  E++G  +   +GD 
Sbjct: 66  IAFSRMSVEIGGKPINSVALAPIAVAREWRQQGVGEALVAAGIERLEQEGVVLCFALGDP 125

Query: 144 AYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQ-NIKG 185
            +Y + GF A        P     +  L +PL   +    ++G
Sbjct: 126 GFYGRFGFAADVASGFDSPY--AGDYFLAVPLQGGLIPCGVRG 166


>gi|301348616|ref|ZP_07229357.1| Acetyltransferase (GNAT) family protein [Acinetobacter baumannii
           AB056]
          Length = 100

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 92  PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGF 151
            IS  +   + LGPI V P  Q +GIG  L++ S++  +K G++  VL+GD  YYS+ GF
Sbjct: 1   QISSGEKNWYGLGPISVTPNKQGQGIGSLLMNSSLEKLKKSGAKGCVLLGDPKYYSRFGF 60

Query: 152 QAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191
           +A P   L LP  V P     L     V    KG V   E
Sbjct: 61  KAYP--DLKLPG-VPPEYFQALSFQNYVP---KGDVSYHE 94


>gi|294084270|ref|YP_003551028.1| hypothetical protein SAR116_0701 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663843|gb|ADE38944.1| hypothetical protein SAR116_0701 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 176

 Score = 86.5 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 66/157 (42%), Gaps = 10/157 (6%)

Query: 34  FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSL------SFLCAEGKRIVGS 87
              R   ++ + ++              V++                S +  +  +++G 
Sbjct: 1   MNIRFAQETDLDSIQKVIETAFSDEENKVIMNLVAELAKETTIPSIKSLIAEKDNQVIGY 60

Query: 88  VRMTPI---SIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIA 144
           V  +PI   S   I+G++L P+ V P +Q +G+G  LI+  +D   K G  V+V+ GD  
Sbjct: 61  VSYSPIFLKSDSTISGYILAPLAVSPEHQKQGVGSNLINSGIDMLTKDGVSVLVVYGDPE 120

Query: 145 YYSKLGFQAVPWKSLILPAPVD-PNRVLFLPLVQNVA 180
           YY + G +    +S + P P++ P   L + L     
Sbjct: 121 YYGRFGLKEEVGRSFMPPYPLEYPFGWLGMTLKDTAI 157


>gi|327537529|gb|EGF24248.1| GCN5-related N-acetyltransferase [Rhodopirellula baltica WH47]
          Length = 175

 Score = 85.7 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 63/144 (43%), Gaps = 7/144 (4%)

Query: 44  ICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVR----MTPISIEKIT 99
           + A  A  F  G    + ++   +   + ++S +  + ++++G V     +T  +  + +
Sbjct: 15  VSAFEASEF--GHHGESELIEALRDNCERAISLVALDDRQVIGHVIASPAVTHSAGSERS 72

Query: 100 GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSL 159
           G  +GP+ V P +Q +G+G +L+   V+ A+  G   + + G   +Y++ GF+ +    +
Sbjct: 73  GLAIGPMAVMPSFQRRGVGSQLVRAVVERADAAGESFMAVAGHPEFYTRFGFRPILDFGV 132

Query: 160 -ILPAPVDPNRVLFLPLVQNVAQN 182
                 +  +      L      +
Sbjct: 133 QHCFEGMPDDVFFLRGLQTTFPDH 156


>gi|167893827|ref|ZP_02481229.1| acetyltransferase, GNAT family protein [Burkholderia pseudomallei
           7894]
          Length = 114

 Score = 85.7 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 80  EGKRIVGSVRMTPISIE--KITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137
              R+VG V  +P++I       H L P+ V P  Q +GIG  L+   +DA  + G++  
Sbjct: 1   RDGRLVGHVAFSPVAIGAGGEGWHGLAPLAVWPGCQRQGIGAALVRAGLDALRRAGARGC 60

Query: 138 VLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGI