RPSBLAST alignment for GI: 254781162 and conserved domain: pfam00583

>gnl|CDD|144249 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins. Length = 80
 Score = 53.4 bits (129), Expect = 4e-08
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 7/79 (8%)

Query: 80  EGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139
           E   +VG   ++ I  E     + G + V P Y+ KGIG  L+    + A + G + I L
Sbjct: 3   EDGELVGFASLSIIDEEGNVAEIEG-LAVDPEYRGKGIGTALLEALEEYARELGLKRIEL 61

Query: 140 VGD------IAYYSKLGFQ 152
                    IA Y KLGF+
Sbjct: 62  EVLEDNEAAIALYEKLGFK 80