RPSBLAST alignment for GI: 254781162 and conserved domain: cd04301
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included. Length = 65
Score = 49.6 bits (119), Expect = 5e-07
Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
Query: 75 SFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134
+ + IVG ++P T ++ G + V P Y+ KGIG L+ + + A ++G+
Sbjct: 1 FLVAEDDGEIVGFASLSPDGSGGDTAYI-GDLAVLPEYRGKGIGSALLEAAEEEARERGA 59
Query: 135 QVIVL 139
+ + L
Sbjct: 60 KRLRL 64