Query gi|254781164|ref|YP_003065577.1| hypothetical protein CLIBASIA_05355 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 56 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 06:03:50 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781164.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00514 accC acetyl-CoA carb 50.6 4.7 0.00012 21.7 0.1 20 6-30 79-98 (451) 2 TIGR02692 tRNA_CCA_actino tRNA 45.5 10 0.00026 20.0 1.2 35 16-50 135-170 (472) 3 TIGR02712 urea_carbox urea car 39.3 11 0.00028 19.8 0.6 21 6-31 78-100 (1226) 4 KOG3727 consensus 27.6 23 0.00058 18.2 0.6 19 2-20 630-648 (664) 5 PRK12603 putative monovalent c 27.4 41 0.001 16.9 1.9 20 18-37 51-71 (89) 6 KOG2428 consensus 19.9 28 0.0007 17.8 -0.2 39 15-53 207-246 (443) 7 KOG4812 consensus 18.7 45 0.0011 16.7 0.7 31 7-37 133-169 (262) 8 TIGR01235 pyruv_carbox pyruvat 17.8 36 0.00091 17.2 0.0 15 7-26 84-98 (1169) 9 KOG3192 consensus 17.1 80 0.002 15.4 1.7 20 25-44 53-72 (168) 10 TIGR02733 desat_CrtD C-3',4' d 16.8 44 0.0011 16.7 0.3 35 11-45 359-404 (499) No 1 >TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase. Acetyl-CoA carboxylase (6.4.1.2 from EC) is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase (6.3.4.14 from EC), and two subunits of carboxyl transferase in a 2:2 complex. In the first step of long-chain fatty acid synthesis, biotin carboxylase catalyses the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-coA. Homologous domains are found in eukaryotic forms of acetyl-CoA carboxylase and in a number of other carboxylases (e.g. pyruvate carboxylase). In some systems, the biotin carboxyl carrier protein and this protein (biotin carboxylase) may be shared by different carboxyltransferases. However, this model is not intended to identify the biotin carboxylase domain of propionyl-coA carboxylase. The model should hit the full length of proteins, except for chloroplast transit peptides in plants. If it hits a domain only of a longer protein, there may be a problem with the identification.; GO: 0016874 ligase activity. Probab=50.60 E-value=4.7 Score=21.75 Aligned_cols=20 Identities=55% Similarity=0.880 Sum_probs=14.9 Q ss_pred EEEEEEEEEEECCCCCCHHHHHHHH Q ss_conf 7200245776046763466675337 Q gi|254781164|r 6 LEGYGFLSLRESDGRADFSDISEGI 30 (56) Q Consensus 6 legygflslresdgradfsdisegi 30 (56) --||||||= -|+|..+.|-. T Consensus 79 HPGYGFLSE-----NA~FAe~c~~~ 98 (451) T TIGR00514 79 HPGYGFLSE-----NADFAEICEDH 98 (451) T ss_pred CCCCCHHHH-----HHHHHHHHHHC T ss_conf 288773443-----12478898738 No 2 >TIGR02692 tRNA_CCA_actino tRNA adenylyltransferase; InterPro: IPR014065 The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3 -end of tRNA molecules. Genes encoding tRNA include the CCA tail in some but not all bacteria, and this enzyme may be required for viability. Members of this family represent a distinct clade within the larger family IPR002646 from INTERPRO (tRNA nucleotidyltransferase/poly(A) polymerase family protein). The example from Streptomyces coelicolor was shown to act as a CCA-adding enzyme and not as a poly(A) polymerase.. Probab=45.47 E-value=10 Score=19.97 Aligned_cols=35 Identities=34% Similarity=0.563 Sum_probs=30.5 Q ss_pred ECCCCCCHHHHHHHHH-HHHHHHHHHHCCCEECCCC Q ss_conf 0467634666753379-9999986541640002463 Q gi|254781164|r 16 ESDGRADFSDISEGIA-LLNIIYNTMKKPVLSFEND 50 (56) Q Consensus 16 esdgradfsdisegia-llniiyntmkkpvlsfend 50 (56) .++|...|.|++-|+. |++-+-.|-.+|-.||..| T Consensus 135 ~~~G~~~f~Dp~gGl~~l~~~~L~TP~~Pe~SF~DD 170 (472) T TIGR02692 135 AADGSLEFVDPLGGLDDLLAKVLDTPATPEQSFSDD 170 (472) T ss_pred CCCCCEEEECHHHHHHHHHHHHCCCCCCCCCCCCCC T ss_conf 057955886426779999998405788743567888 No 3 >TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast). The allophanate hydrolase domain of the yeast enzyme is not included in this entry and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from O. sagaranensis was shown to be highly active on acetamide and formamide as well as urea.. Probab=39.31 E-value=11 Score=19.80 Aligned_cols=21 Identities=48% Similarity=0.828 Sum_probs=14.0 Q ss_pred EEEEEEEEEEECCCCCCHHHHH--HHHH Q ss_conf 7200245776046763466675--3379 Q gi|254781164|r 6 LEGYGFLSLRESDGRADFSDIS--EGIA 31 (56) Q Consensus 6 legygflslresdgradfsdis--egia 31 (56) .-||||||= -|+|++-. +||+ T Consensus 78 ~PGYGFLSE-----NA~FA~~C~~aGI~ 100 (1226) T TIGR02712 78 HPGYGFLSE-----NAAFAEACEAAGIV 100 (1226) T ss_pred ECCCCCCCC-----CHHHHHHHHHCCCE T ss_conf 458872357-----87799899847957 No 4 >KOG3727 consensus Probab=27.64 E-value=23 Score=18.17 Aligned_cols=19 Identities=47% Similarity=0.723 Sum_probs=13.4 Q ss_pred CEEEEEEEEEEEEEECCCC Q ss_conf 4488720024577604676 Q gi|254781164|r 2 EHIFLEGYGFLSLRESDGR 20 (56) Q Consensus 2 ehiflegygflslresdgr 20 (56) -|-|.-||=|||.|+.|-. T Consensus 630 VHEfIGGYIFLStRsKd~n 648 (664) T KOG3727 630 VHEFIGGYIFLSTRSKDQN 648 (664) T ss_pred HHHHCCCEEEEEECCHHCC T ss_conf 2333051699872220105 No 5 >PRK12603 putative monovalent cation/H+ antiporter subunit F; Reviewed Probab=27.41 E-value=41 Score=16.88 Aligned_cols=20 Identities=30% Similarity=0.335 Sum_probs=17.8 Q ss_pred CCCCC-HHHHHHHHHHHHHHH Q ss_conf 67634-666753379999998 Q gi|254781164|r 18 DGRAD-FSDISEGIALLNIIY 37 (56) Q Consensus 18 dgrad-fsdisegiallniiy 37 (56) .||.| |-||+-.-|++|.|- T Consensus 51 ~~r~e~FlDial~YAlinFi~ 71 (89) T PRK12603 51 NDALSLFIDVSLVYACINFIS 71 (89) T ss_pred CCCHHHHHHHHHHHHHHHHHH T ss_conf 288599989999999999999 No 6 >KOG2428 consensus Probab=19.86 E-value=28 Score=17.75 Aligned_cols=39 Identities=28% Similarity=0.473 Sum_probs=29.1 Q ss_pred EECCCC-CCHHHHHHHHHHHHHHHHHHHCCCEECCCCEEE Q ss_conf 604676-346667533799999986541640002463577 Q gi|254781164|r 15 RESDGR-ADFSDISEGIALLNIIYNTMKKPVLSFENDVHI 53 (56) Q Consensus 15 resdgr-adfsdisegiallniiyntmkkpvlsfendvhi 53 (56) +||..| .-+||=|.-.-|-|-||++|++|+..+-|..+| T Consensus 207 kESNAriVrWSDGS~SL~lGNEvfDv~~~pl~~~~nhl~v 246 (443) T KOG2428 207 KESNARIVRWSDGSMSLHLGNEVFDVYKQPLSGNQNHLFV 246 (443) T ss_pred EECCCEEEEECCCCEEEEECHHHHHHHHCCCCCCCCEEEE T ss_conf 1046447885388336751436777663533367532677 No 7 >KOG4812 consensus Probab=18.74 E-value=45 Score=16.66 Aligned_cols=31 Identities=42% Similarity=0.598 Sum_probs=22.9 Q ss_pred EEEEEEEEEECCCCCCHHHHHH------HHHHHHHHH Q ss_conf 2002457760467634666753------379999998 Q gi|254781164|r 7 EGYGFLSLRESDGRADFSDISE------GIALLNIIY 37 (56) Q Consensus 7 egygflslresdgradfsdise------giallniiy 37 (56) +-|++..+.++|||-||+||.. |+-++++|- T Consensus 133 ~y~~~i~~~~~~~~nd~~~~D~L~vGnd~~F~~af~v 169 (262) T KOG4812 133 PYYGTIDLENSDGRNDEIDIDGLRVGNDGIFMWAFIV 169 (262) T ss_pred CCCCCEECCCCCCCCCHHCCCCCCCCCCHHHHHHHHH T ss_conf 5324100146787533000024533650679999999 No 8 >TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis. During prolonged fasting, when hepatic glycogen is exhausted, gluconeogenesis becomes the only source of plasma glucose. Gluconeogenesis (the production of new glucose molecules) occurs mainly in liver and, to a small extent, in kidneys. Pyruvate carboxylase (6.4.1.1 from EC), a member of the biotin-dependent enzyme family, catalyses the ATP-dependent carboxylation of pyruvate to oxaloacetate, thus playing a crucial role in gluconeogenesis.ATP + pyruvate + HCO3- = ADP + phosphate + oxaloacetate Most well characterised forms of active enzyme consist of four identical subunits arranged in a tetrahedron-like structure. Each subunit contains three functional domains: the biotin carboxylation domain, the transcarboxylation domain and the biotin carboxyl carrier domain.; GO: 0004736 pyruvate carboxylase activity, 0006094 gluconeogenesis, 0005737 cytoplasm. Probab=17.78 E-value=36 Score=17.16 Aligned_cols=15 Identities=53% Similarity=1.043 Sum_probs=9.8 Q ss_pred EEEEEEEEEECCCCCCHHHH Q ss_conf 20024577604676346667 Q gi|254781164|r 7 EGYGFLSLRESDGRADFSDI 26 (56) Q Consensus 7 egygflslresdgradfsdi 26 (56) -||||||= +.+|.|- T Consensus 84 PGYGfLSE-----~~~Fa~~ 98 (1169) T TIGR01235 84 PGYGFLSE-----NSEFADA 98 (1169) T ss_pred CCCCCCCC-----CHHHHHH T ss_conf 88562248-----8789999 No 9 >KOG3192 consensus Probab=17.09 E-value=80 Score=15.35 Aligned_cols=20 Identities=45% Similarity=0.600 Sum_probs=18.0 Q ss_pred HHHHHHHHHHHHHHHHHCCC Q ss_conf 67533799999986541640 Q gi|254781164|r 25 DISEGIALLNIIYNTMKKPV 44 (56) Q Consensus 25 disegiallniiyntmkkpv 44 (56) --||-+|-||--|+|.|+|. T Consensus 53 ~a~eqSa~lnkAY~TLk~pL 72 (168) T KOG3192 53 QASEQSAELNKAYDTLKDPL 72 (168) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 67887899999999987588 No 10 >TIGR02733 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 Members of this family are encoded by slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp. (strain PCC 6803), and close homologues (presumed to be functionally equivalent) from other cyanobacteria, where myxoxanthophyll biosynthesis is either known or expected. This enzyme can act on neurosporene and so presumably catalyses the first step that is committed to myxoxanthophyll.. Probab=16.81 E-value=44 Score=16.70 Aligned_cols=35 Identities=37% Similarity=0.554 Sum_probs=26.1 Q ss_pred EEEE-EECCCCCC----------HHHHHHHHHHHHHHHHHHHCCCE Q ss_conf 4577-60467634----------66675337999999865416400 Q gi|254781164|r 11 FLSL-RESDGRAD----------FSDISEGIALLNIIYNTMKKPVL 45 (56) Q Consensus 11 flsl-resdgrad----------fsdisegiallniiyntmkkpvl 45 (56) |.|. +|.||||- |.|++.=..+-.--|..+|+-++ T Consensus 359 FVSiS~egDGRAP~G~~TlIAS~FTd~~~W~~l~~~~Y~~~K~~y~ 404 (499) T TIGR02733 359 FVSISQEGDGRAPAGEATLIASSFTDVADWSSLDEEDYTAKKKQYT 404 (499) T ss_pred EEEECCCCCCCCCCCCEEEEEEECCCCHHHCCCCHHHHHHHHHHHH T ss_conf 2786578688877575367874213712211772678999999999 Done!