>gnl|CDD|151120 pfam10590, PNPOx_C, Pyridoxine 5'-phosphate oxidase C-terminal dimerization region. Pyridoxine 5'-phosphate oxidase (PNPOx) catalyses the terminal step in the biosynthesis of pyridoxal 5'-phosphate (PLP), a cofactor used by many enzymes involved in amino acid metabolism. The enzyme oxidizes either the 4'-hydroxyl group of pyridoxine 5'-phosphate (PNP) or the 4'-primary amine of pyridoxamine 5'-phosphate (PMP) to an aldehyde. PNPOx is a homodimeric enzyme with one flavin mononucleotide (FMN) molecule non-covalently bound to each subunit. This domain represents one of the two dimerization regions of the protein, located at the edge of the dimer interface, at the C-terminus, being the last three beta strands, S6, S7, and S8 along with the last three residues to the end. In PNPOx from Myxococcus xanthus, S6 runs from residues 178-192, S7 from 200-206 and S8 from 211-215. the extended loop, of residues 167-177 may well be involved in the pocket formed between the two dimers that positions the FMN molecule. Length = 41

 Score = 63.7 bits (156), Expect = 3e-11
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 159 WHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP 201
           W G+R+ P SIEFW  RP RLHDRL ++RE     W+   L P
Sbjct: 1   WGGYRVVPESIEFWQGRPSRLHDRLRYTRE--GDGWSIERLAP 41