RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781165|ref|YP_003065578.1| pyridoxamine 5'-phosphate oxidase [Candidatus Liberibacter asiaticus str. psy62] (201 letters) >gnl|CDD|30608 COG0259, PdxH, Pyridoxamine-phosphate oxidase [Coenzyme metabolism]. Length = 214 Score = 236 bits (604), Expect = 3e-63 Identities = 96/189 (50%), Positives = 125/189 (66%), Gaps = 2/189 (1%) Query: 13 FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72 TL +W++EA +E ++P+A+ LAT D G P++R+VL+K D+ GFVFYTN S KG+ Sbjct: 28 LTLFRRWLEEAIRAEVNEPNAMTLATVDEQGRPSSRIVLLKELDERGFVFYTNYGSRKGR 87 Query: 73 EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132 E+ NP A+L F WK L RQ+RV G VE+ D SD Y+ASRPR S+IGAWASKQS+ + Sbjct: 88 ELAANPYAALLFPWKELERQVRVEGRVERVSDEESDAYFASRPRGSQIGAWASKQSRPIA 147 Query: 133 SLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAG 192 S L+ V ++ + + EIPRP W GFRI P SIEFW RP RLHDRL + R+ G Sbjct: 148 SRAALEAKVAELTAKFADGEIPRPPHWGGFRIVPESIEFWQGRPSRLHDRLRYRRD--DG 205 Query: 193 KWTQFLLYP 201 W L P Sbjct: 206 GWKIERLAP 214 >gnl|CDD|37797 KOG2586, KOG2586, KOG2586, Pyridoxamine-phosphate oxidase [Coenzyme transport and metabolism]. Length = 228 Score = 167 bits (424), Expect = 2e-42 Identities = 81/192 (42%), Positives = 124/192 (64%), Gaps = 3/192 (1%) Query: 13 FTLLSQWMQEA-QSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTN-SQSPK 70 L +W QEA + + + +A+ L+TAD+ G ++R+VL+K D +GFVFYTN S K Sbjct: 37 VELFKKWFQEAAKDPDIGEINAMTLSTADKDGRVSSRMVLLKGLDHDGFVFYTNYGTSRK 96 Query: 71 GKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQK 130 GK++ ENP A+L F+W+ L RQ+RV G+VEK ++ Y+ SRPR S+IGAWAS QS+ Sbjct: 97 GKDLQENPNAALLFYWEDLNRQVRVEGIVEKLPREEAEAYFKSRPRASQIGAWASPQSEV 156 Query: 131 MPSLDDLQKSVQRYSSFYQEKE-IPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRET 189 +P ++L+K + + + +++ IP+P W G+R+ P EFW +P RLHDR+++ R T Sbjct: 157 IPDREELEKKDEELTELFGDEQSIPKPDSWGGYRLVPQEFEFWQGQPDRLHDRIVYRRLT 216 Query: 190 IAGKWTQFLLYP 201 + W L P Sbjct: 217 VDEDWKLVRLAP 228 >gnl|CDD|144728 pfam01243, Pyridox_oxidase, Pyridoxamine 5'-phosphate oxidase. Length = 87 Score = 90.4 bits (225), Expect = 3e-19 Identities = 31/74 (41%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Query: 29 HDPHAVVLATADRMGFPNARVVLIKH-FDQEGFVFYTNSQSPKGKEILENPKASLCFHWK 87 +P+A VLAT D G PN V K+ FD+ G F TN S K + + ENP+ +L F W Sbjct: 9 AEPNAGVLATVDADGRPNVSPVGFKYGFDRVGIYFATNYDSRKARNLRENPRVALLFGWP 68 Query: 88 SLARQLRVRGLVEK 101 L R +R+ G E Sbjct: 69 ELRRGVRIEGTAEI 82 >gnl|CDD|33661 COG3871, COG3871, Uncharacterized stress protein (general stress protein 26) [General function prediction only]. Length = 145 Score = 39.5 bits (92), Expect = 6e-04 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Query: 27 ESHDPHAVVLATADRMGFPNARVVLIKHFDQEG-FVFYTNSQSPKGKEILENPKASLCFH 85 E +LAT G P++R + H +G F+TN S K +EI +NPK + F Sbjct: 15 EGSKVG--MLATVQENGHPHSRPMTFNHDGPKGTIWFFTNKDSRKVEEIKKNPKVCVLFG 72 Query: 86 WKSLARQLRVRGLVE 100 + + V G E Sbjct: 73 YDDHDAFVEVSGTAE 87 >gnl|CDD|30419 COG0070, GltB, Glutamate synthase domain 3 [Amino acid transport and metabolism]. Length = 301 Score = 31.5 bits (71), Expect = 0.17 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query: 58 EGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLA 106 E V YT S K KEILEN + K R+ R L+ + A Sbjct: 247 EEHVEYTGS--EKAKEILENWELYEEKFVKVKPREYRPFLLLNADAEAA 293 >gnl|CDD|34620 COG5015, COG5015, Uncharacterized conserved protein [Function unknown]. Length = 132 Score = 29.1 bits (65), Expect = 0.88 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Query: 34 VVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQL 93 V LAT + G P R + + E F T + P K+I +NP+ C K + Sbjct: 14 VALATVED-GKPRVRPFQVMFVEGEKLYFCTANTKPYYKQIKKNPEVEFCGMDKD-GVMV 71 Query: 94 RVRGLVE 100 R+RG E Sbjct: 72 RLRGRAE 78 >gnl|CDD|34402 COG4792, EscU, Type III secretory pathway, component EscU [Intracellular trafficking and secretion]. Length = 349 Score = 28.7 bits (64), Expect = 1.2 Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 9/52 (17%) Query: 49 VVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVE 100 ++ Q GF+F + PK ++I NP ++ R +R +VE Sbjct: 97 ATVLSGVLQVGFLFALEAIKPKAEKI--NPV-------QNAKRIFSLRSVVE 139 >gnl|CDD|144740 pfam01257, Complex1_24kDa, Respiratory-chain NADH dehydrogenase 24 Kd subunit. Length = 145 Score = 28.2 bits (64), Expect = 1.7 Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Query: 20 MQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFV-FYTN-SQSPKGK 72 + AQ + P + A+ +G P ARV FY+ + P GK Sbjct: 19 LHLAQEQYGYLPDEAIEYIAELLGIPPARV--------YEVATFYSMFNLKPVGK 65 >gnl|CDD|144818 pfam01366, PRTP, Herpesvirus processing and transport protein. The members of this family are associate with capsid intermediates during packaging of the virus. Length = 635 Score = 28.0 bits (63), Expect = 1.7 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 11/82 (13%) Query: 82 LCFHWKSLARQLRVRGLVEKYCD-LASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKS 140 +C H + +Q+ VRGL E L D ++ R S + A + QS+ S ++ Sbjct: 213 ICDH---VTKQVPVRGLFENELRHLPHDLGLSAERRPSALAALKAIQSRTAESDSGYREE 269 Query: 141 ----VQRYSSFYQEKEIPRPVW 158 + ++ F EIP ++ Sbjct: 270 AEAALDAHNVF---SEIPPRIY 288 >gnl|CDD|36177 KOG0959, KOG0959, KOG0959, N-arginine dibasic convertase NRD1 and related Zn2+-dependent endopeptidases, insulinase superfamily [Posttranslational modification, protein turnover, chaperones]. Length = 974 Score = 27.7 bits (61), Expect = 2.0 Identities = 20/117 (17%), Positives = 33/117 (28%), Gaps = 33/117 (28%) Query: 87 KSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSS 146 K+L R L ++ + Y ++ +G SLD L+ V R Sbjct: 188 KTLLEGPREIDLRDELLKFYKNWYSSNIMTLVIVGKE---------SLDVLESLVTRLFD 238 Query: 147 FYQEKEIPRPVW--------WHGFRI----------------CPLSIEFWSERPYRL 179 K+ PRPV+ + P + +P R Sbjct: 239 EISNKKKPRPVFPEPPFLPEELKKLVRVVPIKDGRSLMISWPVPPLNHHYKSKPLRY 295 >gnl|CDD|58536 cd04367, IlGF_insulin_like, IlGF_like family, insulin_like subgroup, specific to vertebrates. Members include a number of peptides including insulin and insulin-like growth factors I and II, which play a variety of roles in controlling processes such as metabolism, growth and differentiation, and reproduction. On a cellular level they affect cell cycle, apoptosis, cell migration, and differentiation. With the exception of the insulin-like growth factors, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.. Length = 79 Score = 26.5 bits (58), Expect = 5.2 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 59 GFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYC 103 GF FYT + ++ L + + ++ R RG+VE+ C Sbjct: 22 GF-FYTPKRRRDVEDPLVPQEQAAGLQPQAQEEIKRKRGIVEQCC 65 >gnl|CDD|33544 COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 167 Score = 26.0 bits (57), Expect = 6.2 Identities = 8/28 (28%), Positives = 14/28 (50%) Query: 132 PSLDDLQKSVQRYSSFYQEKEIPRPVWW 159 +++ L + + S +YQ PRP W Sbjct: 135 VAIERLLEGLGGISVYYQPAADPRPKSW 162 >gnl|CDD|29748 cd01145, TroA_c, Periplasmic binding protein TroA_c. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.. Length = 203 Score = 26.2 bits (57), Expect = 7.2 Identities = 12/45 (26%), Positives = 16/45 (35%) Query: 30 DPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEI 74 DPH L +D A +V+ + EGF S K Sbjct: 35 DPHQYQLKPSDIAKMRKADLVVTSGHELEGFEPKLAELSSNSKVQ 79 >gnl|CDD|144473 pfam00888, Cullin, Cullin family. Length = 605 Score = 25.7 bits (56), Expect = 9.1 Identities = 10/42 (23%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Query: 121 GAWASKQSQK--MPSLDDLQKSVQRYSSFYQEKEIPRPVWWH 160 G W + ++ +P ++L+K+++++ FY +K R + W Sbjct: 475 GFWPTLPTEPFSLP--EELEKALEKFEEFYSKKHSGRKLTWL 514 >gnl|CDD|38506 KOG3296, KOG3296, KOG3296, Translocase of outer mitochondrial membrane complex, subunit TOM40 [Intracellular trafficking, secretion, and vesicular transport]. Length = 308 Score = 25.6 bits (56), Expect = 9.4 Identities = 11/69 (15%), Positives = 19/69 (27%), Gaps = 7/69 (10%) Query: 32 HAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLAR 91 + T + G Q G F TN++ + + + Sbjct: 206 NWDATVTLGQQGLTGTYYQRAVEKLQMGVEFETNTRLQS-------TDVTAAYGYDLPTA 258 Query: 92 QLRVRGLVE 100 Q RG V+ Sbjct: 259 QSVFRGSVD 267 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.134 0.428 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,555,999 Number of extensions: 124316 Number of successful extensions: 295 Number of sequences better than 10.0: 1 Number of HSP's gapped: 291 Number of HSP's successfully gapped: 21 Length of query: 201 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 112 Effective length of database: 4,340,536 Effective search space: 486140032 Effective search space used: 486140032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.0 bits)