>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate,

Probab=96.65 E-value=0.015 Score=36.44 Aligned_cols=72 Identities=17% Similarity=0.210 Sum_probs=49.4 Q ss_pred CCCCEEEEECCCCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH Q ss_conf 299789994889884179999999998898-8999848988999999997138928999888999999999999999984 Q gi|254781166|r 8 MKDKRGIVLGVANNRSLAWSIAKMCHAAGA-KVALTWQGDATKKRIEGLVEGMDFFMAGHCNVSNSETIDDVFRNLEKEW 86 (284) Q Consensus 8 L~~K~~iVtGa~g~~GIG~aiA~~la~~Ga-~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~ 86 (284) T Consensus 176 l~~~~vLviGaGe---m~~l~~~~L~~~g~~~i~v~nRt~~ra~~la~---~~g~------~~~~~~~-------l~~~l 236 (311) T cd05213 176 LKGKKVLVIGAGE---MGELAAKHLAAKGVAEITIANRTYERAEELAK---ELGG------NAVPLDE-------LLELL 236 (311) T ss_pred CCCCEEEEECCCH---HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHH---HCCC------EEECHHH-------HHHHH T ss_conf 2116799986879---99999999996599825997686789999999---7498------9972999-------99999 Q ss_pred CCCCEEEECCCC Q ss_conf 798899962721 Q gi|254781166|r 87 GTIDFLVHAIAF 98 (284) Q Consensus 87 G~iD~lInnag~ 98 (284) T Consensus 237 ~~~DvvisaT~s 248 (311) T cd05213 237 NEADVVISATGA 248 (311) T ss_pred HHCCEEEEECCC T ss_conf 768999992799

HHsearch alignment for GI: 254781166 and conserved domain: cd05213