HHsearch alignment for GI: 254781167 and conserved domain: PRK03220

>PRK03220 consensus.
Probab=97.26  E-value=0.00064  Score=48.72  Aligned_cols=92  Identities=14%  Similarity=0.189  Sum_probs=73.3

Q ss_pred             CHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH-CCCCE
Q ss_conf             01455432000122012100135664025774212276610467876667388753025777789989888742-03523
Q gi|254781167|r  135 ALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILP-SVDGV  213 (322)
Q Consensus       135 ~~~~~~~~~~~~g~~~itiH~Rt~~~~g~s~~~~~~~~~~~~~~i~~l~~~~~~~~i~~NGdi~~~~~a~~~l~-~~dgv  213 (322)
T Consensus        32 dP~~~a~~~~~~G~d~lhivDld----~---a~--~g~~~n~~~I~~i~~~~-~~pi~vGGGIrs~e~~~~ll~~GadkV  101 (257)
T PRK03220         32 DPVELAAVYDAEGADELTFLDVT----A---SS--SGRATMLDVVRRTAEQV-FIPLTVGGGVRTVEDVDSLLRAGADKV  101 (257)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECC----C---CC--CCCHHHHHHHHHHHHCC-CCCEEEECCCCCHHHHHHHHHCCCCEE
T ss_conf             99999999998699989999088----8---75--67630799999998506-964898478587999999998197508


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCC
Q ss_conf             44122000124399999987199
Q gi|254781167|r  214 MIGRAAYKNSAMLTTVDEYFSNP  236 (322)
Q Consensus       214 MigRga~~~P~if~~I~~~l~~~  236 (322)
T Consensus       102 vigs~a~~~p~~~~~~~~~fG~q  124 (257)
T PRK03220        102 SVNTAAIARPELLAELARRFGSQ  124 (257)
T ss_pred             ECHHHHHHCCHHHHHHHHHCCCE
T ss_conf             72066775947778999870986