HHsearch alignment for GI: 254781167 and conserved domain: PRK04281

>PRK04281 consensus.
Probab=97.16  E-value=0.00062  Score=48.83  Aligned_cols=92  Identities=14%  Similarity=0.239  Sum_probs=72.8

Q ss_pred             CHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH-CCCCE
Q ss_conf             01455432000122012100135664025774212276610467876667388753025777789989888742-03523
Q gi|254781167|r  135 ALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILP-SVDGV  213 (322)
Q Consensus       135 ~~~~~~~~~~~~g~~~itiH~Rt~~~~g~s~~~~~~~~~~~~~~i~~l~~~~~~~~i~~NGdi~~~~~a~~~l~-~~dgv  213 (322)
T Consensus        31 dP~~~ak~~~~~GadelhivD----ld~---a--~~~~~~~~~~I~~i~~~~-~vpi~vGGGIrs~e~~~~ll~~GadkV  100 (254)
T PRK04281         31 DPVEAAKRYNGEGADELTFLD----ITA---S--SDNRDTILHIIEEVAGQV-FIPLTVGGGVRTVADIRRLLNAGADKV  100 (254)
T ss_pred             CHHHHHHHHHHCCCCEEEEEE----CCC---C--CCCCHHHHHHHHHHHHHC-CCCEEEECCEEECHHHHHHHHCCCCEE
T ss_conf             999999999986999999996----889---8--777530899999998507-962899777545188999997699889


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCC
Q ss_conf             44122000124399999987199
Q gi|254781167|r  214 MIGRAAYKNSAMLTTVDEYFSNP  236 (322)
Q Consensus       214 MigRga~~~P~if~~I~~~l~~~  236 (322)
T Consensus       101 iigs~a~~np~~l~~~~~~fG~q  123 (254)
T PRK04281        101 SINTAAVTRPDLIDEAAGFFGSQ  123 (254)
T ss_pred             EECHHHHHCCHHHHHHHHHCCCE
T ss_conf             97776764926767678755982