HHsearch alignment for GI: 254781167 and conserved domain: PRK05458

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional.
Probab=94.43  E-value=0.14  Score=31.47  Aligned_cols=95  Identities=19%  Similarity=0.332  Sum_probs=59.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHCCCCC--CHHHH---HHHHHHHHCCCCCCCCCCCCC
Q ss_conf             5899999999985027906999861134566532201455432000122--01210---013566402577421227661
Q gi|254781167|r  100 NPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGV--NGIWI---HARKAILKGLSPKDNRKIPNL  174 (322)
Q Consensus       100 ~p~~~~~iv~~~~~~~~~pvsvK~RlG~~~~~~~~~~~~~~~~~~~~g~--~~iti---H~Rt~~~~g~s~~~~~~~~~~  174 (322)
T Consensus        70 ~~e~~~~~~~~~~~~-~~--~~~iSvGi~~~-~----~~~i~~l~~~~~~~~~i~iDvAhG~~~---------------~  126 (326)
T PRK05458         70 DPEARIPFIKDMHER-GL--IASISVGVKDD-E----YDFIDQLAAEGLTPEYITIDIAHGHSD---------------S  126 (326)
T ss_pred             CHHHHHHHHHHCCCC-CC--EEEEEECCCHH-H----HHHHHHHHHCCCCCCEEEEECCCCCHH---------------H
T ss_conf             889999999852323-72--79999479989-9----999999985699977799980564428---------------9


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH-CCCCEEEECC
Q ss_conf             0467876667388753025777789989888742-0352344122
Q gi|254781167|r  175 DYDIVYEIKKENPDLFIGLNGGLEDMSQALKILP-SVDGVMIGRA  218 (322)
Q Consensus       175 ~~~~i~~l~~~~~~~~i~~NGdi~~~~~a~~~l~-~~dgvMigRg  218 (322)
T Consensus       127 ~~~~i~~ik~~~~~~~ii-aGNVaT~e~~~~L~~~Gad~VkVGIG  170 (326)
T PRK05458        127 VINMIKHIKKHLPETFVI-AGNVGTPEAVRELENAGADATKVGIG  170 (326)
T ss_pred             HHHHHHHHHHHCCCCCEE-ECCCCCHHHHHHHHHCCCCEEEECCC
T ss_conf             999999999878998399-65431899999999749999996777