HHsearch alignment for GI: 254781171 and conserved domain: PRK13027

>PRK13027 C4-dicarboxylate transporter DctA; Reviewed.
Probab=100.00  E-value=0  Score=710.43  Aligned_cols=403  Identities=19%  Similarity=0.334  Sum_probs=372.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             54499999999999999999968875788878789999999999999999999999832531134665899999999999
Q gi|254781171|r   12 QQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLT   91 (420)
Q Consensus        12 ~~k~~i~l~~~illGi~~G~~~~~~~~~~~~~iG~ifi~lLkmiviPLIf~sii~~I~~l~~~~~~gki~~~ti~~~~~t   91 (420)
T Consensus         6 ~~~L~~~IligivlGi~~G~~~p~~-~~~i~~~G~lFl~lLkmiVvPLIf~sIi~gIa~l~~~~~lGrig~kti~~fl~t   84 (442)
T PRK13027          6 LRSLFGQVVIALVLGVALGAFFPHF-AESLKPLGDGFIKLIKMLIGPIVFCVVVSGIAGAGDLKKVGRVGLKAVIYFEVM   84 (442)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             8989999999999999999973888-999977899999999999999999999999963846252136999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCC-----------CCCCCCCCHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             99999998750123486410110000-----------1222447689899985366404576551132053556664213
Q gi|254781171|r   92 TMLAASVALCTYGLISPSNMITKPDV-----------AVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIA  160 (420)
Q Consensus        92 t~iA~~igl~~~~l~~Pg~~~~~~~~-----------~~~~~~~~~~~~l~~liP~Ni~~ala~gniL~iivfai~~Gia  160 (420)
T Consensus        85 t~iA~~igl~~~~l~~PG~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~liP~Ni~~a~a~gnvL~vIvFAil~Gia  164 (442)
T PRK13027         85 TTIALVIGLVLAYLTGPGVGMNIDLRSLDAASLAGYAKNAQSLKGTAGFLMKLIPTTAVDAFAKGDILQVLLFSVLFGSA  164 (442)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHCCCCCCCCCHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             99999999999999655644566832201455432114553446699999996787589886557709999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77404645301799999999999999989879897778789999999850112111012468999999999999999876
Q gi|254781171|r  161 THFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPV  240 (420)
Q Consensus       161 ~~~~~~k~~~~~~~~~~~~~~~i~~~ii~~im~l~Pigvf~lia~~~~~~~~~~~l~~l~~~l~~~~~~~~i~~~v~~~~  240 (420)
T Consensus       165 l~~~~e~--~~~l~~~~~~l~~v~~kii~~Ii~laPigVfaliA~~v~~~g~~-~l~~l~~~v~~~~~~~~i~~~i~~~~  241 (442)
T PRK13027        165 LSLVGEK--AKRVNSLIDELSHVFFRIMGFIIKLAPLGVLGAIAFTTGKYGVG-SLKQLGMLVAVFYLTCFVFVVVVLGA  241 (442)
T ss_pred             HHHCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8742744--44699999999999999999999799999999999999970189-99999999999999999999999999


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC
Q ss_conf             64412504110011002478898885176550779999997317899889989999998737885056779999997423
Q gi|254781171|r  241 ILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQN  320 (420)
Q Consensus       241 i~~~~~~np~~~~k~~~~~~~~Af~T~SS~atlP~~l~~~~~~lgv~~~i~~fviPlG~tinm~G~ai~~~~~~~f~a~~  320 (420)
T Consensus       242 i~~~~~~~p~~f~k~~~~~~~~Af~T~SSaATLPvt~~~~e-klGV~~~ia~fvlPLGaTiNmdGtAiy~~~~~iFiAq~  320 (442)
T PRK13027        242 VMRLAGFSVFKLIRYLREELLIVLGTASSDAVLPQVMRKLE-HMGIKDSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAQA  320 (442)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH-HCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99981998889887501678888632420114569999999-75979200335555545038860499999999998998


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69788956799999999999842138864159999999997549-99999999996577641567899987789999999
Q gi|254781171|r  321 NGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMG-IPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIV  399 (420)
Q Consensus       321 ~gi~l~~~~~~~~i~~~~v~as~g~~gvPg~~~v~~~~vl~~~g-lP~~~~~lli~id~i~D~~rT~~NV~gd~~~a~iv  399 (420)
T Consensus       321 ~Gi~ls~~~~~-~i~~~a~lasiG~aGVPg~g~v~l~~vL~~~g~lP~e~i~lil~iD~~lDm~RT~~NV~Gd~~~a~iV  399 (442)
T PRK13027        321 TNTPLSMHDLI-TILLVSLVTSKGAHGIPGSAIVILAATLSAIPAIPVLGLVLILPVDWFMGIARALTNLIGNCVATVVV  399 (442)
T ss_pred             HCCCCCHHHHH-HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             28999999999-99999999962357886378999999999757775978999985896630538987446665899998


Q ss_pred             HHHHHHHHHHHHHHHHHHCCC
Q ss_conf             987300013477545430259
Q gi|254781171|r  400 NKSYPKSSDHPENAIVQNSVE  420 (420)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~e  420 (420)
T Consensus       400 ~~~e~~lD~~~~~~~~~~~~~  420 (442)
T PRK13027        400 ARWENDIDRARAQAVLNGELR  420 (442)
T ss_pred             HHHCCHHHHHHHHHHHCCCCC
T ss_conf             784163209999998579999