HHsearch results for GI: 254781174 and protein with PDBid: 2vyi_A

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1
Probab=99.17  E-value=5.8e-10  Score=74.91  Aligned_cols=118  Identities=15%  Similarity=0.082  Sum_probs=102.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             68998778877654555679999988754011211013555443444555544311123458999999999998520010
Q gi|254781174|r   94 RKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSP  173 (271)
Q Consensus        94 ~~A~~~la~~~y~~~~y~~A~~~~~~fi~~~P~s~~~~~A~y~~a~~~~~~~~~~~~d~~~~~~A~~~f~~~i~~yP~S~  173 (271)
                      .+++...|..++..|+|++|+..|++.++..|++.   .+++..|.|+..+        +...+|+..++..+...|++.
T Consensus        12 ~e~l~~~G~~~~~~~~y~~A~~~~~~al~~~p~~~---~~~~~l~~~~~~~--------~~~~~A~~~~~~~l~~~p~~~   80 (131)
T 2vyi_A           12 AERLKTEGNEQMKVENFEAAVHFYGKAIELNPANA---VYFCNRAAAYSKL--------GNYAGAVQDCERAICIDPAYS   80 (131)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH---HHHHHHHHHHHHT--------TCHHHHHHHHHHHHHHCTTCH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHC--------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999995899999999999998689989---9998488998872--------776889999999998863237


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             134565555555666666655566666544322345689998865289981159999999999997498
Q gi|254781174|r  174 YVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALAL  242 (271)
Q Consensus       174 ya~~A~~~l~~~~~~La~~e~~ia~~Y~~~~~y~aA~~~~~~~i~~yp~t~~~~eAl~~l~~~y~~lg~  242 (271)
                      .   +.              +.+|..|...|++..|+..|+.+++..|+.+   ++...++.++.+++.
T Consensus        81 ~---~~--------------~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~---~~~~~l~~~~~~l~e  129 (131)
T 2vyi_A           81 K---AY--------------GRMGLALSSLNKHVEAVAYYKKALELDPDNE---TYKSNLKIAELKLRE  129 (131)
T ss_dssp             H---HH--------------HHHHHHHHHTTCHHHHHHHHHHHHHHSTTCH---HHHHHHHHHHHHHTT
T ss_pred             H---HH--------------HHHHHHHHCCCCHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHCC
T ss_conf             9---99--------------8899998502569999999999997696989---999999999998738