HHsearch alignment for GI: 254781177 and conserved domain: PRK13311

>PRK13311 N-acetyl-D-glucosamine kinase; Provisional.
Probab=94.76  E-value=0.24  Score=27.38  Aligned_cols=67  Identities=15%  Similarity=0.169  Sum_probs=44.1

Q ss_pred             EEEEEEECCCEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHCCEEEE
Q ss_conf             79999914980699999833766533335677615999996110111008837478999999999999999982976537
Q gi|254781177|r   23 IVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDN  102 (440)
Q Consensus        23 ii~~iDiGsski~~~v~e~~~~~~~~~~~~~~~~~~iig~g~~~s~gi~~G~I~d~~~~~~~I~~ai~~ae~~ag~~i~~  102 (440)
T Consensus         1 MylGiDIGGTki~~~l~d~~--------------g~~~~~~~~~T~~------~~~~~~~~~i~~l~~~~~~~~~~~-~~   59 (256)
T PRK13311          1 MYYGFDMGGTKIELGVFDEN--------------LQRIWHKRVPTPR------EDYPQLLQILRDLTEEADTYCGVQ-GS   59 (256)
T ss_pred             CEEEEECCCHHEEEEEEECC--------------CCEEEEEEECCCC------CCHHHHHHHHHHHHHHHHHHCCCC-CE
T ss_conf             99999934101102899699--------------9899999974998------579999999999999988746988-75


Q ss_pred             EEEECCCC
Q ss_conf             99972687
Q gi|254781177|r  103 LLVNISAG  110 (440)
Q Consensus       103 v~v~i~g~  110 (440)
T Consensus        60 IGig~pG~   67 (256)
T PRK13311         60 VGIGIPGL   67 (256)
T ss_pred             EEEEECCC
T ss_conf             99980777