PSIBLAST alignment of GI: 254781177 and protein with PDB id: 2e8a

>gi|166007013|pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391
 Score = 71.6 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 46/372 (12%), Positives = 114/372 (30%), Gaps = 45/372 (12%)

Query: 25  SALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQ---SHGVKMGTIVDIDAV 81
             +D+G+T +   + +       +   G       +     +       K    ++    
Sbjct: 10  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNT 69

Query: 82  ERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSF 141
               ++++       G    + +V                   ++ +ND D   +  S  
Sbjct: 70  VFDAKRLI-------GRKFGDPVVQSDMKH-----------WPFQVINDGDKPKVQVSYK 111

Query: 142 RRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAIN 201
                     +   ++T      ++ +  P+        + +       S  +  + A  
Sbjct: 112 GETKAFYPEEISSMVLTKMKEIAEAYLGYPV-----TNAVITVPAYFNDSQRQATKDAGV 166

Query: 202 RAHLSVERMVASPYASGLATL--VDDEFELGSVVIDMGGGTTKIAIFDKGKLVY-----M 254
            A L+V R++  P A+ +A       + E   ++ D+GGGT  ++I      ++      
Sbjct: 167 IAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATA 226

Query: 255 DVIAIGGSHVTNDLARGLSISLDNAE------------RLKVMHPSIIPSLADEHDILSI 302
               +GG    N L                        RL+        +L+        
Sbjct: 227 GDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLE 286

Query: 303 PTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQV 362
                   +    ++RA    +       T E + + ++ +         +VL GG++++
Sbjct: 287 IDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRI 346

Query: 363 IGLQEMLRETIC 374
             +Q++L++   
Sbjct: 347 PKVQKLLQDFFN 358