RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781178|ref|YP_003065591.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] (304 letters) >gnl|CDD|149506 pfam08478, POTRA_1, POTRA domain, FtsQ-type. FtsQ/DivIB bacterial division proteins (pfam03799) contain an N-terminal POTRA domain (for polypeptide-transport-associated domain). This is found in different types of proteins, usually associated with a transmembrane beta-barrel. FtsQ/DivIB may have chaperone-like roles, which has also been postulated for the POTRA domain in other contexts. Length = 67 Score = 73.0 bits (180), Expect = 8e-14 Identities = 25/67 (37%), Positives = 36/67 (53%) Query: 90 IEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTM 149 I +V + GN +I L + TS D I+ +L LPWI A +RR +P+T+ Sbjct: 1 IRQVEVSGNKHVSAEEIRKALGIQKGTSFFSVDLNAIEDRLEKLPWIKSASVRRQWPNTL 60 Query: 150 EIRLTER 156 EIR+ ER Sbjct: 61 EIRVVER 67 >gnl|CDD|182720 PRK10775, PRK10775, cell division protein FtsQ; Provisional. Length = 276 Score = 61.3 bits (149), Expect = 3e-10 Identities = 44/155 (28%), Positives = 73/155 (47%), Gaps = 11/155 (7%) Query: 126 IQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITA-FNHV 184 IQ+Q+ LPWI +R+ +PD ++I L E P A W + +++D G + + Sbjct: 96 IQQQIERLPWIKQVSVRKQWPDELKIHLVEYVPIARWND---QHMVDAEGNSFSVPADRT 152 Query: 185 RFAYLPILIG-ENIYKAV-RSFEVLSNIAGITKF-VKAYNWIAERRWDLHLHNGIIIKLP 241 LP+L G E V + + + + KF +K A R W L L+N I ++L Sbjct: 153 GKQVLPMLYGPEGSENEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNDIRLELG 212 Query: 242 EEKFDVAIAKILE----LQNKYQILDRDISVIDMR 272 +A+ +E LQ + Q + IS +D+R Sbjct: 213 RGDTMKRLARFIELYPVLQQQAQTDGKRISYVDLR 247 >gnl|CDD|135428 PRK05529, PRK05529, cell division protein FtsQ; Provisional. Length = 255 Score = 45.3 bits (107), Expect = 2e-05 Identities = 23/90 (25%), Positives = 39/90 (43%) Query: 89 SIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDT 148 ++ + + GN+ DI+ L L D ++K+L A P I + P T Sbjct: 62 ALRSIEVAGNMRVKPQDIVAALRDQFGKPLPLVDPETVRKKLAAFPLIRSYSVESKPPGT 121 Query: 149 MEIRLTERHPYAIWQNNSALYLIDNNGYVI 178 + +R+ ER P A Q +++D G I Sbjct: 122 IVVRVVERVPLAFIQRGDGFHVVDAAGVSI 151 >gnl|CDD|182901 PRK11017, codB, cytosine permease; Provisional. Length = 404 Score = 31.4 bits (72), Expect = 0.28 Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 9 LSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFF 61 + R V+ + L L NF+ + L +P GVI+A +F Sbjct: 287 TRLSSRTLTVVNGIIGTVLALWLYN--NFVGWLTLLGSAIPPVGGVIIADYFM 337 >gnl|CDD|152029 pfam11593, Med3, Mediator complex subunit 3 fungal. Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor. Length = 381 Score = 30.8 bits (69), Expect = 0.42 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 239 KLPEEKFDVAIAKILELQNKYQILDRDI 266 K +EKF + +K+LEL N Q L +D Sbjct: 61 KTSQEKFLLIRSKLLELYNNIQKLSKDF 88 >gnl|CDD|178161 PLN02546, PLN02546, glutathione reductase. Length = 558 Score = 29.8 bits (67), Expect = 0.82 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 140 EIRRLYPDTMEIR----LTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFA 187 E+R + M +R TE P AI ++ + N + F+HV FA Sbjct: 294 EVRDFVAEQMSLRGIEFHTEESPQAIIKSADGSLSLKTNKGTVEGFSHVMFA 345 >gnl|CDD|152883 pfam12449, DUF3684, Protein of unknown function (DUF3684). This domain family is found in eukaryotes, and is typically between 1072 and 1090 amino acids in length. Length = 1082 Score = 29.2 bits (66), Expect = 1.3 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 164 NNSAL-YLIDN---NGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSN 209 + A+ Y I N NGY + V A+LP E K + E ++ Sbjct: 733 RDKAMSYFISNHHANGYAAFDISAVTIAFLPAEGNEKEGKLSKPSECFTD 782 >gnl|CDD|182651 PRK10692, PRK10692, hypothetical protein; Provisional. Length = 92 Score = 28.0 bits (63), Expect = 2.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 53 GVILAIFFFAIVGIYGASIGGH 74 G +L+IF A++ + GA +GG Sbjct: 45 GALLSIFVGALLWLAGARVGGR 66 >gnl|CDD|179166 PRK00915, PRK00915, 2-isopropylmalate synthase; Validated. Length = 513 Score = 28.2 bits (64), Expect = 3.1 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Query: 238 IKLPEEKFDVAIAKILELQN-KYQILDRDI-----SVIDMRLPDRL---SVRLTTGS 285 KL +E+ D A + EL + K ++ D D+ P+ S+++ +GS Sbjct: 346 YKLSDEELDKAFERFKELADKKKEVFDEDLEALVEDETQQEEPEHYKLESLQVQSGS 402 >gnl|CDD|163382 TIGR03662, Chlor_Arch_YYY, Chlor_Arch_YYY domain. Members of this highly hydrophobic probable integral membrane family belong to two classes. In one, a single copy of the region modeled by This model represents essentially the full length of a strongly hydrophobic protein of about 700 to 900 residues (variable because of long inserts in some). The domain architecture of the other class consists of an additional N-terminal region, two copies of the region represented by this model, and three to four repeats of TPR, or tetratricopeptide repeat. The unusual species range includes several Archaea, several Chloroflexi, and Clostridium phytofermentans. An unusual motif YYYxG is present, and we suggest the name Chlor_Arch_YYY protein. The function is unknown. Length = 723 Score = 27.8 bits (62), Expect = 3.6 Identities = 22/91 (24%), Positives = 33/91 (36%), Gaps = 12/91 (13%) Query: 1 MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFF 60 A R R L++ + L VLGL + N +F P Y G+ + F Sbjct: 291 ALAWWLRPKGEQRPRWLILLL---LALVLGLLAVTNSWDF--------PIYAGLAGLVVF 339 Query: 61 FAIVGIYGASIGGHTRK-VIDIVDSFIGFSI 90 A Y A G R+ VI + + + Sbjct: 340 AAYGRPYRAPGNGWLREAVILALGQAVLVPV 370 >gnl|CDD|161847 TIGR00380, cobD, cobalamin biosynthesis protein CobD. This protein is involved in cobalamin (vitamin B12) biosynthesis and porphyrin biosynthesis. It converts cobyric acid to cobinamide by the addition of aminopropanol on the F carboxylic group. It is part of the cob operon. Length = 305 Score = 27.5 bits (61), Expect = 4.8 Identities = 10/45 (22%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 53 GVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIG 97 GV +F+ + G+ GA + + ++ +D+ +G+ E +G Sbjct: 156 GVTAPLFYAILFGLPGAFV----YRAVNTLDAMVGYKREPYTDLG 196 >gnl|CDD|132072 TIGR03027, pepcterm_export, putative polysaccharide export protein, PEP-CTERM sytem-associated. This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by Pfam model pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system. Length = 165 Score = 27.3 bits (61), Expect = 4.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 81 IVDSFIGFSIEKVRIIGNVETPEA 104 IV FIG E++R++G P+A Sbjct: 69 IVTGFIGPFSEQIRVVGAAANPQA 92 >gnl|CDD|178460 PLN02871, PLN02871, UDP-sulfoquinovose:DAG sulfoquinovosyltransferase. Length = 465 Score = 27.4 bits (61), Expect = 4.8 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Query: 94 RIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALP 134 RII V + D+IH +S ++ F A+ K LL +P Sbjct: 135 RIISEVARFKPDLIHA----SSPGIMVFGALFYAK-LLCVP 170 >gnl|CDD|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE). This family of prokaryotic proteins models a class of Mg++ transporter first described in Bacillus firmus. May form a homodimer. Length = 449 Score = 27.1 bits (60), Expect = 5.6 Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Query: 236 IIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVD 294 I I L E+ + K L+ Q DI+ RLP + L F+ ++ VD Sbjct: 11 IRILLKEKSYSKIKEKFLKXQPX------DIAEALKRLPGTELILLY--RFLPKKIAVD 61 >gnl|CDD|149044 pfam07760, DUF1616, Protein of unknown function (DUF1616). This is a family of sequences from hypothetical archaeal proteins. The region in question is approximately 330 amino acid residues long. Length = 278 Score = 26.5 bits (59), Expect = 7.8 Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query: 13 RRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIY 67 R L +G+S+++ ++GL LN+ + ++ P + F +V Y Sbjct: 58 ERAALSVGLSIAIVPLIGL-----GLNYTPWGIRLAPILISLSAFTLIFCLVAYY 107 >gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial. A deep split separates two families of GMP reductase. The other (TIGR01305) is found in eukaryotic and some proteobacterial lineages, including E. coli, while this family is found in a variety of bacterial lineages. Length = 321 Score = 26.4 bits (58), Expect = 9.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 73 GHTRKVIDIVDSFIGFSIEKVRIIGNVETPEA 104 GH+ VI+++ + I GNV TPEA Sbjct: 119 GHSNSVINMIKHIKTHLPDSFVIAGNVGTPEA 150 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.329 0.145 0.437 Gapped Lambda K H 0.267 0.0699 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,255,388 Number of extensions: 357167 Number of successful extensions: 949 Number of sequences better than 10.0: 1 Number of HSP's gapped: 948 Number of HSP's successfully gapped: 38 Length of query: 304 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 211 Effective length of database: 3,984,929 Effective search space: 840820019 Effective search space used: 840820019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 57 (25.8 bits)