RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|152532 pfam12097, DUF3573, Protein of unknown function (DUF3573). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 372 to 530 amino acids in length. Length = 375 Score = 26.8 bits (59), Expect = 1.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 14 VNNEQLTEIEEPQKVTVDQINNAIASLI 41 VN+ LT E + +++ Q NN IAS I Sbjct: 80 VNDSTLTGNGETKVLSLGQRNNNIASDI 107 >gnl|CDD|180871 PRK07191, flgK, flagellar hook-associated protein FlgK; Validated. Length = 456 Score = 25.6 bits (56), Expect = 3.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 6 QSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASL 40 N+ + +Q I + + TV QIN+ S+ Sbjct: 141 LRFNNVNNFIVQQKKSIGQQRDATVKQINSLTRSI 175 >gnl|CDD|183571 PRK12522, PRK12522, RNA polymerase sigma factor; Provisional. Length = 173 Score = 24.4 bits (53), Expect = 5.7 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Query: 12 DLVNNEQLTEIEEPQKVTVDQ--INNAIASLIPEERRDLQDR 51 DL + E EIE V + + I A +I E + L ++ Sbjct: 82 DLFHKEDGGEIEFADDVNISEEFIQKVEAEMIREVIQLLNEK 123 >gnl|CDD|178411 PLN02815, PLN02815, L-aspartate oxidase. Length = 594 Score = 24.7 bits (54), Expect = 5.8 Identities = 10/36 (27%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Query: 31 DQINNAIASLIPEERRDLQDRMAKY-----STRKLK 61 D + + I R++LQ M Y ST +L+ Sbjct: 457 DSVMDEILEWTAVVRKELQRIMWNYVGIVRSTERLE 492 >gnl|CDD|149702 pfam08726, efhand_Ca_insen, Ca2+ insensitive EF hand. EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes. EF hands usually bind to Ca2+ ions which causes a major conformational change that allows the protein to interact with its designated targets. This domain corresponds to an EF hand which has partially or entirely lost its calcium-binding properties. The calcium insensitive EF hand is still able to mediate protein-protein recognition. Length = 69 Score = 24.5 bits (54), Expect = 6.8 Identities = 7/19 (36%), Positives = 9/19 (47%) Query: 38 ASLIPEERRDLQDRMAKYS 56 +L PE+ RM YS Sbjct: 29 RALTPEQAEYCIARMPPYS 47 >gnl|CDD|183652 PRK12652, PRK12652, putative monovalent cation/H+ antiporter subunit E; Reviewed. Length = 357 Score = 24.3 bits (53), Expect = 7.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Query: 13 LVNNEQLTEIEEPQKVTVDQINNA--IASLIPEERRDLQD 50 L N+ LT P +TVD + + SL P R DL D Sbjct: 276 LANSITLT----PGTLTVDVDDRHLLVHSLTPSAREDLFD 311 >gnl|CDD|130268 TIGR01201, HU_rel, DNA-binding protein, histone-like, putative. This model describes a set of proteins related to but longer than DNA-binding protein HU. Its distinctive domain architecture compared to HU and related histone-like DNA-binding proteins justifies the designation as superfamily. Members include, so far, one from Bacteroides fragilis, a gut bacterium, and ten from Porphyromonas gingivalis, an oral anaerobe. Length = 145 Score = 24.2 bits (53), Expect = 8.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 21 EIEEPQKVTVDQINNAIASLIPEERR 46 +EE ++V+ +Q+N A PE R Sbjct: 90 GVEEAEEVSAEQVNKARVLFTPEMRL 115 >gnl|CDD|147884 pfam05970, DUF889, PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated. Length = 418 Score = 23.8 bits (52), Expect = 9.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 25 PQKVTVDQINNAIASLIPEERRD 47 P VD+IN+ I +P E ++ Sbjct: 243 PTNEDVDEINDYILDQLPGEEKE 265 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.129 0.353 Gapped Lambda K H 0.267 0.0697 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,100,304 Number of extensions: 53824 Number of successful extensions: 137 Number of sequences better than 10.0: 1 Number of HSP's gapped: 137 Number of HSP's successfully gapped: 20 Length of query: 71 Length of database: 5,994,473 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,086,937 Effective search space: 147521173 Effective search space used: 147521173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.1 bits)