RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Length = 244 Score = 25.7 bits (56), Expect = 1.2 Identities = 10/45 (22%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Query: 1 MHSIHQSTNSCDLVNNEQLTEIEEP----QKVTVDQINNAIASLI 41 ++++ +S ++C + +NE L ++ + TVD +N I + Sbjct: 191 LNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEAL 235 >d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 245 Score = 25.3 bits (55), Expect = 1.6 Identities = 8/45 (17%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 1 MHSIHQSTNSCDLVNNEQLTEIEEP----QKVTVDQINNAIASLI 41 H+ + ++ +V+NE + +I ++ T +N I ++ Sbjct: 191 THTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIV 235 >d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 243 Score = 24.9 bits (54), Expect = 1.8 Identities = 8/45 (17%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 1 MHSIHQSTNSCDLVNNEQLTEI----EEPQKVTVDQINNAIASLI 41 +H + ++T+ ++NE L +I + T +N+ +++ + Sbjct: 189 VHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATM 233 >d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Length = 193 Score = 23.6 bits (51), Expect = 4.3 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 30 VDQINNAIA-SLIPEERRDLQDRMAKYS 56 V QI I + +R LQ+R+AK + Sbjct: 163 VAQIRQQIEEATSDYDREKLQERVAKLA 190 >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Score = 23.4 bits (49), Expect = 6.3 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 50 DRMAKYSTRKLKPRGRVIFAD 70 + + R LK GR + D Sbjct: 99 RKAVREVARVLKQDGRFLLVD 119 >d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Score = 23.2 bits (49), Expect = 7.0 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 33 INNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD 71 +++AI L EE+R L+ MAK+ L P+ + I + Sbjct: 1 VDDAINGL-SEEQRQLRQTMAKFLQEHLAPKAQEIDRSN 38 >d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 184 Score = 22.9 bits (49), Expect = 7.6 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 30 VDQINNAIA-SLIPEERRDLQDRMAKYS 56 V QI I S +R LQ+R+AK + Sbjct: 155 VAQIRQEIENSDSDYDREKLQERLAKLA 182 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.129 0.353 Gapped Lambda K H 0.267 0.0632 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 239,375 Number of extensions: 8356 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 10 Length of query: 71 Length of database: 2,407,596 Length adjustment: 39 Effective length of query: 32 Effective length of database: 1,872,126 Effective search space: 59908032 Effective search space used: 59908032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.1 bits)