Query gi|254781182|ref|YP_003065595.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 94 No_of_seqs 102 out of 125 Neff 4.9 Searched_HMMs 39220 Date Mon May 30 05:43:39 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781182.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK11448 hsdR type I restricti 98.9 6.9E-09 1.8E-13 72.5 7.8 66 8-73 54-119 (1126) 2 pfam05168 HEPN HEPN domain. 87.4 2.6 6.6E-05 22.7 8.4 67 8-74 47-115 (117) 3 COG4823 AbiF Abortive infectio 77.6 3.2 8.2E-05 22.1 3.7 37 17-53 179-215 (299) 4 COG2445 Uncharacterized conser 75.3 7.4 0.00019 20.0 8.7 67 13-82 63-130 (138) 5 pfam07751 Abi_2 Abi-like prote 60.5 15 0.00039 18.2 4.7 32 22-53 151-183 (187) 6 smart00748 HEPN Higher Eukaryt 55.6 19 0.00047 17.7 6.4 61 8-68 43-112 (113) 7 pfam01934 DUF86 Protein of unk 53.9 20 0.0005 17.5 6.4 47 12-59 55-102 (120) 8 PRK10022 putative DNA-binding 44.1 28 0.00072 16.6 5.3 53 13-68 61-116 (167) 9 TIGR00464 gltX_bact glutamyl-t 39.8 33 0.00085 16.2 4.0 58 3-64 260-323 (513) 10 pfam08343 RNR_N Ribonucleotide 38.3 29 0.00074 16.6 2.6 30 9-38 36-65 (82) 11 PRK11001 mtlR mannitol repress 33.6 42 0.0011 15.6 5.1 59 13-71 60-121 (170) 12 pfam09509 Hypoth_Ymh Protein o 33.6 41 0.0011 15.7 2.8 32 42-73 89-124 (124) 13 COG4770 Acetyl/propionyl-CoA c 32.9 43 0.0011 15.6 3.4 31 33-63 62-96 (645) 14 smart00580 PUG domain in prote 32.0 39 0.00099 15.8 2.4 26 37-62 3-29 (58) 15 pfam07126 DUF1379 Protein of u 31.5 42 0.0011 15.6 2.5 41 42-82 17-57 (154) 16 pfam11848 DUF3368 Domain of un 26.6 56 0.0014 14.9 2.8 29 15-45 4-32 (48) 17 pfam00289 CPSase_L_chain Carba 24.6 54 0.0014 15.0 2.1 29 32-60 60-88 (109) 18 pfam09969 DUF2203 Uncharacteri 23.4 64 0.0016 14.6 4.7 35 53-87 2-36 (120) 19 PRK12833 acetyl-CoA carboxylas 20.9 72 0.0018 14.3 2.6 25 34-58 66-90 (458) 20 PRK07187 ribonucleotide-diphos 20.7 73 0.0019 14.2 3.3 43 9-51 43-87 (722) No 1 >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Probab=98.90 E-value=6.9e-09 Score=72.51 Aligned_cols=66 Identities=24% Similarity=0.276 Sum_probs=61.5 Q ss_pred CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 689654488999999999868999899999999999731320688889899999999999999999 Q gi|254781182|r 8 RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIV 73 (94) Q Consensus 8 ~l~~~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g~~~~edA~~ll~f~~~il~~~ 73 (94) ++..|...+++++|+.|...++|++.+.+++|.||+.||.|||++..+.++|..++..+..++.|. T Consensus 54 ~l~~p~~~~~~~li~~~~f~~~i~~~i~~~~~~iRk~GN~AvH~~~~~~~~A~~~L~~~f~l~~W~ 119 (1126) T PRK11448 54 GIEEDERTTQHDLLRRLGKEGFLDDEILDVFHALRKIGNKAVHEFHGDHDDALMCLKLAFRLAVWF 119 (1126) T ss_pred CCCCCCCCCHHHHHHCHHHHHHCCHHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 899997657999865532454269899999999998681621589999899999999999999999 No 2 >pfam05168 HEPN HEPN domain. Probab=87.35 E-value=2.6 Score=22.67 Aligned_cols=67 Identities=16% Similarity=0.032 Sum_probs=54.6 Q ss_pred CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHHHHHH Q ss_conf 689654488999999999868999899999999999731320688--8898999999999999999998 Q gi|254781182|r 8 RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDECLEFVNLFCDIVF 74 (94) Q Consensus 8 ~l~~~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g--~~~~edA~~ll~f~~~il~~~~ 74 (94) +.+.|+.-++...++.+...+..+..+.+.+..+......+-=++ ..+.++|..+++.++.|++++- T Consensus 47 ~~~~p~~H~l~~L~~~l~~~~~~~~~~~~~~~~L~~~~i~~RYp~~~~~~~e~a~~~i~~a~~v~~~v~ 115 (117) T pfam05168 47 GGEPPKTHDLRRLLGELKKLLILPEELREILRELEKAYIPSRYPDADEPTEEDAEEALKIAEEVLEFVE 115 (117) T ss_pred CCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH T ss_conf 699998622999999988746695999999999989582663979888999999999999999999997 No 3 >COG4823 AbiF Abortive infection bacteriophage resistance protein [Defense mechanisms] Probab=77.62 E-value=3.2 Score=22.11 Aligned_cols=37 Identities=16% Similarity=0.338 Sum_probs=31.1 Q ss_pred HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCC Q ss_conf 9999999998689998999999999997313206888 Q gi|254781182|r 17 LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ 53 (94) Q Consensus 17 l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g~ 53 (94) ..++-+.-+.-|+=.+....|+|.|-+.+|-|+|.+. T Consensus 179 ~knk~kIakkyg~~~~~f~swl~~inliRNiCAHn~r 215 (299) T COG4823 179 IKNKKKIAKKYGYDAEYFQSWLHTINLIRNICAHNGR 215 (299) T ss_pred HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCE T ss_conf 4108899999487789999999999999998750451 No 4 >COG2445 Uncharacterized conserved protein [Function unknown] Probab=75.29 E-value=7.4 Score=20.01 Aligned_cols=67 Identities=18% Similarity=0.021 Sum_probs=48.5 Q ss_pred CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 448899999999986899989999999999973132068-8889899999999999999999861599999 Q gi|254781182|r 13 KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIVFTLPALIKE 82 (94) Q Consensus 13 k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~-g~~~~edA~~ll~f~~~il~~~~t~P~~ie~ 82 (94) +-+|-.+-+..|.++|+||++..+-+-.+.-..|.-||. +..+.+.. .+.+.-++......++.|+. T Consensus 63 ~p~~y~d~~~~L~~~gvi~~e~~e~L~~~~gfRN~lVH~Y~~vD~~~v---~~~l~~~~~~~~~f~e~i~~ 130 (138) T COG2445 63 DPGTYDDCIDILVEEGVIPEEEAEELKKMVGFRNILVHRYWAVDPEKV---YRSLKELLEDYENFLEEIRK 130 (138) T ss_pred CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHH---HHHHHHHHHHHHHHHHHHHH T ss_conf 999889999999985999879999999999888999888832788999---99999888899999999999 No 5 >pfam07751 Abi_2 Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function. Probab=60.50 E-value=15 Score=18.19 Aligned_cols=32 Identities=19% Similarity=0.389 Sum_probs=23.6 Q ss_pred HHHHHCCCCC-HHHHHHHHHHHHHHHHHCCCCC Q ss_conf 9999868999-8999999999997313206888 Q gi|254781182|r 22 RYLKQHNLII-EEIFEWSNFVRIEGNKAVHEGQ 53 (94) Q Consensus 22 ~~L~~~g~I~-~~i~~~~~~~R~~gN~a~H~g~ 53 (94) ..+..-+.++ +.+.+|++.||..+|.|+|.+. T Consensus 151 ~i~~~~~~~~~~~l~~~l~~i~~lRN~~AH~er 183 (187) T pfam07751 151 KIAKRFGPLNRKELESWLKSLRLLRNRCAHHER 183 (187) T ss_pred HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 999995789999999999999999978627782 No 6 >smart00748 HEPN Higher Eukarytoes and Prokaryotes Nucleotide-binding domain. Probab=55.64 E-value=19 Score=17.70 Aligned_cols=61 Identities=15% Similarity=0.024 Sum_probs=42.6 Q ss_pred CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC---------CCCHHHHHHHHHHHHH Q ss_conf 689654488999999999868999899999999999731320688---------8898999999999999 Q gi|254781182|r 8 RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG---------QSSIEESDECLEFVNL 68 (94) Q Consensus 8 ~l~~~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g---------~~~~edA~~ll~f~~~ 68 (94) +..+|++-++...++.+...+..++.+.+..+.++......+-.- ..+.++|..++++++. T Consensus 43 ~~~~pktH~l~~L~~~l~~~~~~~~~~~~~~~~~~~L~~~yi~sRYPd~~~p~~~y~~~~Ae~~l~~a~~ 112 (113) T smart00748 43 GGEPPKTHSLRELLSELEKLLRLPEFIDEIRECLNLLEEAYIKSRYPDAGEPLEWYTKEDAEELLKCAEE 112 (113) T ss_pred CCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHC T ss_conf 5999997889999999998636501079999999999997843559899885146799999999999753 No 7 >pfam01934 DUF86 Protein of unknown function DUF86. The function of members of this family is unknown. Probab=53.87 E-value=20 Score=17.53 Aligned_cols=47 Identities=21% Similarity=0.000 Sum_probs=38.9 Q ss_pred CCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC-CCCHHHH Q ss_conf 54488999999999868999899999999999731320688-8898999 Q gi|254781182|r 12 EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEES 59 (94) Q Consensus 12 ~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g-~~~~edA 59 (94) ++-++ .|-+..|.++|+|+.....-+-.+.-.+|.-||.. ..+.+.. T Consensus 55 ~~p~~-~d~~~~L~~~gii~~~~~~~l~~~~g~RN~LVH~Y~~id~~~v 102 (120) T pfam01934 55 RDPGS-RDIFDILAEEGVISEEPAIPWRKMAGLRNILVHGYFSIDLEIV 102 (120) T ss_pred CCCCH-HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHH T ss_conf 99855-8999999866777713556799998464363013133799999 No 8 >PRK10022 putative DNA-binding transcriptional regulator; Provisional Probab=44.15 E-value=28 Score=16.62 Aligned_cols=53 Identities=4% Similarity=-0.083 Sum_probs=40.0 Q ss_pred CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCHHHHHHHHHHHHH Q ss_conf 44889999999998689998999999999997313206888---898999999999999 Q gi|254781182|r 13 KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ---SSIEESDECLEFVNL 68 (94) Q Consensus 13 k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g~---~~~edA~~ll~f~~~ 68 (94) +-|.++=|++.|+.=|+|+....+-....-...+...|+++ |+.+ .+++|++. T Consensus 61 PLgdlsVRlKLl~gLGvIs~~~Y~Die~f~~l~e~ln~d~~~y~FtDd---~i~~~i~~ 116 (167) T PRK10022 61 PLDDIDVALRLIYALGKMDKWLYADITHFSQFWHYLNEQDETPGFADD---MTWDFISN 116 (167) T ss_pred CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCH---HHHHHHHH T ss_conf 952264499999981567488897599999999999648866785777---99999998 No 9 >TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Glutamyl-tRNA synthetase (6.1.1.17 from EC) is a class Ic synthetase and shows several similarities with glutaminyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. To date one crystal structure of a glutamyl-tRNA synthetase (Thermus thermophilus) has been solved. The molecule has the form of a bent cylinder and consists of four domains. The N-terminal half (domains 1 and 2) contains the 'Rossman fold' typical for class I synthetases and resembles the corresponding part of E. coli GlnRS, whereas the C-terminal half exhibits a GluRS-specific structure . ; GO: 0000166 nucleotide binding, 0004818 glutamate-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006424 glutamyl-tRNA aminoacylation, 0005737 cytoplasm. Probab=39.80 E-value=33 Score=16.22 Aligned_cols=58 Identities=16% Similarity=0.327 Sum_probs=42.6 Q ss_pred CCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCC-----CCC-CCHHHHHHHHH Q ss_conf 501046896544889999999998689998999999999997313206-----888-89899999999 Q gi|254781182|r 3 DDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-----EGQ-SSIEESDECLE 64 (94) Q Consensus 3 ~d~~e~l~~~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H-----~g~-~~~edA~~ll~ 64 (94) |+.|-+|+... |+.+.-|..+++.|++|+.|.+- +-+.|+.... .-| ||.+++.+.|+ T Consensus 260 ~~~gKKLSKRd-g~~~~si~q~~~~GyLPEAl~Ny---l~lLGW~~~~dlas~~~E~Fs~~elie~F~ 323 (513) T TIGR00464 260 NEDGKKLSKRD-GKTATSIEQFKEQGYLPEALINY---LALLGWSPPDDLASKDQEIFSLEELIEIFS 323 (513) T ss_pred CCCCCEEECCC-CHHHHHHHHHHHCCCCHHHHHHH---HHHHCCCCCCCCCCCCCCCCCHHHHHHCCC T ss_conf 69884001206-40257689998668877899999---998468965233446566367799982068 No 10 >pfam08343 RNR_N Ribonucleotide reductase N-terminal. This domain is found at the N-terminus of bacterial ribonucleoside-diphosphate reductases (ribonucleotide reductases, RNRs) which catalyse the formation of deoxyribonucleotides. It occurs together with the RNR all-alpha domain (pfam00317) and the RNR barrel domain (pfam02867). Probab=38.29 E-value=29 Score=16.58 Aligned_cols=30 Identities=23% Similarity=0.222 Sum_probs=23.6 Q ss_pred CCCCCCCCHHHHHHHHHHCCCCCHHHHHHH Q ss_conf 896544889999999998689998999999 Q gi|254781182|r 9 INFEKCGMLSDRTRYLKQHNLIIEEIFEWS 38 (94) Q Consensus 9 l~~~k~g~l~dri~~L~~~g~I~~~i~~~~ 38 (94) .|.-...|+..||++|.++|+..+++.+.. T Consensus 36 pnt~~F~sl~Erl~yLv~n~YYe~~vl~~Y 65 (82) T pfam08343 36 PNTVFFHSLEERLDYLVENGYYEEEVLDKY 65 (82) T ss_pred HHHEECCCHHHHHHHHHHCCCHHHHHHHHC T ss_conf 520104889999999998362779999767 No 11 >PRK11001 mtlR mannitol repressor protein; Provisional Probab=33.59 E-value=42 Score=15.64 Aligned_cols=59 Identities=19% Similarity=0.121 Sum_probs=40.9 Q ss_pred CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC---CCCHHHHHHHHHHHHHHHH Q ss_conf 4488999999999868999899999999999731320688---8898999999999999999 Q gi|254781182|r 13 KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG---QSSIEESDECLEFVNLFCD 71 (94) Q Consensus 13 k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g---~~~~edA~~ll~f~~~il~ 71 (94) +-|.|+=|++.|+.=|+|+....+-....-...+.-.|++ .|+.+....-+.=++.+-. T Consensus 60 PLgdLsVRLKLl~gLGvIs~~~y~Die~fi~Lke~Ln~d~~e~~FtD~~I~~~i~~Lh~v~~ 121 (170) T PRK11001 60 PLGDLSVRLKLLYGLGVISREEYEDIELLIALREELNHDGNEYRFTDDEILGPFGELHCVAA 121 (170) T ss_pred CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHH T ss_conf 94135359999988056758889769999999999963875478686899999987088761 No 12 >pfam09509 Hypoth_Ymh Protein of unknown function (Hypoth_ymh). This entry consists of a relatively rare prokaryotic protein family (about 8 occurrences per 200 genomes). Genes for members of this family appear to be associated variously with phage and plasmid regions, restriction system loci, transposons, and housekeeping genes. Their function is unknown. Probab=33.56 E-value=41 Score=15.68 Aligned_cols=32 Identities=19% Similarity=0.298 Sum_probs=25.4 Q ss_pred HHHHHHHCCCCC----CCHHHHHHHHHHHHHHHHHH Q ss_conf 997313206888----89899999999999999999 Q gi|254781182|r 42 RIEGNKAVHEGQ----SSIEESDECLEFVNLFCDIV 73 (94) Q Consensus 42 R~~gN~a~H~g~----~~~edA~~ll~f~~~il~~~ 73 (94) --..|-.+|+.. ++.+||.+.+.++..+..++ T Consensus 89 ~~~RNp~aH~~~~~~~~~~~dale~L~l~S~l~r~l 124 (124) T pfam09509 89 GAYRNPTAHEPRINWPDTEQDALELLALLSLLHRLL 124 (124) T ss_pred HHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC T ss_conf 870794134666678899999999999999998739 No 13 >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Probab=32.88 E-value=43 Score=15.57 Aligned_cols=31 Identities=19% Similarity=0.262 Sum_probs=23.0 Q ss_pred HHHHHHHHHHHHHHHHCCCCCC----CHHHHHHHH Q ss_conf 9999999999973132068888----989999999 Q gi|254781182|r 33 EIFEWSNFVRIEGNKAVHEGQS----SIEESDECL 63 (94) Q Consensus 33 ~i~~~~~~~R~~gN~a~H~g~~----~~edA~~ll 63 (94) .+..++++.|..|-+|+|+|++ +.+=|+.|. T Consensus 62 ~~dkIi~Aa~~tGA~AIHPGYGFLSENa~FA~a~~ 96 (645) T COG4770 62 DIDKIIDAARRTGAQAIHPGYGFLSENADFAQAVE 96 (645) T ss_pred CHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH T ss_conf 68899999997383213688421235989999999 No 14 >smart00580 PUG domain in protein kinases, N-glycanases and other nuclear proteins. Probab=32.00 E-value=39 Score=15.83 Aligned_cols=26 Identities=15% Similarity=0.068 Sum_probs=17.7 Q ss_pred HHHHHHHHHHHHCCCCCCC-HHHHHHH Q ss_conf 9999999731320688889-8999999 Q gi|254781182|r 37 WSNFVRIEGNKAVHEGQSS-IEESDEC 62 (94) Q Consensus 37 ~~~~~R~~gN~a~H~g~~~-~edA~~l 62 (94) .-+.+|..+|+.-|..+.+ ..+.++. T Consensus 3 vrdLLR~iRNk~~Hy~el~~p~~~~~~ 29 (58) T smart00580 3 VRDLLRALRNILHHPREEKGNPAIKER 29 (58) T ss_pred HHHHHHHHHHHHHHHHHCCCCHHHHHH T ss_conf 899999998002135341698999998 No 15 >pfam07126 DUF1379 Protein of unknown function (DUF1379). This family consists of several hypothetical bacterial proteins of around 180 residues in length. The function of this family is unknown. Probab=31.49 E-value=42 Score=15.63 Aligned_cols=41 Identities=12% Similarity=0.158 Sum_probs=33.2 Q ss_pred HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99731320688889899999999999999999861599999 Q gi|254781182|r 42 RIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKE 82 (94) Q Consensus 42 R~~gN~a~H~g~~~~edA~~ll~f~~~il~~~~t~P~~ie~ 82 (94) +..-+.|..+..|+.|||.-.+.|.+.+-.--++.|..++- T Consensus 17 k~L~~~a~~~~~FsvdDAa~Y~~~~E~~~~l~ls~~~~~el 57 (154) T pfam07126 17 KMLVPDAFKEQEFSVEDAALYQQFKEQLASLDLSDAQRVQL 57 (154) T ss_pred HHCCHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHH T ss_conf 32885240478867889999999999984389988999999 No 16 >pfam11848 DUF3368 Domain of unknown function (DUF3368). This domain is functionally uncharacterized. This domain is found in bacteria and archaea. This presumed domain is about 50 amino acids in length. Probab=26.60 E-value=56 Score=14.92 Aligned_cols=29 Identities=24% Similarity=0.186 Sum_probs=21.5 Q ss_pred CCHHHHHHHHHHCCCCCHHHHHHHHHHHHHH Q ss_conf 8899999999986899989999999999973 Q gi|254781182|r 15 GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEG 45 (94) Q Consensus 15 g~l~dri~~L~~~g~I~~~i~~~~~~~R~~g 45 (94) ||+.= +..++++|+|+ +++.+++.++..| T Consensus 4 GTlgi-L~~ak~~G~I~-~vkp~l~~l~~~g 32 (48) T pfam11848 4 GTLGI-LLLAKRKGLIS-EVKPLLDALIDAG 32 (48) T ss_pred EEHHH-HHHHHHCCCHH-HHHHHHHHHHHCC T ss_conf 30799-99999959804-5689999999949 No 17 >pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00988. The small chain has a GATase domain in the carboxyl terminus. See pfam00117. Probab=24.56 E-value=54 Score=15.00 Aligned_cols=29 Identities=24% Similarity=0.316 Sum_probs=22.1 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCHHHHH Q ss_conf 89999999999973132068888989999 Q gi|254781182|r 32 EEIFEWSNFVRIEGNKAVHEGQSSIEESD 60 (94) Q Consensus 32 ~~i~~~~~~~R~~gN~a~H~g~~~~edA~ 60 (94) -.+..+.+.++..|-+|+|+|++-..+.. T Consensus 60 l~~~~Ii~ia~~~~~~aihpGyGflsEn~ 88 (109) T pfam00289 60 LNIERILDIAEKEGADAIHPGYGFLSENA 88 (109) T ss_pred CCHHHHHHHHHHHCCCEEECCCCCCCCCH T ss_conf 37999999999818896877976233599 No 18 >pfam09969 DUF2203 Uncharacterized conserved protein (DUF2203). This domain, found in various hypothetical bacterial proteins, has no known function. Probab=23.37 E-value=64 Score=14.56 Aligned_cols=35 Identities=20% Similarity=0.162 Sum_probs=21.3 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 88989999999999999999986159999987527 Q gi|254781182|r 53 QSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTH 87 (94) Q Consensus 53 ~~~~edA~~ll~f~~~il~~~~t~P~~ie~~~~~~ 87 (94) .||.++|..++-.+..++..+...-..++++.+.+ T Consensus 2 ~FTleEA~~lLP~l~~~l~~~~~~~~el~el~~~l 36 (120) T pfam09969 2 YFTLEEANELLPELRRLLEEVREAKAELEELEAAL 36 (120) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 45899999989999999999999999999999988 No 19 >PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Probab=20.94 E-value=72 Score=14.27 Aligned_cols=25 Identities=24% Similarity=0.207 Sum_probs=20.7 Q ss_pred HHHHHHHHHHHHHHHCCCCCCCHHH Q ss_conf 9999999999731320688889899 Q gi|254781182|r 34 IFEWSNFVRIEGNKAVHEGQSSIEE 58 (94) Q Consensus 34 i~~~~~~~R~~gN~a~H~g~~~~ed 58 (94) +..+....+..|-+|+|+|++-..+ T Consensus 66 ~~~Ii~~A~~~g~dAiHPGYGFLSE 90 (458) T PRK12833 66 PAAILAAARQCGADAIHPGYGFLSE 90 (458) T ss_pred HHHHHHHHHHHCCCEEECCCCHHHH T ss_conf 9999999998299999768662552 No 20 >PRK07187 ribonucleotide-diphosphate reductase subunit alpha; Validated Probab=20.72 E-value=73 Score=14.24 Aligned_cols=43 Identities=16% Similarity=0.137 Sum_probs=30.5 Q ss_pred CCCCCCCCHHHHHHHHHHCCCCCHHHHHHH--HHHHHHHHHHCCC Q ss_conf 896544889999999998689998999999--9999973132068 Q gi|254781182|r 9 INFEKCGMLSDRTRYLKQHNLIIEEIFEWS--NFVRIEGNKAVHE 51 (94) Q Consensus 9 l~~~k~g~l~dri~~L~~~g~I~~~i~~~~--~~~R~~gN~a~H~ 51 (94) .+.-...++.+||++|.++|+-++.+.+.. ..|.....-+-|. T Consensus 43 ~~~~~f~s~~e~~~~l~~~~~y~~~~l~~Y~~e~i~~l~~~i~~~ 87 (722) T PRK07187 43 PNQMAFNSLEEKLAYLVNNNYYEQAILDAYSNDQIKELFHYAYQQ 87 (722) T ss_pred HHCCCCCCHHHHHHHHHHCCCCCHHHHHHCCHHHHHHHHHHHHHC T ss_conf 514235899999999997698559999758999999999775133 Done!