Query gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 78 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 05:42:03 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781184.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG3828 consensus 27.9 31 0.0008 16.6 1.4 27 4-32 152-178 (457) 2 smart00186 FBG Fibrinogen-rela 26.4 31 0.00079 16.6 1.1 12 56-67 40-51 (212) 3 pfam00147 Fibrinogen_C Fibrino 24.5 35 0.0009 16.3 1.1 11 57-67 41-51 (221) 4 cd00087 FReD Fibrinogen-relate 23.1 39 0.00099 16.1 1.1 12 56-67 41-52 (215) 5 COG5341 Uncharacterized protei 21.3 74 0.0019 14.6 2.4 50 6-58 17-67 (132) 6 KOG2869 consensus 18.0 67 0.0017 14.8 1.5 22 34-55 80-101 (379) 7 KOG2579 consensus 16.4 67 0.0017 14.8 1.1 11 57-67 160-170 (338) 8 TIGR02468 sucrsPsyn_pln sucros 16.3 38 0.00098 16.1 -0.1 22 53-74 406-427 (1072) 9 PRK06934 flavodoxin; Provision 15.8 39 0.001 16.1 -0.2 15 12-26 135-149 (221) 10 COG2983 Uncharacterized conser 12.6 96 0.0024 13.9 1.1 23 33-55 124-146 (153) No 1 >KOG3828 consensus Probab=27.94 E-value=31 Score=16.60 Aligned_cols=27 Identities=37% Similarity=0.755 Sum_probs=17.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHEEEE Q ss_conf 57888999999899998789987622236 Q gi|254781184|r 4 AINHLFINIFYPILWYTFPLMILISIQIS 32 (78) Q Consensus 4 ainhlfinifypilwytfplmilisiqis 32 (78) -+|+|| .+||..||-+|+..-..+--+ T Consensus 152 ~l~llF--l~ypv~~yl~~~~f~~d~f~~ 178 (457) T KOG3828 152 RLNLLF--LSYPVGWYLPPILFYADIFRS 178 (457) T ss_pred HHHHHH--HCCCHHHHHHHHHHHHHHHHH T ss_conf 999987--236158888888876659999 No 2 >smart00186 FBG Fibrinogen-related domains (FReDs). Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous. Probab=26.37 E-value=31 Score=16.63 Aligned_cols=12 Identities=42% Similarity=0.811 Sum_probs=9.3 Q ss_pred EEEEEEEEEECH Q ss_conf 213433653000 Q gi|254781184|r 56 ERKWIVFQRRAE 67 (78) Q Consensus 56 erkwivfqrrae 67 (78) ..-|+|+|||-. T Consensus 40 gGGWtViQrR~d 51 (212) T smart00186 40 GGGWTVIQRRMD 51 (212) T ss_pred CCCEEEEEEECC T ss_conf 997699998317 No 3 >pfam00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain. Probab=24.55 E-value=35 Score=16.34 Aligned_cols=11 Identities=55% Similarity=1.105 Sum_probs=9.1 Q ss_pred EEEEEEEEECH Q ss_conf 13433653000 Q gi|254781184|r 57 RKWIVFQRRAE 67 (78) Q Consensus 57 rkwivfqrrae 67 (78) .-|+|+|||.. T Consensus 41 GGWtVIQrR~d 51 (221) T pfam00147 41 GGWTVFQRRQD 51 (221) T ss_pred CCEEEEEEECC T ss_conf 97599998327 No 4 >cd00087 FReD Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation. Probab=23.13 E-value=39 Score=16.10 Aligned_cols=12 Identities=42% Similarity=0.844 Sum_probs=9.5 Q ss_pred EEEEEEEEEECH Q ss_conf 213433653000 Q gi|254781184|r 56 ERKWIVFQRRAE 67 (78) Q Consensus 56 erkwivfqrrae 67 (78) ..-|+|+|||-. T Consensus 41 ggGWtViQrR~d 52 (215) T cd00087 41 GGGWTVIQRRGD 52 (215) T ss_pred CCCEEEEEEECC T ss_conf 997599998317 No 5 >COG5341 Uncharacterized protein conserved in bacteria [Function unknown] Probab=21.32 E-value=74 Score=14.55 Aligned_cols=50 Identities=28% Similarity=0.450 Sum_probs=28.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEECCCCHH-HHHHHEEEE Q ss_conf 88899999989999878998762223689997325642184201-211101213 Q gi|254781184|r 6 NHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVK-KTAYFVERK 58 (78) Q Consensus 6 nhlfinifypilwytfplmilisiqisimisirgriirenpivk-ktayfverk 58 (78) --|+|-.|-||+...+.--- --.---||+.|+.+|+-|.-| ...|+++.+ T Consensus 17 v~LiI~sf~~i~~f~~a~~~---kG~~A~i~v~Gk~~r~i~l~Kg~~t~~v~~~ 67 (132) T COG5341 17 VMLIILSFLPILLFSLAKAK---KGAVAEISVDGKVIRTIPLTKGNETFDVKEN 67 (132) T ss_pred HHHHHHHHHHHHHHEEEECC---CCCEEEEEECCEEEEEEECCCCCCCEEEECC T ss_conf 48999999999852144025---7827999987789999983558734899748 No 6 >KOG2869 consensus Probab=18.00 E-value=67 Score=14.79 Aligned_cols=22 Identities=41% Similarity=0.685 Sum_probs=18.7 Q ss_pred EEEEEEEEEECCCCHHHHHHHE Q ss_conf 9997325642184201211101 Q gi|254781184|r 34 MISIRGRIIRENPIVKKTAYFV 55 (78) Q Consensus 34 misirgriirenpivkktayfv 55 (78) .+-++||-|-||+.||-.||.. T Consensus 80 ~L~~KGrti~eNe~Vk~GaYHT 101 (379) T KOG2869 80 VLRLKGRTIEENEYVKMGAYHT 101 (379) T ss_pred EEEEEEEEEEECCCCCCCCEEE T ss_conf 8999400212434110244057 No 7 >KOG2579 consensus Probab=16.38 E-value=67 Score=14.80 Aligned_cols=11 Identities=45% Similarity=0.930 Sum_probs=8.3 Q ss_pred EEEEEEEEECH Q ss_conf 13433653000 Q gi|254781184|r 57 RKWIVFQRRAE 67 (78) Q Consensus 57 rkwivfqrrae 67 (78) -.|.|||||-. T Consensus 160 GGWTviQrR~d 170 (338) T KOG2579 160 GGWTVIQRRED 170 (338) T ss_pred CCEEEEEEECC T ss_conf 98899997027 No 8 >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819 Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound . This compound is produced by the combined action of two enzymes, sucrose-phosphate synthase (2.4.1.14 from EC) and sucrose-phosphate phosphatase (3.1.3.24 from EC), via the intermediate sucrose 6-phosphate. Several studies have shown a positive correlation between sucrose-phosphate synthase activity and plant growth rate and yield in agronomically important plants, though direct proof of a causal link is lacking. This entry represents sucrose-phosphate synthase from plants, which is known to exist in multigene families in several species of both monocots and dicots. The enzyme contains an N-terminal domain glucosyltransferase domain, a variable linker region, and a C-terminal domain similar to that of sucrose-phosphate phosphatase, the next and final enzyme of sucrose biosynthesis. The C-terminal domain is likely to serve a binding - not a catalytic - function, as sucrose-phosphate phosphatase is always encoded by a distinct protein. ; GO: 0046524 sucrose-phosphate synthase activity, 0005985 sucrose metabolic process. Probab=16.29 E-value=38 Score=16.13 Aligned_cols=22 Identities=41% Similarity=0.739 Sum_probs=17.9 Q ss_pred HHEEEEEEEEEEECHHHHHHHH Q ss_conf 1012134336530000232230 Q gi|254781184|r 53 YFVERKWIVFQRRAENCYARFI 74 (78) Q Consensus 53 yfverkwivfqrraencyarfi 74 (78) -.+|||-=+=+||.-|||.||. T Consensus 406 ~~LerkLRaR~rRgVsC~GRfM 427 (1072) T TIGR02468 406 VVLERKLRARARRGVSCYGRFM 427 (1072) T ss_pred CEEEHHHHHCCCCCCCCCCCCC T ss_conf 0110102211126864246527 No 9 >PRK06934 flavodoxin; Provisional Probab=15.77 E-value=39 Score=16.08 Aligned_cols=15 Identities=47% Similarity=1.236 Sum_probs=10.7 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999899998789987 Q gi|254781184|r 12 IFYPILWYTFPLMIL 26 (78) Q Consensus 12 ifypilwytfplmil 26 (78) +=||+-|+++|..+. T Consensus 135 lGyPiWw~t~p~~v~ 149 (221) T PRK06934 135 IGYPIWWYKMPMVMY 149 (221) T ss_pred ECCCHHHCCCCHHHH T ss_conf 877556413768999 No 10 >COG2983 Uncharacterized conserved protein [Function unknown] Probab=12.59 E-value=96 Score=13.95 Aligned_cols=23 Identities=30% Similarity=0.469 Sum_probs=15.3 Q ss_pred EEEEEEEEEEECCCCHHHHHHHE Q ss_conf 89997325642184201211101 Q gi|254781184|r 33 IMISIRGRIIRENPIVKKTAYFV 55 (78) Q Consensus 33 imisirgriirenpivkktayfv 55 (78) --||+|||.+.|.....--.|.| T Consensus 124 a~isvrg~~v~e~~v~D~~d~iv 146 (153) T COG2983 124 AGISVRGRTVSESEVIDWEDHIV 146 (153) T ss_pred CCCEEECCEECCCCHHHHHHHHC T ss_conf 58103132322243304999861 Done!