RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 26.1 bits (57), Expect = 2.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 11/48 (22%) Query: 2 NEAINHLFINIFYPILWYTFPLM-ILISIQISIMISI---RGRIIREN 45 N A NH F + Y F ++ I+I+ +++ I +G+ IREN Sbjct: 1647 NRADNH-FKDT------YGFSILDIVINNPVNLTIHFGGEKGKRIREN 1687 Score = 24.9 bits (54), Expect = 4.9 Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 14/45 (31%) Query: 20 TFPLMIL--ISIQISI---------MISIRGRIIRE--NPIVKKT 51 +P L ++ S+ M+SI + +E V KT Sbjct: 313 AYPNTSLPPSILEDSLENNEGVPSPMLSISN-LTQEQVQDYVNKT 356 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.335 0.148 0.467 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 721,206 Number of extensions: 26713 Number of successful extensions: 92 Number of sequences better than 10.0: 1 Number of HSP's gapped: 92 Number of HSP's successfully gapped: 5 Length of query: 78 Length of database: 5,693,230 Length adjustment: 47 Effective length of query: 31 Effective length of database: 4,553,762 Effective search space: 141166622 Effective search space used: 141166622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.4 bits)