RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781185|ref|YP_003065598.1| hypothetical protein CLIBASIA_05460 [Candidatus Liberibacter asiaticus str. psy62] (42 letters) >gnl|CDD|163209 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). Length = 235 Score = 31.0 bits (71), Expect = 0.072 Identities = 7/34 (20%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Query: 10 IIFGLVLVLSGCSIGEQKKNN-----SVKKYFNK 38 ++ L+L+L+GCS ++K+ + ++ + + Sbjct: 6 LLLALLLLLAGCSSKKKKEADPVEEWPAEELYEE 39 >gnl|CDD|184569 PRK14212, PRK14212, camphor resistance protein CrcB; Provisional. Length = 128 Score = 28.6 bits (64), Expect = 0.37 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 5 NIGINIIFGLVLVLSGCSIGEQKKNNS 31 NI N++ GL++V G +G K NS Sbjct: 102 NILANVLLGLLMVFIGAYLGSLLKQNS 128 >gnl|CDD|149279 pfam08139, LPAM_1, Prokaryotic membrane lipoprotein lipid attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached. Length = 19 Score = 24.8 bits (56), Expect = 5.0 Identities = 4/15 (26%), Positives = 11/15 (73%) Query: 8 INIIFGLVLVLSGCS 22 + ++ +L+L+GC+ Sbjct: 4 LLLLLLALLLLAGCA 18 >gnl|CDD|182215 PRK10060, PRK10060, RNase II stability modulator; Provisional. Length = 663 Score = 24.3 bits (53), Expect = 7.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 13 GLVLVLSGCSIG 24 GL+ V +GCSIG Sbjct: 348 GLIEVYTGCSIG 359 >gnl|CDD|151401 pfam10954, DUF2755, Protein of unknown function (DUF2755). Some members in this family of proteins are annotated as YaiY however no function is known. The family appears to be restricted to Enterobacteriaceae. Length = 100 Score = 24.4 bits (53), Expect = 7.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 2 VSKNIGINIIFGLVLVLSGCSI 23 V +G+ IFGL+ L GC I Sbjct: 65 VEIGLGVGTIFGLIPFLIGCLI 86 >gnl|CDD|182698 PRK10750, PRK10750, potassium transporter; Provisional. Length = 483 Score = 23.6 bits (51), Expect = 9.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 8 INIIFGLVLVLSGCSIG 24 IN I + L++SGC+ G Sbjct: 238 INTIIAIFLLISGCNYG 254 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.385 Gapped Lambda K H 0.267 0.0753 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 604,251 Number of extensions: 20596 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 11 Length of query: 42 Length of database: 5,994,473 Length adjustment: 16 Effective length of query: 26 Effective length of database: 5,648,745 Effective search space: 146867370 Effective search space used: 146867370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.0 bits)