BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781185|ref|YP_003065598.1| hypothetical protein CLIBASIA_05460 [Candidatus Liberibacter asiaticus str. psy62] (42 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781185|ref|YP_003065598.1| hypothetical protein CLIBASIA_05460 [Candidatus Liberibacter asiaticus str. psy62] Length = 42 Score = 81.6 bits (200), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MVSKNIGINIIFGLVLVLSGCSIGEQKKNNSVKKYFNKLIQR 42 MVSKNIGINIIFGLVLVLSGCSIGEQKKNNSVKKYFNKLIQR Sbjct: 1 MVSKNIGINIIFGLVLVLSGCSIGEQKKNNSVKKYFNKLIQR 42 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 10 IIFGLVLVLSGCSIGEQKKNNSVKKYFNK 38 II+GL L + +IGE+ N + + +K Sbjct: 121 IIYGLALRRTLITIGEEMVNAAYEASLDK 149 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 20.4 bits (41), Expect = 6.0, Method: Compositional matrix adjust. Identities = 6/14 (42%), Positives = 13/14 (92%) Query: 27 KKNNSVKKYFNKLI 40 K N+++K++FNK++ Sbjct: 1682 KNNHAIKEWFNKIL 1695 >gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] Length = 397 Score = 20.0 bits (40), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 22 SIGEQKKNNSVK 33 SI E+K+NNS K Sbjct: 29 SIQEEKRNNSTK 40 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.140 0.385 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,721 Number of Sequences: 1233 Number of extensions: 702 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 42 length of database: 328,796 effective HSP length: 16 effective length of query: 26 effective length of database: 309,068 effective search space: 8035768 effective search space used: 8035768 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)