RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] (45 letters) >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298 Score = 25.1 bits (54), Expect = 4.3 Identities = 6/24 (25%), Positives = 12/24 (50%) Query: 3 HQYNPDAIVLYANGIGAVTANYLE 26 + Y ++YA G+GA + + Sbjct: 20 YAYTELEAIMYALGVGASIKDPKD 43 >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Length = 592 Score = 24.7 bits (53), Expect = 4.9 Identities = 8/34 (23%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYL-ENLNYSPI 33 +YN + + N G A L +L Y + Sbjct: 471 YLVEYNECPVYIELNSTGVSVAKSLYMDLEYEGV 504 >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332 Score = 24.7 bits (53), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 5 YNPDAIVLYANGIGA 19 YN +++YA GIG Sbjct: 54 YNQRDLLMYAVGIGE 68 >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280 Score = 24.2 bits (52), Expect = 7.8 Identities = 4/17 (23%), Positives = 10/17 (58%) Query: 3 HQYNPDAIVLYANGIGA 19 +++ ++LY +GA Sbjct: 7 WRFDDRDVILYNIALGA 23 >3khp_A MAOC family protein; ssgcid, NIH, niaid, decode, university of washington, emerald biostructures, SBRI, dehydrogenase; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311 Score = 24.0 bits (51), Expect = 7.9 Identities = 6/17 (35%), Positives = 10/17 (58%) Query: 3 HQYNPDAIVLYANGIGA 19 ++ +LYA G+GA Sbjct: 38 FEWTDRDTLLYAIGVGA 54 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.314 0.131 0.369 Gapped Lambda K H 0.267 0.0498 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 372,734 Number of extensions: 10393 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's gapped: 31 Number of HSP's successfully gapped: 6 Length of query: 45 Length of database: 5,693,230 Length adjustment: 18 Effective length of query: 27 Effective length of database: 5,256,838 Effective search space: 141934626 Effective search space used: 141934626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.6 bits)