RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] (252 letters) >gnl|CDD|100085 cd06164, S2P-M50_SpoIVFB_CBS, SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 227 Score = 33.3 bits (77), Expect = 0.074 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Query: 15 RILKAILSRWRKSKLSAL---GSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVA 71 R+L+A+L R L A VG F + L LGL L++ + L L ++A Sbjct: 160 RVLRALLWRRTGDYLKATRIAAWVGRGFAVL---LIILGLL---SLFLNLLGGLWLILIA 213 Query: 72 F 72 + Sbjct: 214 W 214 >gnl|CDD|32177 COG1994, SpoIVFB, Zn-dependent proteases [General function prediction only]. Length = 230 Score = 29.2 bits (65), Expect = 1.1 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 RILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVH-YLWVIFVSSLSLAIVAFG 73 R+L+A+L R + ++A+ + ++ + G LGL ++ L +I + S A+ A Sbjct: 165 RVLRALLPRRYGAAIAAIELAALLGLLVLILAGILGLLVLNPPLRLIDLFVYSGALSALQ 224 Query: 74 V 74 Sbjct: 225 S 225 >gnl|CDD|34234 COG4603, COG4603, ABC-type uncharacterized transport system, permease component [General function prediction only]. Length = 356 Score = 28.2 bits (63), Expect = 2.2 Identities = 11/53 (20%), Positives = 22/53 (41%) Query: 14 KRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLS 66 + K +S LS L ++ + ++ +L L LG + +FV + Sbjct: 1 IELEKRPKRSRLRSILSPLIAILLALIVGALLLLLLGYDPLAAYSALFVGAFG 53 >gnl|CDD|146578 pfam04018, DUF368, Domain of unknown function (DUF368). Predicted transmembrane domain of unknown function. Family members have between 6 and 9 predicted transmembrane segments. Length = 250 Score = 27.9 bits (63), Expect = 3.1 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Query: 9 GILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSL 44 G+LS ++L +L ++R + L+ L G ++ SL Sbjct: 194 GLLSFSKLLSYLLKKYRDATLAFL--TG--LMLGSL 225 >gnl|CDD|38355 KOG3145, KOG3145, KOG3145, Cystine transporter Cystinosin [Amino acid transport and metabolism]. Length = 372 Score = 26.5 bits (58), Expect = 8.0 Identities = 12/48 (25%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Query: 24 WRK-SKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIF-VSSLSLAI 69 W++ SK ALG + +F++ + + Y + +L + +S + LA+ Sbjct: 227 WQRVSKGIALGILAIFWLFAVVFMYVAYWYVIRWLAFLNNLSYIKLAM 274 >gnl|CDD|35965 KOG0746, KOG0746, KOG0746, 60S ribosomal protein L3 and related proteins [Translation, ribosomal structure and biogenesis]. Length = 384 Score = 26.2 bits (57), Expect = 8.0 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Query: 115 TQYDRYE-VIYNFGG-PMYGVIVPDFIHDLLDIPEEKRRLNT---SYLTYVDR 162 T YD E I GG P YG ++ DF+ + K+R+ T S L R Sbjct: 286 TDYDLTEKSITPMGGFPHYGEVINDFVMLKGCVVGPKKRVVTLRKSLLKQTKR 338 >gnl|CDD|177250 MTH00206, ND4, NADH dehydrogenase subunit 4; Provisional. Length = 450 Score = 26.4 bits (59), Expect = 8.3 Identities = 11/48 (22%), Positives = 17/48 (35%), Gaps = 7/48 (14%) Query: 44 LPLGALGLYEVHYLWVIFVSSLSLAIVAFGV-------EECLRLNDIK 84 L LG G+ + + S + G+ CLR D+K Sbjct: 232 LKLGGYGMMRIILILGPSTKLSSYFFIILGLWGSIMTSSICLRQTDLK 279 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.404 Gapped Lambda K H 0.267 0.0664 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,089,598 Number of extensions: 164128 Number of successful extensions: 421 Number of sequences better than 10.0: 1 Number of HSP's gapped: 419 Number of HSP's successfully gapped: 23 Length of query: 252 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 160 Effective length of database: 4,275,709 Effective search space: 684113440 Effective search space used: 684113440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (25.5 bits)