RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] (252 letters) >gnl|CDD|179840 PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional. Length = 296 Score = 28.6 bits (65), Expect = 1.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 29 LSALGSVGVFFVIFSLPLGALGLYEVHYLW 58 LG G+ +++ +L LGA LY L+ Sbjct: 230 PVLLGMAGLLYLVVALLLGAWFLYYAWRLY 259 >gnl|CDD|177996 PLN02368, PLN02368, alanine transaminase. Length = 407 Score = 27.8 bits (62), Expect = 2.6 Identities = 9/31 (29%), Positives = 18/31 (58%) Query: 203 ISLYVDPLTPRDISFTQYEKHACALVNWLEK 233 + L V+P P DIS+ Q+ + + ++ L + Sbjct: 335 MGLMVNPPKPGDISYDQFVRESKGILESLRR 365 >gnl|CDD|182866 PRK10958, PRK10958, leucine export protein LeuE; Provisional. Length = 212 Score = 27.9 bits (63), Expect = 2.6 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 25 RKSKLSALGS--VGVFFVIFSLPLGALGL 51 R+ KL+A G+ VG+ FV F+ L Sbjct: 184 RRKKLAAGGNSLVGLLFVGFAAKLATATS 212 >gnl|CDD|102369 PRK06424, PRK06424, transcription factor; Provisional. Length = 144 Score = 27.6 bits (61), Expect = 3.3 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 4/81 (4%) Query: 172 TPVVYDNKYRPSAEAMRTICPTK--LMKIFEDTISLYVDPLTPRDISFTQYEKHACALVN 229 TPV+ NK++ E ++ P K ++ ++ Y + D+ E +A + N Sbjct: 34 TPVIEHNKFKEVKEDIKVKLPEKKIIVPTYKKAYKKYKKKASDEDLDIV--EDYAELVKN 91 Query: 230 WLEKGKFNEMSIARKAFNRRS 250 E+ ++ +A K F R++ Sbjct: 92 ARERLSMSQADLAAKIFERKN 112 >gnl|CDD|171459 PRK12388, PRK12388, fructose-1,6-bisphosphatase II-like protein; Reviewed. Length = 321 Score = 27.3 bits (60), Expect = 4.3 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 88 EQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVI 134 E+A QL +K + + V A+ C Q + Y+V+Y GG GVI Sbjct: 171 EEATQLGVKVFALPDGDVAAS-VLTCW-QDNPYDVMYTIGGAPEGVI 215 >gnl|CDD|166304 PLN02663, PLN02663, hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase. Length = 431 Score = 27.2 bits (60), Expect = 4.7 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 150 RRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPT 193 R L+ + ++DR LL R P + +Y+P +M+T T Sbjct: 173 RGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQP-PPSMKTPLET 215 >gnl|CDD|150410 pfam09731, Mitofilin, Mitochondrial inner membrane protein. Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence rich in positive-charged and hydroxylated residues and a membrane anchor domain. In addition, it has three centrally located coiled coil domains. Length = 561 Score = 27.0 bits (60), Expect = 5.1 Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Query: 79 RLNDIKYEEEQAIQLKIKE------DSASERLVKATEAC 111 +L ++K EEE+ ++ +KE E L+ E Sbjct: 246 KLAELKAEEEEELERALKEKREELLSKLEEELLARLEEK 284 >gnl|CDD|185057 PRK15102, PRK15102, trimethylamine N-oxide reductase I catalytic subunit; Provisional. Length = 825 Score = 26.6 bits (59), Expect = 6.8 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Query: 98 DSASERLVKATEACACLTQYDRYE----VIYNFGGP 129 D + +L +AT A CL + ++Y+ + +F GP Sbjct: 785 DIGTSQLAQATSAHTCLVEIEKYQGKVPPVTSFNGP 820 >gnl|CDD|183603 PRK12574, PRK12574, putative monovalent cation/H+ antiporter subunit B; Reviewed. Length = 141 Score = 26.2 bits (58), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 59 VIFVSSLSLAIVAFGVEECL 78 +IF S+ L +AFGVEE L Sbjct: 42 LIFSSAFILMFLAFGVEEVL 61 >gnl|CDD|130580 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1), which are modelled by the corresponding TIGR01116 and TIGR01522. This model is well separated from the two others. Length = 941 Score = 26.3 bits (58), Expect = 9.1 Identities = 8/48 (16%), Positives = 14/48 (29%), Gaps = 2/48 (4%) Query: 31 ALGSVGVFFVIF-SLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEEC 77 V V F + L ++ + + LSL I + Sbjct: 892 FTFGFQVIIVEFGGSFFSTVSLSIEQWIGCVLLGMLSL-IFGVLLRLI 938 >gnl|CDD|150772 pfam10136, SpecificRecomb, Site-specific recombinase. Members of this family of bacterial proteins are found in various putative site-specific recombinase transmembrane proteins. Length = 647 Score = 26.0 bits (58), Expect = 9.8 Identities = 14/46 (30%), Positives = 18/46 (39%), Gaps = 11/46 (23%) Query: 32 LGSVGVFFVIFSLPLGALGLYEV-HYLWVIFVS-SLSLAIVAFGVE 75 LG F LPL +V H V S +L A+ A G + Sbjct: 546 LGLTPAIGAFFGLPL------DVRH---VTLSSANLGYALGALGFD 582 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.138 0.404 Gapped Lambda K H 0.267 0.0756 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,152,726 Number of extensions: 262956 Number of successful extensions: 512 Number of sequences better than 10.0: 1 Number of HSP's gapped: 512 Number of HSP's successfully gapped: 23 Length of query: 252 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 161 Effective length of database: 4,028,145 Effective search space: 648531345 Effective search space used: 648531345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (25.3 bits)