RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] (252 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 51.5 bits (123), Expect = 2e-07 Identities = 62/433 (14%), Positives = 113/433 (26%), Gaps = 202/433 (46%) Query: 1 MKKASMRNGILSIKRILKAIL---------SRWRKSKLSALGS----------------- 34 M S R LS + +L S+ ++ L Sbjct: 1 MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAEL 60 Query: 35 VGVF--FVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIK------YE 86 VG F +V + +G ++ L+L + F L NDI + Sbjct: 61 VGKFLGYVSSLVEPSKVGQFD---------QVLNLCLTEF-ENCYLEGNDIHALAAKLLQ 110 Query: 87 EEQAIQLKIKEDSASERLVKA-TEACACLTQ-YDRYEV-------------IYN-FGGP- 129 E +K K L+K A + +D+ + FGG Sbjct: 111 ENDTTLVKTK------ELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQG 164 Query: 130 --------------MYGVIVPDFIH------------------------DL---LDIPEE 148 Y V+V D I ++ L+ P Sbjct: 165 NTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPS- 223 Query: 149 KRRLNTSYLTYVDR-----GLL-----------------DVRS--------SETPVV--- 175 + YL + G++ ++RS S+ V Sbjct: 224 -NTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVA 282 Query: 176 ------YDNKYRPSAEAMRTI------C----PTKLM--KIFEDTISLYVDPLTP----R 213 +++ + +A+ + C P + I ED++ +P Sbjct: 283 IAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSIS 342 Query: 214 DISFTQYEKH--------------ACALVN-------------------WLEKGKF-NEM 239 +++ Q + + +LVN L K K + + Sbjct: 343 NLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGL 402 Query: 240 SIARKAFNRRSQR 252 +R F S+R Sbjct: 403 DQSRIPF---SER 412 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 40.8 bits (94), Expect = 3e-04 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 6/28 (21%) Query: 87 EEQAIQ-----LKI-KEDSASERLVKAT 108 E+QA++ LK+ +DSA +KAT Sbjct: 18 EKQALKKLQASLKLYADDSAPALAIKAT 45 Score = 29.2 bits (64), Expect = 0.95 Identities = 7/28 (25%), Positives = 13/28 (46%), Gaps = 9/28 (32%) Query: 185 EAMRTICPTKLMKIFEDTISLYVDPLTP 212 +A++ KL + ++ LY D P Sbjct: 20 QALK-----KL----QASLKLYADDSAP 38 Score = 27.3 bits (59), Expect = 4.0 Identities = 7/23 (30%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Query: 74 VEECLRLNDIKYEEEQAIQLKIK 96 ++ L+L Y ++ A L IK Sbjct: 25 LQASLKL----YADDSAPALAIK 43 Score = 26.5 bits (57), Expect = 6.8 Identities = 9/31 (29%), Positives = 13/31 (41%), Gaps = 11/31 (35%) Query: 148 EK---RRLNTSYLTYVDRGLLDVRSSETPVV 175 EK ++L S Y D D S+ P + Sbjct: 18 EKQALKKLQASLKLYAD----D--SA--PAL 40 >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION binding, metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Score = 29.4 bits (66), Expect = 0.89 Identities = 11/46 (23%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 10 ILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVH 55 +L++KR+L+A L W+ + L + + +I G + V Sbjct: 5 LLTLKRMLRACLRAWKDKEFQVLFVLTILTLIS----GTIFYSTVE 46 >3kg2_A Glutamate receptor 2; ION channel, membrane protein, alternative splicing, cell membrane, glycoprotein, ION transport, membrane; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Score = 27.6 bits (60), Expect = 2.6 Identities = 14/60 (23%), Positives = 23/60 (38%) Query: 20 ILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLR 79 +L + + G G AL L V ++ I V L LA++ +E C + Sbjct: 749 LLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK 808 >3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii} Length = 224 Score = 26.1 bits (57), Expect = 8.3 Identities = 10/47 (21%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 15 RILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIF 61 RIL+AILS+ S + + + + + GL ++ + ++ Sbjct: 151 RILRAILSKKYGYLKSTKIAANIGKSLALI-MLLFGLLSMNIILILV 196 >3gb5_A IYD-1, iodotyrosine dehalogenase 1; iodide salvage, flavoprotein, FMN, membrane, NADP, oxidoreductase, transmembrane; HET: FMN; 2.00A {Mus musculus} PDB: 3gfd_A* 3gh8_A* Length = 259 Score = 26.0 bits (56), Expect = 8.9 Identities = 5/41 (12%), Positives = 11/41 (26%) Query: 110 ACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKR 150 + AC + + + LL P ++ Sbjct: 182 SIACGLLLAALQNAGLVTVTTTPLNCGPRLRVLLGRPSHEK 222 >1f6g_A Voltage-gated potassium channel; integral membrane protein, cytoplasmic domains, proton transport, membrane protein; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 160 Score = 25.7 bits (56), Expect = 9.2 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 6 MRNGILSIKRILKAILSR-WRKSKLSALGSVGVFFVIFSLPLGALGLY 52 M +G+L+ R++K +L R +A G+ V VI L G+ Sbjct: 4 MLSGLLA--RLVKLLLGRHGSALHWAAAGAATVLLVIVLL-AGSYLAV 48 >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Score = 26.0 bits (56), Expect = 9.2 Identities = 7/28 (25%), Positives = 15/28 (53%) Query: 206 YVDPLTPRDISFTQYEKHACALVNWLEK 233 + + +T D S+ +Y + +C L L+ Sbjct: 44 FTNAVTGVDYSYAEYLEKSCCLGKALQN 71 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.138 0.404 Gapped Lambda K H 0.267 0.0435 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 2,183,552 Number of extensions: 99526 Number of successful extensions: 222 Number of sequences better than 10.0: 1 Number of HSP's gapped: 219 Number of HSP's successfully gapped: 15 Length of query: 252 Length of database: 5,693,230 Length adjustment: 90 Effective length of query: 162 Effective length of database: 3,511,270 Effective search space: 568825740 Effective search space used: 568825740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.7 bits)