Query gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 233 No_of_seqs 140 out of 347 Neff 7.7 Searched_HMMs 39220 Date Tue May 31 16:02:16 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781190.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 cd04859 Prim_Pol Prim_Pol: Pri 99.9 1.4E-20 3.5E-25 137.7 12.4 120 2-131 30-151 (152) 2 pfam09250 Prim-Pol Bifunctiona 99.8 6.8E-18 1.7E-22 122.2 12.8 117 2-124 37-159 (161) 3 pfam08707 PriCT_2 Primase C te 99.7 2.4E-17 6.1E-22 119.1 6.1 60 169-233 1-60 (74) 4 cd00525 AE_Prim_S_like AE_Prim 99.1 1.9E-10 4.9E-15 79.2 6.0 91 2-110 29-134 (136) 5 pfam08800 VirE_N VirE N-termin 90.0 0.98 2.5E-05 23.3 5.6 50 22-71 30-80 (136) 6 pfam03090 Replicase Replicase 81.7 2.5 6.5E-05 20.9 4.2 45 24-71 26-72 (137) 7 COG4983 Uncharacterized conser 49.5 18 0.00046 16.0 4.5 93 5-103 62-159 (495) 8 KOG3946 consensus 41.9 17 0.00043 16.2 1.9 33 196-231 171-203 (338) 9 TIGR02778 ligD_pol DNA polymer 35.9 30 0.00076 14.7 4.6 41 25-66 120-168 (251) 10 TIGR02525 plasmid_TraJ plasmid 35.0 17 0.00044 16.1 1.0 32 10-50 147-178 (374) 11 CHL00023 ndhK NADH dehydrogena 33.6 33 0.00083 14.5 2.4 54 90-143 97-160 (225) 12 pfam04534 Herpes_UL56 Herpesvi 25.9 42 0.0011 13.9 1.7 18 16-33 28-45 (198) 13 TIGR02706 P_butyryltrans phosp 22.3 48 0.0012 13.5 1.5 26 12-37 108-133 (295) 14 KOG1663 consensus 22.2 53 0.0013 13.3 2.6 26 13-38 79-114 (237) 15 pfam06174 DUF987 Protein of un 20.7 44 0.0011 13.8 1.0 22 104-126 26-47 (66) No 1 >cd04859 Prim_Pol Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol). These primpol domains belong to the archaeal/eukaryal primase (AEP) superfamily. This group includes archaeal plasmids and bacteriophage AEPs. The ORF904 protein is a multifunctional protein having ATPase, primase and DNA polymerase activity, and may play a role in the replication of the archaeal plasmid. The pRN1 primpol domain exhibits DNA polymerase and primase activities; a cluster of active site residues (three acidic residues, and a histidine) is required for both these activities. For pRN1 primpol, the primase activity prefers dNTPs to rNTPs; incorporation of dNTPs requires rNTP as cofactor. The pRN1 primpol contains an unusual zinc-binding stem, which is not conserved in other members of this group. Probab=99.85 E-value=1.4e-20 Score=137.70 Aligned_cols=120 Identities=13% Similarity=0.079 Sum_probs=83.2 Q ss_pred CHHHHHCCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHH--HHHHHCCCCEEEECCCCCEEEEEECCCCCCCCCCCC Q ss_conf 237875186168899707884888999954898467899999--776408986298678895399984474312433577 Q gi|254781190|r 2 VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNN--EFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSE 79 (233) Q Consensus 2 va~~~~~~p~~giGi~~G~~s~~l~~iDiD~~d~~~~~~~~~--~~~~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~~~ 79 (233) |..+++++|.+||||.||+ +||++||||..+.... .+.. ....++..+....+..+++|+|||+|+...... .. T Consensus 30 i~~w~~~~p~~niGi~~G~--sglvviDiD~~~~~~~-~~~~~~~~~~l~~~t~~~~T~~gG~H~~f~~p~~~~~~~-~~ 105 (152) T cd04859 30 IEAWWRDGPDANIGLRTGP--SGLVVIDIDVKHDGAA-ALAALAELGKLPPLTLTVRTGSGGRHLYFRVPDGVPVKS-VK 105 (152) T ss_pred HHHHHHHCCCCCEEEECCC--CCEEEEECCCCCCCHH-HHHHHHHCCCCCCCCEEEECCCCCEEEEEECCCCCCCCC-CC T ss_conf 9999985998448888288--8779997326776346-899877615778777478869994499998999862233-22 Q ss_pred CCCCCCEEEEECCCEEEECCCCCCCCCCEEEECCCCCCCHHHCCCCCHHHHH Q ss_conf 7676635898458328953668888884574216776882236768999999 Q gi|254781190|r 80 EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVE 131 (233) Q Consensus 80 ~~~~~~iEi~~~g~q~V~~g~hp~Tg~~Y~W~~~~~~~~~~~lP~~~~~~l~ 131 (233) .....+||||+.|+|+|+|||+|.+|++|.|.. .. +++.+|.|+++ T Consensus 106 ~~~~~~vDir~~g~yvV~pPS~~~~g~~y~~~~---~~---~~~~~P~wl~~ 151 (152) T cd04859 106 GKGGPGIDIRGGGGYVVAPPSVHPGGGYYVWKS---TV---DPAPAPEWLLD 151 (152) T ss_pred CCCCCCEEEEECCCEEECCCCCCCCCCEEEECC---CC---CCCCCCHHHHC T ss_conf 476786789835988981786848964698089---99---86678867863 No 2 >pfam09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal. Members of this family adopt a structure consisting of a core of antiparallel beta sheets. They are found in various bacterial hypothetical proteins, and have been shown to harbour both primase and polymerase activities. Probab=99.78 E-value=6.8e-18 Score=122.21 Aligned_cols=117 Identities=15% Similarity=0.091 Sum_probs=77.4 Q ss_pred CHHHHHCCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHH--HHCCCCEEEECCCCCEEEEEECCCCCCCCCCC- Q ss_conf 237875186168899707884888999954898467899999776--40898629867889539998447431243357- Q gi|254781190|r 2 VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ--SCCGKPISRVGQAPKTLMLFRMQETNLKKQKS- 78 (233) Q Consensus 2 va~~~~~~p~~giGi~~G~~s~~l~~iDiD~~d~~~~~~~~~~~~--~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~~- 78 (233) |..++.++|.+||||+||+ +++++||||..+... .+..+.. ..++.+....+.++++|+|||+|......... T Consensus 37 i~~w~~~~p~~nigv~~g~--~~lvviDiD~~~~~~--~l~~l~~~~~~lp~t~~~~T~~gG~H~~fr~p~~~~~~~~~~ 112 (161) T pfam09250 37 IRRWWARNPGANIGLPTGR--SGLVVLDVDTKAGGD--ALAALERAGGPLPPTLVVRTPSGGRHLYFRVPDGPELKRNLL 112 (161) T ss_pred HHHHHHCCCCCCEEEECCC--CCEEEEECCCCCCHH--HHHHHHHHCCCCCCCEEEECCCCCEEEEEECCCCCCCCCCCC T ss_conf 9999860999528887089--857999576765448--999999854888886168889997799997788864367522 Q ss_pred --CCCCCCCEEEEECC-CEEEECCCCCCCCCCEEEECCCCCCCHHHCCC Q ss_conf --77676635898458-32895366888888457421677688223676 Q gi|254781190|r 79 --EEKIQGHLEFLAYG-QQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124 (233) Q Consensus 79 --~~~~~~~iEi~~~g-~q~V~~g~hp~Tg~~Y~W~~~~~~~~~~~lP~ 124 (233) ......+||||++| +|+|+|||.+..| .|+|..+ .+.+++++|. T Consensus 113 ~~~~~~~~gvDir~~g~~yvv~ppS~~~~g-~Y~w~~~-~~~~~~~~P~ 159 (161) T pfam09250 113 FAKDGGGGGIDIRAGGGGYVVAPPSVHPGG-PYEWTGG-TPLPPAPAPE 159 (161) T ss_pred CCCCCCCCCEEEECCCCCEEEECCCCCCCE-EEEEECC-CCCCCCCCCC T ss_conf 102678998798538962899579537983-2898159-9888778988 No 3 >pfam08707 PriCT_2 Primase C terminal 2 (PriCT-2). This alpha helical domain is found at the C terminal of primases. Probab=99.70 E-value=2.4e-17 Score=119.05 Aligned_cols=60 Identities=33% Similarity=0.591 Sum_probs=55.0 Q ss_pred HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHCC Q ss_conf 99999973580013567457999998763027886226799999861388998678999862079 Q gi|254781190|r 169 EIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233 (233) Q Consensus 169 ~a~~~L~~i~~~~~~~dyd~W~~vg~AL~~~~~~~~~~l~lw~~WS~~~~~y~~~~~~~~W~sF~ 233 (233) +++++|.+|+|. .+|++|++||||||+++ ++.++++|++||++++||++++|+++|+||+ T Consensus 1 ~~~~~L~~i~~~---~dy~~W~~vG~aL~~~~--~~~~~~lw~~wS~~~~ky~~~~~~~~W~sf~ 60 (74) T pfam08707 1 DAREALDFIPPR---DDYDSWLRVGMALKHEF--GEEGLELWDEWSAKSSKYDPGECERKWDSFK 60 (74) T ss_pred CHHHHHHCCCCC---CCHHHHHHHHHHHHHCC--CHHHHHHHHHHHCCCCCCCHHHHHHHHHHCC T ss_conf 988997238986---88899999999998266--6579999999974656588378999998377 No 4 >cd00525 AE_Prim_S_like AE_Prim_S_like: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases. The replication machineries of A/Es are distinct from that of bacteria. Primases are DNA-dependent RNA polymerases which synthesis the short RNA primers required for DNA replication. In eukaryotes, this small catalytically active primase subunit (p50) and a larger primase subunit (p60), referred to jointly as the core primase, associate with the B subunit and the DNA polymerase alpha subunit in a complex, called Pol alpha-pri. In addition to its catalytic role in replication, eukaryotic DNA primase may play a role in coupling replication to DNA damage repair and in checkpoint control during S phase. Pfu41 and Pfu46 comprise the primase complex of the archaea Pyrococcus furiosus; these proteins have sequence identity to the eukaryotic p50 and p60 primase proteins respectively. Pfu41 preferentially uses dNTPs as substrate. Pfu46 regulates the pri Probab=99.09 E-value=1.9e-10 Score=79.23 Aligned_cols=91 Identities=14% Similarity=0.153 Sum_probs=65.2 Q ss_pred CHHHHHCCCCCCEEEEECCC----CCCEEEEEEECCCH---HHHHHHHHHHHHHCC-----CCEEEECCCCCEEEEEECC Q ss_conf 23787518616889970788----48889999548984---678999997764089-----8629867889539998447 Q gi|254781190|r 2 VATDVDHYVYNGFGILCGIG----THPVYAFDVDVLDE---QVVDRFNNEFQSCCG-----KPISRVGQAPKTLMLFRMQ 69 (233) Q Consensus 2 va~~~~~~p~~giGi~~G~~----s~~l~~iDiD~~d~---~~~~~~~~~~~~~~~-----~~~~~~g~~~~~~~lfr~~ 69 (233) +.+++.+++..+||+.||.. ..++++||+|..+. ........++.+++. +.++++|+ +|+|++|+. T Consensus 29 ~~~w~~~~~~~~i~~~~~~~~~~~~~~~lv~DlD~~~~~~~~~~~~~a~~~~~ll~~~~~~~~~~~TG~-~G~H~~~~~- 106 (136) T cd00525 29 ILAWLANLPPGNIGLSLGRYDKLWKPDLLVFDLDPDDYDCWEDVKEAALLLRELLDEDGLNTLVVTSGS-RGLHVYVRL- 106 (136) T ss_pred HHHHHHHCCCEEEECCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCC-CEEEEEEEC- T ss_conf 999886338575017766567567998799826899999899999999999999988499554374389-834999976- Q ss_pred CCCCCCCCCCCCCCCCEEEEEC--CCEEEECCCCCC-CCCCEEE Q ss_conf 4312433577767663589845--832895366888-8884574 Q gi|254781190|r 70 ETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIHPK-TQRAYTW 110 (233) Q Consensus 70 ~~~~~~~~~~~~~~~~iEi~~~--g~q~V~~g~hp~-Tg~~Y~W 110 (233) ||++++ |+|+|+|+|++. .+..+.| T Consensus 107 ----------------iD~~~~~~~~~~v~p~S~~~~~~~~p~~ 134 (136) T cd00525 107 ----------------IDIRVNARGRLLVAPPSVHPRPGGPPSW 134 (136) T ss_pred ----------------CHHHCCCCCCEEECCCCCCCCCCCCCCC T ss_conf ----------------4564357897276365566899897877 No 5 >pfam08800 VirE_N VirE N-terminal domain. This presumed domain is found at the N-terminus of VirE proteins. Probab=90.01 E-value=0.98 Score=23.31 Aligned_cols=50 Identities=12% Similarity=0.182 Sum_probs=29.8 Q ss_pred CCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEECCCC-CEEEEEECCCC Q ss_conf 488899995489846789999977640898629867889-53999844743 Q gi|254781190|r 22 THPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP-KTLMLFRMQET 71 (233) Q Consensus 22 s~~l~~iDiD~~d~~~~~~~~~~~~~~~~~~~~~~g~~~-~~~~lfr~~~~ 71 (233) .+|+++||||..+.+....+.+.+...+-+...-++.+| +.+.+.++..+ T Consensus 30 ~sgli~lDiD~l~~ee~~~~r~~l~~dp~t~~~FvSpSG~GvKi~V~~~~~ 80 (136) T pfam08800 30 YNGLVCLDVDHLAKEELERVKQKAAALPYTVLAFISSSGRGVKIWVRFDRP 80 (136) T ss_pred CCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEEECCC T ss_conf 688089982899989999999998469948999985799879999997577 No 6 >pfam03090 Replicase Replicase family. This is a family of bacterial plasmid DNA replication initiator proteins. Pfam: PF01051 is a similar family. These RepA proteins exist as monomers and dimers in equilibrium: monomers bind directly to repeated DNA sequences and thus activate replication; dimers repress repA transcription by binding an inversely repeated DNA operator. Dimer dissociation can occur spontaneously or be mediated by Hsp70 chaperones. Probab=81.69 E-value=2.5 Score=20.92 Aligned_cols=45 Identities=9% Similarity=-0.010 Sum_probs=25.5 Q ss_pred CEEEEEEECCCHHHHHHHHHHHHH-HC-CCCEEEECCCCCEEEEEECCCC Q ss_conf 889999548984678999997764-08-9862986788953999844743 Q gi|254781190|r 24 PVYAFDVDVLDEQVVDRFNNEFQS-CC-GKPISRVGQAPKTLMLFRMQET 71 (233) Q Consensus 24 ~l~~iDiD~~d~~~~~~~~~~~~~-~~-~~~~~~~g~~~~~~~lfr~~~~ 71 (233) ..++||||-.+... ...|... ++ +.+....-..|++|++|....+ T Consensus 26 ~~lV~DiD~~~a~~---~~~w~~~~lp~Pn~i~~Np~nghaHl~y~L~~P 72 (137) T pfam03090 26 SWLVVDIDHPGAKA---RLDWEDEGLPAPNWIVRNPANGHAHLIWLLDAP 72 (137) T ss_pred EEEEEECCCCCCHH---HHHHHHCCCCCCEEEEECCCCCEEEEEEEECCC T ss_conf 88998437878255---545876599998089887999848899996784 No 7 >COG4983 Uncharacterized conserved protein [Function unknown] Probab=49.53 E-value=18 Score=16.00 Aligned_cols=93 Identities=10% Similarity=0.044 Sum_probs=46.8 Q ss_pred HHHCCCCCCEEEEECCCCCCEEEEEEEC-CCHH---HHHHHHHHHHHHCCCCEEEECCCCCEEEEEECCCCCCCCCCCCC Q ss_conf 8751861688997078848889999548-9846---78999997764089862986788953999844743124335777 Q gi|254781190|r 5 DVDHYVYNGFGILCGIGTHPVYAFDVDV-LDEQ---VVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEE 80 (233) Q Consensus 5 ~~~~~p~~giGi~~G~~s~~l~~iDiD~-~d~~---~~~~~~~~~~~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~~~~ 80 (233) .|++|.-.|||..--.. +..+.||.|. +|.. +-....+....++++...-|-...+.|++=+...-+... T Consensus 62 alt~y~fdGIGFvFaen-~~~v~iDlDgcrd~~tGel~~~A~e~ir~l~nSytE~S~SGtGiHiigkg~~~p~gG----- 135 (495) T COG4983 62 ALTEYDFDGIGFVFAEN-NDDVPIDLDGCRDLDTGELKKSAQEKIRDLLNSYTEFSESGTGIHIIGKGEGIPIGG----- 135 (495) T ss_pred HHHHCCCCCEEEEECCC-CCCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCC----- T ss_conf 98724556436896037-898663641024234566566678888764556651256886279995056235665----- Q ss_pred CCCCCEEEEECCCEEEECC-CCCC Q ss_conf 6766358984583289536-6888 Q gi|254781190|r 81 KIQGHLEFLAYGQQFVAYN-IHPK 103 (233) Q Consensus 81 ~~~~~iEi~~~g~q~V~~g-~hp~ 103 (233) ....-.|...+++.++.-| ..++ T Consensus 136 rR~gn~EmY~d~rF~~ftg~~vld 159 (495) T COG4983 136 RRYGNPEMYADCRFGEFTGVDVLD 159 (495) T ss_pred CCCCCHHHCCCCCEEEECCCCCCC T ss_conf 567882014555337640641145 No 8 >KOG3946 consensus Probab=41.86 E-value=17 Score=16.17 Aligned_cols=33 Identities=24% Similarity=0.491 Sum_probs=22.7 Q ss_pred HHHCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHH Q ss_conf 630278862267999998613889986789998620 Q gi|254781190|r 196 IHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231 (233) Q Consensus 196 L~~~~~~~~~~l~lw~~WS~~~~~y~~~~~~~~W~s 231 (233) |.-.|=++| +.+.+||.+.+-|-....+++|.| T Consensus 171 L~LvFFDGE---EAf~eW~p~DSlYGsRhLA~~~~s 203 (338) T KOG3946 171 LQLVFFDGE---EAFEEWGPEDSLYGSRHLAAKWES 203 (338) T ss_pred EEEEEECCH---HHHHHCCCCCCCCHHHHHHHHHHC T ss_conf 899995558---888633975663057899998740 No 9 >TIGR02778 ligD_pol DNA polymerase LigD, polymerase domain; InterPro: IPR014145 DNA repair of double-stranded breaks by non-homologous end joining (NHEJ) is accomplished by a two-protein system that is present in a minority of prokaryotes. One component is the Ku protein (see IPR009187 from INTERPRO), which binds DNA ends. The other is a DNA ligase, a protein that is a multidomain polypeptide in most of those bacteria that have NheJ, a permuted polypeptide in Mycobacterium tuberculosis and a few other species, and the product of tandem genes in some other bacteria. This region represents the C-terminal polymerase domain.. Probab=35.89 E-value=30 Score=14.74 Aligned_cols=41 Identities=10% Similarity=-0.001 Sum_probs=17.8 Q ss_pred EEEEEEECCCHHH-------HHHHHHHHHHHC-CCCEEEECCCCCEEEEE Q ss_conf 8999954898467-------899999776408-98629867889539998 Q gi|254781190|r 25 VYAFDVDVLDEQV-------VDRFNNEFQSCC-GKPISRVGQAPKTLMLF 66 (233) Q Consensus 25 l~~iDiD~~d~~~-------~~~~~~~~~~~~-~~~~~~~g~~~~~~~lf 66 (233) =+++|+|...... +..+..++.++. .+=+.|||.+ |.|++- T Consensus 120 riVFDLDPgp~~~~~~vveAA~~~r~~L~~lgL~sFvKTSGGK-GLHv~v 168 (251) T TIGR02778 120 RIVFDLDPGPGVAWKLVVEAALLIRELLDELGLESFVKTSGGK-GLHVYV 168 (251) T ss_pred EEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCC-EEEEEE T ss_conf 6888158888657999999999999999871235644115897-038987 No 10 >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364 Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase (IPR013363 from INTERPRO) of a type-IV secretion-like system of the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii.. Probab=34.99 E-value=17 Score=16.14 Aligned_cols=32 Identities=13% Similarity=0.264 Sum_probs=18.2 Q ss_pred CCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHCC Q ss_conf 61688997078848889999548984678999997764089 Q gi|254781190|r 10 VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG 50 (233) Q Consensus 10 p~~giGi~~G~~s~~l~~iDiD~~d~~~~~~~~~~~~~~~~ 50 (233) |.+|.|++||.-.+| --+..+.+-+.+.+..+ T Consensus 147 P~~GLGLiCG~TGSG---------KSTl~AaiY~~~l~t~p 178 (374) T TIGR02525 147 PKAGLGLICGETGSG---------KSTLAAAIYRHCLETYP 178 (374) T ss_pred CCCCCEEECCCCCCC---------HHHHHHHHHHHHCCCCC T ss_conf 003780221778972---------89999999998507488 No 11 >CHL00023 ndhK NADH dehydrogenase subunit K Probab=33.56 E-value=33 Score=14.52 Aligned_cols=54 Identities=9% Similarity=0.071 Sum_probs=33.3 Q ss_pred ECCCEEEECCCCCCCCCCEEEEC-----C-----CCCCCHHHCCCCCHHHHHHHHHHHHHHCCC Q ss_conf 45832895366888888457421-----6-----776882236768999999999754420134 Q gi|254781190|r 90 AYGQQFVAYNIHPKTQRAYTWSI-----A-----PHALKVEELPLLTPDEVEYFFEFFDTITTP 143 (233) Q Consensus 90 ~~g~q~V~~g~hp~Tg~~Y~W~~-----~-----~~~~~~~~lP~~~~~~l~~~~~~~~~~~~~ 143 (233) -.=.+||++|+-..+|+.|+|.. + |-+..++--|--|+.++++++..-++.+.. T Consensus 97 PePK~VIAmGaCA~sGG~F~~dsYsvv~GvD~iIPVDVyIPGCPPrPEAiidaI~kLqkKi~~e 160 (225) T CHL00023 97 PEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAITKLRKKISRE 160 (225) T ss_pred CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCEECCCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 9985699856645788744579850115777214513676898869899999999999999766 No 12 >pfam04534 Herpes_UL56 Herpesvirus UL56 protein. In herpes simplex virus type 2, UL56 is thought to be a tail-anchored type II membrane protein involved in vesicular trafficking. The C terminal hydrophobic region is required for association with the cytoplasmic membrane, and the N terminal proline-rich region is important for the translocation of UL56 to the Golgi apparatus and cytoplasmic vesicles. Probab=25.93 E-value=42 Score=13.89 Aligned_cols=18 Identities=22% Similarity=0.276 Sum_probs=13.1 Q ss_pred EEECCCCCCEEEEEEECC Q ss_conf 970788488899995489 Q gi|254781190|r 16 ILCGIGTHPVYAFDVDVL 33 (233) Q Consensus 16 i~~G~~s~~l~~iDiD~~ 33 (233) -+.|.+.+.+++||||+. T Consensus 28 SlsGrneG~fvvididtp 45 (198) T pfam04534 28 SLSGRNEGRFVVIDIDTP 45 (198) T ss_pred CCCCCCCCCEEEEECCCC T ss_conf 235667775588855787 No 13 >TIGR02706 P_butyryltrans phosphate butyryltransferase; InterPro: IPR014079 Members of this family are phosphate butyryltransferase enzymes, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. This entry does not include the homologue from Thermotoga maritima, whose activity on butyryl-CoA is only 30 0f its activity with acetyl-CoA.. Probab=22.27 E-value=48 Score=13.55 Aligned_cols=26 Identities=23% Similarity=0.298 Sum_probs=20.7 Q ss_pred CCEEEEECCCCCCEEEEEEECCCHHH Q ss_conf 68899707884888999954898467 Q gi|254781190|r 12 NGFGILCGIGTHPVYAFDVDVLDEQV 37 (233) Q Consensus 12 ~giGi~~G~~s~~l~~iDiD~~d~~~ 37 (233) .-+||+||+.=+++-++|+-..|+-. T Consensus 108 KE~GLRTGk~lSHVAVFe~P~~dRLl 133 (295) T TIGR02706 108 KEVGLRTGKVLSHVAVFEVPGFDRLL 133 (295) T ss_pred HHCCCCCCCCCCCEEEECCCCCCHHH T ss_conf 00121048712206771589855143 No 14 >KOG1663 consensus Probab=22.23 E-value=53 Score=13.32 Aligned_cols=26 Identities=19% Similarity=0.311 Sum_probs=15.9 Q ss_pred CEEEEEC----------CCCCCEEEEEEECCCHHHH Q ss_conf 8899707----------8848889999548984678 Q gi|254781190|r 13 GFGILCG----------IGTHPVYAFDVDVLDEQVV 38 (233) Q Consensus 13 giGi~~G----------~~s~~l~~iDiD~~d~~~~ 38 (233) -||+.|| +..+-++++|||-...+.+ T Consensus 79 elGvfTGySaL~~Alalp~dGrv~a~eid~~~~~~~ 114 (237) T KOG1663 79 ELGVFTGYSALAVALALPEDGRVVAIEIDADAYEIG 114 (237) T ss_pred EEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHH T ss_conf 981212789999997459996599996186888875 No 15 >pfam06174 DUF987 Protein of unknown function (DUF987). Family of bacterial proteins that are related to the hypothetical protein yeeT. Probab=20.74 E-value=44 Score=13.79 Aligned_cols=22 Identities=23% Similarity=0.477 Sum_probs=12.3 Q ss_pred CCCCEEEECCCCCCCHHHCCCCC Q ss_conf 88845742167768822367689 Q gi|254781190|r 104 TQRAYTWSIAPHALKVEELPLLT 126 (233) Q Consensus 104 Tg~~Y~W~~~~~~~~~~~lP~~~ 126 (233) ||+ |+|..+.....-.++|.++ T Consensus 26 tGk-Y~W~Gs~~hy~greV~di~ 47 (66) T pfam06174 26 TGK-YQWHGSACHYTGRDVPDIT 47 (66) T ss_pred CCC-CEECCCCCHHCCCCCCCCC T ss_conf 664-3051541020487545440 Done!